F444707

General Info

Members Datasets Scaffolds Average Seq Length
441 266 882 133

Family's Representative Sequence

Representative Sequence 3300041452|Ga0451793_1195368|Ga0451793_1195368_11_508
Length 165
Sequence MGEFPPLTHVALTVRDLSVSVPWYEALLDAEPVIDEDTDPDLHHTVYLVGGGTLIGLHQHGTVAPAGDFSEFRVGLDHVAFGVADRSELEKWAARLDELGIERGRIKDASYGSGVSFRDPDGIALEFFAPRPWFAEAVAMIRTGALSDEQIQQQAGELLAINAQG

Samples

Sample ID Description Type Environment
1 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
70 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
130 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
131 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
132 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
133 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
134 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
135 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
136 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
137 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
138 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
139 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
140 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
141 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
142 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
143 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
144 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
145 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
146 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
147 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
148 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
149 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
166 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
167 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
173 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
174 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
178 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
179 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
180 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
198 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
206 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
207 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
210 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
250 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
262 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
263 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.17
Nodule 0
Rhizoplane 3.85
Rhizosphere 91.84
Stem 0
Stem Tuber 0
Unclassified 4.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451793_1195368 3300041452 Bacteria 626
2 JGI25407J50210_10009241 3300003373 Bacteria 2494
3 JGI25407J50210_10021998 3300003373 Bacteria 1658
4 Ga0058860_11523538 3300004801 Bacteria 750
5 Ga0070676_11266869 3300005328 Bacteria 562
6 Ga0070683_101071096 3300005329 Bacteria 774
7 Ga0070683_101840633 3300005329 Bacteria 582
8 Ga0070682_100625119 3300005337 Bacteria 854
9 Ga0068868_101278766 3300005338 Bacteria 681
10 Ga0070689_100349252 3300005340 Bacteria 1240
11 Ga0070661_100338559 3300005344 Bacteria 1178
12 Ga0070668_100434309 3300005347 Bacteria 1126
13 Ga0070674_100665798 3300005356 Bacteria 886
14 Ga0070674_100736686 3300005356 Bacteria 846
15 Ga0070714_101252433 3300005435 Unclassified 724
16 Ga0070713_101368927 3300005436 Bacteria 686
17 Ga0070701_10176436 3300005438 Bacteria 1248
18 Ga0070705_100450679 3300005440 Bacteria 965
19 Ga0070694_100279783 3300005444 Bacteria 1272
20 Ga0070663_100215260 3300005455 Unclassified 1506
21 Ga0070663_100563048 3300005455 Bacteria 954
22 Ga0070678_100096470 3300005456 Bacteria 2281
23 Ga0070662_100216486 3300005457 Bacteria 1526
24 Ga0068867_100951109 3300005459 Bacteria 776
25 Ga0070706_100619855 3300005467 Bacteria 1005
26 Ga0070706_101001140 3300005467 Bacteria 771
27 Ga0070707_101015884 3300005468 Bacteria 795
28 Ga0070707_101128297 3300005468 Bacteria 750
29 Ga0070698_100967628 3300005471 Bacteria 798
30 Ga0070698_101085671 3300005471 Bacteria 749
31 Ga0070699_101555352 3300005518 Bacteria 606
32 Ga0070679_100842942 3300005530 Bacteria 860
33 Ga0070686_101287448 3300005544 Bacteria 610
34 Ga0070695_100028552 3300005545 Bacteria 3463
35 Ga0070695_100029977 3300005545 Bacteria 3384
36 Ga0070696_100010343 3300005546 Bacteria 6250
37 Ga0070704_100250180 3300005549 Bacteria 1455
38 Ga0068855_100123345 3300005563 Bacteria 2964
39 Ga0070664_100246144 3300005564 Bacteria 1606
40 Ga0068854_100112191 3300005578 Bacteria 2058
41 Ga0070702_100305895 3300005615 Bacteria 1102
42 Ga0068864_101122709 3300005618 Bacteria 783
43 Ga0081455_10022032 3300005937 Bacteria 5965
44 Ga0081538_10009630 3300005981 Bacteria 8034
45 Ga0081538_10058734 3300005981 Bacteria 2228
46 Ga0081540_1025990 3300005983 Bacteria 3354
47 Ga0081539_10049469 3300005985 Bacteria 2385
48 Ga0081539_10078569 3300005985 Bacteria 1742
49 Ga0081539_10192368 3300005985 Bacteria 949
50 Ga0075365_10198101 3300006038 Bacteria 1407
51 Ga0075363_100390209 3300006048 Bacteria 817
52 Ga0075363_100399653 3300006048 Bacteria 807
53 Ga0075363_100724189 3300006048 Bacteria 602
54 Ga0075364_10116513 3300006051 Bacteria 1786
55 Ga0075364_10166592 3300006051 Bacteria 1489
56 Ga0070712_100892914 3300006175 Bacteria 766
57 Ga0070712_100964368 3300006175 Bacteria 737
58 Ga0075367_10388141 3300006178 Bacteria 882
59 Ga0075428_100836125 3300006844 Bacteria 978
60 Ga0075433_10007263 3300006852 Bacteria 8779
61 Ga0075433_10843545 3300006852 Bacteria 800
62 Ga0075433_11067034 3300006852 Bacteria 703
63 Ga0075434_100163357 3300006871 Bacteria 2247
64 Ga0075434_100332098 3300006871 Bacteria 1541
65 Ga0068865_100613190 3300006881 Bacteria 921
66 Ga0075436_100974419 3300006914 Bacteria 636
67 Ga0075435_100607260 3300007076 Bacteria 949
68 Ga0075435_101024376 3300007076 Bacteria 721
69 Ga0105240_11719469 3300009093 Bacteria 655
70 Ga0111539_10330919 3300009094 Bacteria 1773
71 Ga0111539_10875279 3300009094 Bacteria 1045
72 Ga0111539_11656252 3300009094 Unclassified 742
73 Ga0111539_11698763 3300009094 Bacteria 732
74 Ga0105245_10008143 3300009098 Bacteria 9167
75 Ga0105245_10191736 3300009098 Bacteria 1958
76 Ga0105245_10237682 3300009098 Bacteria 1764
77 Ga0105245_11007797 3300009098 Bacteria 877
78 Ga0105245_11516935 3300009098 Bacteria 721
79 Ga0114129_10042676 3300009147 Bacteria 6384
80 Ga0114129_10120920 3300009147 Bacteria 3605
81 Ga0114129_10197251 3300009147 Bacteria 2729
82 Ga0114129_10591844 3300009147 Bacteria 1438
83 Ga0105243_10082252 3300009148 Bacteria 2631
84 Ga0105243_12466553 3300009148 Bacteria 559
85 Ga0105242_10005853 3300009176 Bacteria 9473
86 Ga0105242_10048121 3300009176 Bacteria 3464
87 Ga0105242_12218871 3300009176 Bacteria 594
88 Ga0105237_10932057 3300009545 Unclassified 875
89 Ga0105237_12037079 3300009545 Bacteria 583
90 Ga0105238_11121378 3300009551 Bacteria 810
91 Ga0105249_10517759 3300009553 Bacteria 1240
92 Ga0105249_10645735 3300009553 Bacteria 1116
93 Ga0105239_10244735 3300010375 Bacteria 2013
94 Ga0105239_11140508 3300010375 Bacteria 898
95 Ga0105246_10427120 3300011119 Bacteria 1107
96 Ga0105246_11557966 3300011119 Bacteria 623
97 Ga0157374_10582021 3300013296 Bacteria 1129
98 Ga0157378_10019097 3300013297 Bacteria 6023
99 Ga0157378_11640188 3300013297 Bacteria 689
100 Ga0163162_11101841 3300013306 Bacteria 900
101 Ga0163162_11795464 3300013306 Bacteria 701
102 Ga0163162_13350491 3300013306 Bacteria 512
103 Ga0163162_13368495 3300013306 Bacteria 511
104 Ga0157375_10864964 3300013308 Bacteria 1050
105 Ga0163163_10108009 3300014325 Bacteria 2809
106 Ga0163163_10773703 3300014325 Unclassified 1023
107 Ga0157380_10088560 3300014326 Bacteria 2548
108 Ga0157377_10042278 3300014745 Bacteria 2531
109 Ga0157379_11668694 3300014968 Bacteria 624
110 Ga0182005_1071289 3300015265 Bacteria 954
111 Ga0213873_10027484 3300021358 Bacteria 1388
112 Ga0213876_10132729 3300021384 Bacteria 1324
113 Ga0207642_10080233 3300025899 Bacteria 1582
114 Ga0207684_11210694 3300025910 Bacteria 625
115 Ga0207707_10044868 3300025912 Bacteria 3853
116 Ga0207671_10921872 3300025914 Unclassified 690
117 Ga0207657_10453408 3300025919 Bacteria 1006
118 Ga0207649_10177204 3300025920 Bacteria 1490
119 Ga0207646_10127639 3300025922 Bacteria 2287
120 Ga0207646_11469004 3300025922 Bacteria 591
121 Ga0207694_10788877 3300025924 Bacteria 802
122 Ga0207650_10818985 3300025925 Bacteria 789
123 Ga0207687_10034375 3300025927 Bacteria 3441
124 Ga0207687_10544156 3300025927 Bacteria 973
125 Ga0207687_11019831 3300025927 Bacteria 710
126 Ga0207690_10532392 3300025932 Bacteria 953
127 Ga0207706_10432167 3300025933 Bacteria 1140
128 Ga0207686_10018168 3300025934 Bacteria 3976
129 Ga0207686_10254245 3300025934 Bacteria 1285
130 Ga0207709_10056531 3300025935 Bacteria 2429
131 Ga0207670_10737771 3300025936 Bacteria 817
132 Ga0207669_10030769 3300025937 Bacteria 2988
133 Ga0207704_10528699 3300025938 Bacteria 955
134 Ga0207679_10204902 3300025945 Bacteria 1650
135 Ga0207667_10305412 3300025949 Bacteria 1626
136 Ga0207712_10411168 3300025961 Bacteria 1139
137 Ga0207712_10468180 3300025961 Bacteria 1072
138 Ga0207677_10951872 3300026023 Bacteria 776
139 Ga0207677_11658080 3300026023 Bacteria 592
140 Ga0207639_10424365 3300026041 Bacteria 1203
141 Ga0207678_10872194 3300026067 Bacteria 795
142 Ga0207678_11104321 3300026067 Unclassified 702
143 Ga0207641_10799936 3300026088 Bacteria 933
144 Ga0207648_10015140 3300026089 Bacteria 7099
145 Ga0207648_11018941 3300026089 Bacteria 776
146 Ga0207676_10547964 3300026095 Bacteria 1105
147 Ga0207676_10931259 3300026095 Bacteria 854
148 Ga0207675_100158369 3300026118 Bacteria 2159
149 Ga0207675_102101966 3300026118 Bacteria 581
150 Ga0207683_10205879 3300026121 Bacteria 1789
151 Ga0207683_11516283 3300026121 Bacteria 619
152 Ga0268264_11340464 3300028381 Bacteria 726
153 Ga0265327_10054670 3300031251 Bacteria 2065
154 Ga0307408_100184107 3300031548 Bacteria 1677
155 Ga0307408_102022635 3300031548 Bacteria 554
156 Ga0265314_10700048 3300031711 Bacteria 512
157 Ga0307405_10009750 3300031731 Bacteria 4938
158 Ga0307405_10175221 3300031731 Bacteria 1534
159 Ga0307405_10541730 3300031731 Bacteria 940
160 Ga0307413_10006024 3300031824 Bacteria 5490
161 Ga0307413_10956034 3300031824 Bacteria 731
162 Ga0307410_10011358 3300031852 Bacteria 5090
163 Ga0307410_10086287 3300031852 Bacteria 2217
164 Ga0307410_10192608 3300031852 Bacteria 1551
165 Ga0307410_10538192 3300031852 Bacteria 966
166 Ga0307406_10003563 3300031901 Bacteria 8488
167 Ga0307406_10241045 3300031901 Bacteria 1356
168 Ga0307406_10334833 3300031901 Bacteria 1176
169 Ga0307406_10551170 3300031901 Bacteria 943
170 Ga0307407_10023279 3300031903 Bacteria 3230
171 Ga0307407_10103267 3300031903 Bacteria 1774
172 Ga0307407_10492747 3300031903 Bacteria 897
173 Ga0307412_10279391 3300031911 Bacteria 1310
174 Ga0307412_11549819 3300031911 Bacteria 604
175 Ga0307409_100002712 3300031995 Bacteria 9346
176 Ga0307409_100007620 3300031995 Bacteria 6492
177 Ga0307409_100355883 3300031995 Bacteria 1383
178 Ga0307409_100698246 3300031995 Bacteria 1013
179 Ga0307409_100857708 3300031995 Bacteria 919
180 Ga0307409_100968906 3300031995 Bacteria 867
181 Ga0307409_101196438 3300031995 Bacteria 783
182 Ga0307416_100045411 3300032002 Bacteria 3459
183 Ga0307416_100088924 3300032002 Bacteria 2643
184 Ga0307416_100117346 3300032002 Bacteria 2362
185 Ga0307416_100276280 3300032002 Bacteria 1653
186 Ga0307416_101116486 3300032002 Bacteria 893
187 Ga0307416_101382427 3300032002 Bacteria 810
188 Ga0307414_10509426 3300032004 Bacteria 1066
189 Ga0307414_10737883 3300032004 Bacteria 894
190 Ga0307411_10018504 3300032005 Bacteria 3998
191 Ga0307411_10539900 3300032005 Bacteria 993
192 Ga0307415_100000152 3300032126 Bacteria 30589
193 Ga0307415_100001395 3300032126 Bacteria 11528
194 Ga0307415_100038779 3300032126 Bacteria 3142
195 Ga0307415_100200426 3300032126 Bacteria 1583
196 Ga0307415_100243033 3300032126 Bacteria 1457
197 Ga0307415_100885873 3300032126 Bacteria 821
198 Ga0373943_0096574 3300035170 Bacteria 1539
199 Ga0316574_0379405 3300035398 Bacteria 892
200 Ga0373935_0073312 3300035692 Bacteria 2212
201 Ga0373927_0145609 3300035695 Bacteria 1551
202 Ga0373927_0564440 3300035695 Bacteria 752
203 Ga0373933_0914920 3300035724 Bacteria 578
204 Ga0373947_0004411 3300035725 Bacteria 8254
205 Ga0373947_0036590 3300035725 Bacteria 2911
206 Ga0373947_1066396 3300035725 Bacteria 551
207 Ga0373937_0107189 3300036401 Bacteria 2598
208 Ga0395899_0465860 3300037312 Bacteria 825
209 Ga0395900_0133857 3300037418 Bacteria 2539
210 Ga0395900_0339007 3300037418 Bacteria 1479
211 Ga0395900_0820590 3300037418 Bacteria 857
212 Ga0395898_0176473 3300037466 Bacteria 2042
213 Ga0395898_1430402 3300037466 Bacteria 618
214 Ga0395905_0144873 3300037471 Bacteria 2235
215 Ga0395905_0507531 3300037471 Bacteria 1106
216 Ga0436364_0761130 3300037853 Bacteria 729
217 Ga0395901_0061184 3300038443 Bacteria 3918
218 Ga0395901_0402810 3300038443 Bacteria 1405
219 Ga0395901_0623946 3300038443 Bacteria 1084
220 Ga0436365_0044074 3300039437 Bacteria 1135
221 Ga0436365_1342596 3300039437 Bacteria 2306
222 Ga0436362_0572581 3300039453 Bacteria 554
223 Ga0436362_0672615 3300039453 Bacteria 6281
224 Ga0451795_1222202 3300041456 Bacteria 565
225 Ga0439450_018315 3300042008 Bacteria 1470
226 Ga0439450_021906 3300042008 Bacteria 1375
227 Ga0439450_037837 3300042008 Bacteria 1110
228 Ga0439451_019294 3300042009 Bacteria 1375
229 Ga0439454_022073 3300042011 Bacteria 945
230 Ga0439455_0008203 3300042012 Bacteria 2233
231 Ga0439455_0262252 3300042012 Unclassified 507
232 Ga0439456_051487 3300042013 Bacteria 900
233 Ga0439463_000641 3300042016 Bacteria 9678
234 Ga0439463_033151 3300042016 Bacteria 1306
235 Ga0439463_069487 3300042016 Bacteria 902
236 Ga0439463_112877 3300042016 Bacteria 702
237 Ga0450913_002237 3300042117 Bacteria 1168
238 Ga0450888_056219 3300042126 Bacteria 571
239 Ga0450900_001868 3300042136 Bacteria 2145
240 Ga0450902_003560 3300042137 Bacteria 2284
241 Ga0450905_001797 3300042142 Bacteria 2736
242 Ga0439458_0108396 3300042157 Bacteria 725
243 Ga0439444_0004284 3300042437 Bacteria 2066
244 Ga0439459_0201036 3300042438 Unclassified 544
245 Ga0439464_0000362 3300042439 Bacteria 8832
246 Ga0439460_0001778 3300042461 Bacteria 5119
247 Ga0450916_000052 3300042530 Bacteria 6518
248 Ga0439440_0000347 3300042993 Bacteria 7634
249 Ga0439440_0157089 3300042993 Bacteria 654
250 Ga0466965_0009820 3300044683 Bacteria 4452
251 Ga0466963_0750593 3300044694 Bacteria 688
252 Ga0466964_0080383 3300044706 Bacteria 1398
253 Ga0466958_0311372 3300045836 Bacteria 1011
254 Ga0466958_0684582 3300045836 Bacteria 668
255 Ga0466967_0342143 3300045976 Bacteria 1447
256 Ga0466967_0668938 3300045976 Bacteria 1027
257 Ga0495603_0016984 3300046455 Bacteria 4403
258 Ga0495603_0036996 3300046455 Bacteria 2929
259 Ga0495603_0052355 3300046455 Bacteria 2424
260 Ga0495603_0603592 3300046455 Bacteria 628
261 Ga0495591_088699 3300046458 Bacteria 779
262 Ga0495629_0001429 3300046459 Bacteria 18830
263 Ga0495641_0445995 3300046461 Bacteria 589
264 Ga0495653_0362140 3300046463 Bacteria 930
265 Ga0495580_0459316 3300046472 Bacteria 854
266 Ga0495582_0000338 3300046473 Bacteria 25659
267 Ga0495639_0039378 3300046475 Bacteria 2125
268 Ga0495664_0518145 3300046477 Unclassified 712
269 Ga0495584_0082046 3300046491 Bacteria 1623
270 Ga0495594_0422825 3300046499 Bacteria 758
271 Ga0495596_0149159 3300046500 Bacteria 908
272 Ga0495607_0103788 3300046501 Bacteria 1518
273 Ga0495607_0333340 3300046501 Unclassified 704
274 Ga0495583_0296821 3300046506 Bacteria 642
275 Ga0495608_0341732 3300046511 Bacteria 922
276 Ga0495618_0091784 3300046514 Bacteria 1942
277 Ga0495630_0125366 3300046517 Bacteria 1949
278 Ga0495630_0199994 3300046517 Bacteria 1525
279 Ga0495630_0310275 3300046517 Unclassified 1206
280 Ga0495630_1205191 3300046517 Unclassified 572
281 Ga0495631_0200444 3300046518 Bacteria 853
282 Ga0495644_0001468 3300046523 Bacteria 9617
283 Ga0495644_0002550 3300046523 Bacteria 7249
284 Ga0495644_0107631 3300046523 Unclassified 1057
285 Ga0495663_0016510 3300046525 Bacteria 2087
286 Ga0495666_0053699 3300046526 Bacteria 1933
287 Ga0495666_0133832 3300046526 Bacteria 1158
288 Ga0495665_0001371 3300046531 Bacteria 13031
289 Ga0495665_0255503 3300046531 Bacteria 902
290 Ga0495640_0106320 3300046533 Bacteria 1838
291 Ga0495586_0626572 3300046535 Bacteria 621
292 Ga0495598_0011586 3300046537 Bacteria 2142
293 Ga0495598_0044183 3300046537 Bacteria 1315
294 Ga0495609_0045076 3300046538 Bacteria 1977
295 Ga0495609_0058539 3300046538 Bacteria 1704
296 Ga0495621_0045334 3300046539 Bacteria 1557
297 Ga0495621_0169203 3300046539 Bacteria 867
298 Ga0495645_0220865 3300046543 Bacteria 1275
299 Ga0495622_0326731 3300046557 Bacteria 666
300 Ga0495633_0035948 3300046558 Bacteria 2376
301 Ga0495656_0000915 3300046615 Bacteria 9536
302 Ga0495656_0002098 3300046615 Bacteria 6586
303 Ga0495656_0016443 3300046615 Bacteria 2807
304 Ga0495668_0310906 3300046616 Bacteria 864
305 Ga0495634_0408806 3300046642 Bacteria 805
306 Ga0495611_0392967 3300046648 Bacteria 634
307 Ga0495635_0683328 3300046663 Bacteria 666
308 Ga0495635_0884716 3300046663 Bacteria 572
309 Ga0495659_0000574 3300046664 Bacteria 13527
310 Ga0495659_0012582 3300046664 Bacteria 2743
311 Ga0495588_0035489 3300046674 Bacteria 2527
312 Ga0495588_0047467 3300046674 Bacteria 2205
313 Ga0495647_0087291 3300046681 Unclassified 1274
314 Ga0495647_0212258 3300046681 Unclassified 852
315 Ga0495658_0000726 3300046683 Bacteria 17778
316 Ga0495658_0200433 3300046683 Bacteria 1244
317 Ga0495669_0049529 3300046684 Bacteria 1881
318 Ga0495669_0125821 3300046684 Bacteria 1204
319 Ga0495613_0000296 3300046689 Bacteria 45480
320 Ga0495613_0220717 3300046689 Bacteria 1331
321 Ga0495613_0380481 3300046689 Bacteria 965
322 Ga0495624_0237135 3300046690 Bacteria 1104
323 Ga0495624_0314946 3300046690 Unclassified 943
324 Ga0495624_0386775 3300046690 Bacteria 840
325 Ga0495624_0499561 3300046690 Bacteria 728
326 Ga0495624_0804155 3300046690 Bacteria 556
327 Ga0495670_0002507 3300046691 Bacteria 9073
328 Ga0495670_0045121 3300046691 Bacteria 2200
329 Ga0495670_0285084 3300046691 Bacteria 884
330 Ga0495671_0334268 3300046692 Unclassified 727
331 Ga0495589_0088395 3300046794 Bacteria 1505
332 Ga0495589_0113026 3300046794 Bacteria 1310
333 Ga0495600_0678492 3300046809 Bacteria 621
334 Ga0495581_0001112 3300047315 Bacteria 14690
335 Ga0495581_0195231 3300047315 Bacteria 1184
336 Ga0495636_0002792 3300047318 Bacteria 6740
337 Ga0495636_0100758 3300047318 Bacteria 1262
338 Ga0495636_0397161 3300047318 Bacteria 656
339 Ga0495674_0229556 3300047319 Bacteria 1532
340 Ga0495676_0612891 3300047321 Bacteria 708
341 Ga0495676_0616222 3300047321 Bacteria 706
342 Ga0495676_0703541 3300047321 Bacteria 654
343 Ga0495680_0071130 3300047322 Bacteria 2650
344 Ga0495680_0444492 3300047322 Bacteria 888
345 Ga0495677_0009486 3300047445 Bacteria 3595
346 Ga0495673_0348626 3300047469 Bacteria 523
347 Ga0495593_0280297 3300047673 Bacteria 834
348 Ga0495602_0281233 3300048088 Bacteria 1226
349 Ga0495614_0093551 3300048089 Bacteria 1309
350 Ga0495615_0038387 3300048090 Bacteria 1184
351 Ga0495615_0073679 3300048090 Bacteria 925
352 Ga0496102_0060238 3300048905 Bacteria 3472
353 Ga0496102_0595151 3300048905 Bacteria 1029
354 Ga0496108_0307072 3300048911 Bacteria 1382
355 Ga0496108_0464337 3300048911 Bacteria 1106
356 Ga0496109_0206841 3300048912 Bacteria 1845
357 Ga0496109_1640193 3300048912 Bacteria 577
358 Ga0496109_1924769 3300048912 Bacteria 524
359 Ga0496110_0111641 3300048913 Bacteria 2458
360 Ga0496110_0427049 3300048913 Bacteria 1208
361 Ga0496113_0325124 3300048916 Bacteria 1233
362 Ga0496113_0883043 3300048916 Unclassified 708
363 Ga0496113_0997018 3300048916 Bacteria 660
364 Ga0496114_0218482 3300048917 Bacteria 1673
365 Ga0496114_0908186 3300048917 Bacteria 762
366 Ga0496115_1255571 3300048918 Bacteria 554
367 Ga0501031_0023756 3300049568 Bacteria 3996
368 Ga0501032_0119610 3300049569 Bacteria 1742
369 Ga0501033_0025318 3300049570 Bacteria 4469
370 Ga0501034_0007153 3300049571 Bacteria 11911
371 Ga0501036_0030197 3300049572 Bacteria 4579
372 Ga0501037_0028547 3300049573 Bacteria 4121
373 Ga0501037_0677967 3300049573 Bacteria 687
374 Ga0501038_0042753 3300049574 Bacteria 3945
375 Ga0501038_0557826 3300049574 Bacteria 870
376 Ga0501039_0002512 3300049575 Bacteria 13672
377 Ga0501040_0001665 3300049576 Bacteria 14204
378 Ga0501041_0026980 3300049577 Bacteria 3459
379 Ga0501042_0003539 3300049578 Bacteria 9828
380 Ga0501043_0020821 3300049579 Bacteria 5144
381 Ga0501043_0029079 3300049579 Bacteria 4340
382 Ga0501046_0002411 3300049580 Bacteria 17522
383 Ga0501046_0005869 3300049580 Bacteria 10949
384 Ga0501047_0022951 3300049581 Bacteria 5989
385 Ga0501047_0110448 3300049581 Bacteria 2632
386 Ga0501048_0000274 3300049582 Bacteria 34657
387 Ga0501069_0397024 3300049585 Bacteria 816
388 Ga0501069_0505082 3300049585 Bacteria 721
389 Ga0501070_0009375 3300049586 Bacteria 8279
390 Ga0501071_0013627 3300049587 Bacteria 5543
391 Ga0501071_0194103 3300049587 Bacteria 1524
392 Ga0501071_0868706 3300049587 Bacteria 696
393 Ga0501072_0094416 3300049588 Bacteria 2376
394 Ga0501072_0481334 3300049588 Bacteria 982
395 Ga0501074_0014874 3300049590 Bacteria 5659
396 Ga0501074_0481106 3300049590 Bacteria 880
397 Ga0501075_0000372 3300049591 Bacteria 25794
398 Ga0501076_0000442 3300049592 Bacteria 26211
399 Ga0501077_0030886 3300049593 Bacteria 3409
400 Ga0501079_0001650 3300049741 Bacteria 15877
401 Ga0501080_0116169 3300049742 Bacteria 2480
402 Ga0501080_0766471 3300049742 Bacteria 848
403 Ga0501081_0006644 3300049743 Bacteria 7520
404 Ga0501081_0371608 3300049743 Bacteria 1056
405 Ga0501035_0067868 3300049822 Bacteria 3163
406 Ga0501044_0217353 3300049823 Bacteria 1863
407 Ga0501045_0001247 3300049824 Bacteria 16918
408 Ga0501045_0150909 3300049824 Bacteria 1729
409 nmdc:mga03n38_110637_c1 3300050490 Bacteria 1337
410 nmdc:mga03n38_643701_c1 3300050490 Bacteria 607
411 nmdc:mga00v17_105191_c1 3300050491 Bacteria 1785
412 nmdc:mga00v17_487001_c1 3300050491 Bacteria 800
413 nmdc:mga0yw44_381837_c1 3300050492 Bacteria 951
414 nmdc:mga06z11_720230_c1 3300050494 Bacteria 608
415 nmdc:mga05p37_103150_c1 3300050507 Bacteria 3511
416 nmdc:mga05p37_18307_c1 3300050507 Bacteria 8460
417 nmdc:mga05p37_375088_c1 3300050507 Bacteria 1668
418 nmdc:mga05p37_538301_c1 3300050507 Bacteria 1332
419 nmdc:mga09592_90497_c1 3300050508 Bacteria 2614
420 nmdc:mga0qj67_277048_c1 3300050509 Bacteria 1360
421 nmdc:mga06r32_222279_c1 3300050510 Bacteria 1877
422 nmdc:mga08y16_1193473_c1 3300050511 Bacteria 732
423 nmdc:mga08y16_739617_c1 3300050511 Bacteria 980
424 nmdc:mga08y16_844551_c1 3300050511 Bacteria 905
425 nmdc:mga0n895_120564_c1 3300050512 Bacteria 2644
426 nmdc:mga0n895_1610141_c1 3300050512 Bacteria 613
427 nmdc:mga0n895_9312_c1 3300050512 Bacteria 8581
428 nmdc:mga0rr50_594973_c1 3300050513 Bacteria 943
429 nmdc:mga0rr50_71495_c1 3300050513 Bacteria 2647
430 nmdc:mga08x19_645098_c1 3300050514 Bacteria 751
431 nmdc:mga0a205_1470186_c1 3300050515 Bacteria 529
432 nmdc:mga0a205_692212_c1 3300050515 Bacteria 869
433 nmdc:mga0a205_710_c1 3300050515 Bacteria 26727
434 Ga0495601_0195605 3300053077 Bacteria 1322
435 Ga0495595_0094568 3300053084 Bacteria 1437
436 Ga0495619_0138982 3300053085 Bacteria 1672
437 Ga0500616_0021569 3300053153 Unclassified 3608
438 Ga0501084_0008406 3300054114 Bacteria 8527
439 Ga0501084_0203042 3300054114 Unclassified 1673
440 Ga0501082_0000830 3300060353 Bacteria 27217
441 Ga0530510_0004549 3300061734 Bacteria 9597
442 Ga0451793_1195368
443 JGI25407J50210_10009241
444 JGI25407J50210_10021998
445 Ga0058860_11523538
446 Ga0070676_11266869
447 Ga0070683_101071096
448 Ga0070683_101840633
449 Ga0070682_100625119
450 Ga0068868_101278766
451 Ga0070689_100349252
452 Ga0070661_100338559
453 Ga0070668_100434309
454 Ga0070674_100665798
455 Ga0070674_100736686
456 Ga0070714_101252433
457 Ga0070713_101368927
458 Ga0070701_10176436
459 Ga0070705_100450679
460 Ga0070694_100279783
461 Ga0070663_100215260
462 Ga0070663_100563048
463 Ga0070678_100096470
464 Ga0070662_100216486
465 Ga0068867_100951109
466 Ga0070706_100619855
467 Ga0070706_101001140
468 Ga0070707_101015884
469 Ga0070707_101128297
470 Ga0070698_100967628
471 Ga0070698_101085671
472 Ga0070699_101555352
473 Ga0070679_100842942
474 Ga0070686_101287448
475 Ga0070695_100028552
476 Ga0070695_100029977
477 Ga0070696_100010343
478 Ga0070704_100250180
479 Ga0068855_100123345
480 Ga0070664_100246144
481 Ga0068854_100112191
482 Ga0070702_100305895
483 Ga0068864_101122709
484 Ga0081455_10022032
485 Ga0081538_10009630
486 Ga0081538_10058734
487 Ga0081540_1025990
488 Ga0081539_10049469
489 Ga0081539_10078569
490 Ga0081539_10192368
491 Ga0075365_10198101
492 Ga0075363_100390209
493 Ga0075363_100399653
494 Ga0075363_100724189
495 Ga0075364_10116513
496 Ga0075364_10166592
497 Ga0070712_100892914
498 Ga0070712_100964368
499 Ga0075367_10388141
500 Ga0075428_100836125
501 Ga0075433_10007263
502 Ga0075433_10843545
503 Ga0075433_11067034
504 Ga0075434_100163357
505 Ga0075434_100332098
506 Ga0068865_100613190
507 Ga0075436_100974419
508 Ga0075435_100607260
509 Ga0075435_101024376
510 Ga0105240_11719469
511 Ga0111539_10330919
512 Ga0111539_10875279
513 Ga0111539_11656252
514 Ga0111539_11698763
515 Ga0105245_10008143
516 Ga0105245_10191736
517 Ga0105245_10237682
518 Ga0105245_11007797
519 Ga0105245_11516935
520 Ga0114129_10042676
521 Ga0114129_10120920
522 Ga0114129_10197251
523 Ga0114129_10591844
524 Ga0105243_10082252
525 Ga0105243_12466553
526 Ga0105242_10005853
527 Ga0105242_10048121
528 Ga0105242_12218871
529 Ga0105237_10932057
530 Ga0105237_12037079
531 Ga0105238_11121378
532 Ga0105249_10517759
533 Ga0105249_10645735
534 Ga0105239_10244735
535 Ga0105239_11140508
536 Ga0105246_10427120
537 Ga0105246_11557966
538 Ga0157374_10582021
539 Ga0157378_10019097
540 Ga0157378_11640188
541 Ga0163162_11101841
542 Ga0163162_11795464
543 Ga0163162_13350491
544 Ga0163162_13368495
545 Ga0157375_10864964
546 Ga0163163_10108009
547 Ga0163163_10773703
548 Ga0157380_10088560
549 Ga0157377_10042278
550 Ga0157379_11668694
551 Ga0182005_1071289
552 Ga0213873_10027484
553 Ga0213876_10132729
554 Ga0207642_10080233
555 Ga0207684_11210694
556 Ga0207707_10044868
557 Ga0207671_10921872
558 Ga0207657_10453408
559 Ga0207649_10177204
560 Ga0207646_10127639
561 Ga0207646_11469004
562 Ga0207694_10788877
563 Ga0207650_10818985
564 Ga0207687_10034375
565 Ga0207687_10544156
566 Ga0207687_11019831
567 Ga0207690_10532392
568 Ga0207706_10432167
569 Ga0207686_10018168
570 Ga0207686_10254245
571 Ga0207709_10056531
572 Ga0207670_10737771
573 Ga0207669_10030769
574 Ga0207704_10528699
575 Ga0207679_10204902
576 Ga0207667_10305412
577 Ga0207712_10411168
578 Ga0207712_10468180
579 Ga0207677_10951872
580 Ga0207677_11658080
581 Ga0207639_10424365
582 Ga0207678_10872194
583 Ga0207678_11104321
584 Ga0207641_10799936
585 Ga0207648_10015140
586 Ga0207648_11018941
587 Ga0207676_10547964
588 Ga0207676_10931259
589 Ga0207675_100158369
590 Ga0207675_102101966
591 Ga0207683_10205879
592 Ga0207683_11516283
593 Ga0268264_11340464
594 Ga0265327_10054670
595 Ga0307408_100184107
596 Ga0307408_102022635
597 Ga0265314_10700048
598 Ga0307405_10009750
599 Ga0307405_10175221
600 Ga0307405_10541730
601 Ga0307413_10006024
602 Ga0307413_10956034
603 Ga0307410_10011358
604 Ga0307410_10086287
605 Ga0307410_10192608
606 Ga0307410_10538192
607 Ga0307406_10003563
608 Ga0307406_10241045
609 Ga0307406_10334833
610 Ga0307406_10551170
611 Ga0307407_10023279
612 Ga0307407_10103267
613 Ga0307407_10492747
614 Ga0307412_10279391
615 Ga0307412_11549819
616 Ga0307409_100002712
617 Ga0307409_100007620
618 Ga0307409_100355883
619 Ga0307409_100698246
620 Ga0307409_100857708
621 Ga0307409_100968906
622 Ga0307409_101196438
623 Ga0307416_100045411
624 Ga0307416_100088924
625 Ga0307416_100117346
626 Ga0307416_100276280
627 Ga0307416_101116486
628 Ga0307416_101382427
629 Ga0307414_10509426
630 Ga0307414_10737883
631 Ga0307411_10018504
632 Ga0307411_10539900
633 Ga0307415_100000152
634 Ga0307415_100001395
635 Ga0307415_100038779
636 Ga0307415_100200426
637 Ga0307415_100243033
638 Ga0307415_100885873
639 Ga0373943_0096574
640 Ga0316574_0379405
641 Ga0373935_0073312
642 Ga0373927_0145609
643 Ga0373927_0564440
644 Ga0373933_0914920
645 Ga0373947_0004411
646 Ga0373947_0036590
647 Ga0373947_1066396
648 Ga0373937_0107189
649 Ga0395899_0465860
650 Ga0395900_0133857
651 Ga0395900_0339007
652 Ga0395900_0820590
653 Ga0395898_0176473
654 Ga0395898_1430402
655 Ga0395905_0144873
656 Ga0395905_0507531
657 Ga0436364_0761130
658 Ga0395901_0061184
659 Ga0395901_0402810
660 Ga0395901_0623946
661 Ga0436365_0044074
662 Ga0436365_1342596
663 Ga0436362_0572581
664 Ga0436362_0672615
665 Ga0451795_1222202
666 Ga0439450_018315
667 Ga0439450_021906
668 Ga0439450_037837
669 Ga0439451_019294
670 Ga0439454_022073
671 Ga0439455_0008203
672 Ga0439455_0262252
673 Ga0439456_051487
674 Ga0439463_000641
675 Ga0439463_033151
676 Ga0439463_069487
677 Ga0439463_112877
678 Ga0450913_002237
679 Ga0450888_056219
680 Ga0450900_001868
681 Ga0450902_003560
682 Ga0450905_001797
683 Ga0439458_0108396
684 Ga0439444_0004284
685 Ga0439459_0201036
686 Ga0439464_0000362
687 Ga0439460_0001778
688 Ga0450916_000052
689 Ga0439440_0000347
690 Ga0439440_0157089
691 Ga0466965_0009820
692 Ga0466963_0750593
693 Ga0466964_0080383
694 Ga0466958_0311372
695 Ga0466958_0684582
696 Ga0466967_0342143
697 Ga0466967_0668938
698 Ga0495603_0016984
699 Ga0495603_0036996
700 Ga0495603_0052355
701 Ga0495603_0603592
702 Ga0495591_088699
703 Ga0495629_0001429
704 Ga0495641_0445995
705 Ga0495653_0362140
706 Ga0495580_0459316
707 Ga0495582_0000338
708 Ga0495639_0039378
709 Ga0495664_0518145
710 Ga0495584_0082046
711 Ga0495594_0422825
712 Ga0495596_0149159
713 Ga0495607_0103788
714 Ga0495607_0333340
715 Ga0495583_0296821
716 Ga0495608_0341732
717 Ga0495618_0091784
718 Ga0495630_0125366
719 Ga0495630_0199994
720 Ga0495630_0310275
721 Ga0495630_1205191
722 Ga0495631_0200444
723 Ga0495644_0001468
724 Ga0495644_0002550
725 Ga0495644_0107631
726 Ga0495663_0016510
727 Ga0495666_0053699
728 Ga0495666_0133832
729 Ga0495665_0001371
730 Ga0495665_0255503
731 Ga0495640_0106320
732 Ga0495586_0626572
733 Ga0495598_0011586
734 Ga0495598_0044183
735 Ga0495609_0045076
736 Ga0495609_0058539
737 Ga0495621_0045334
738 Ga0495621_0169203
739 Ga0495645_0220865
740 Ga0495622_0326731
741 Ga0495633_0035948
742 Ga0495656_0000915
743 Ga0495656_0002098
744 Ga0495656_0016443
745 Ga0495668_0310906
746 Ga0495634_0408806
747 Ga0495611_0392967
748 Ga0495635_0683328
749 Ga0495635_0884716
750 Ga0495659_0000574
751 Ga0495659_0012582
752 Ga0495588_0035489
753 Ga0495588_0047467
754 Ga0495647_0087291
755 Ga0495647_0212258
756 Ga0495658_0000726
757 Ga0495658_0200433
758 Ga0495669_0049529
759 Ga0495669_0125821
760 Ga0495613_0000296
761 Ga0495613_0220717
762 Ga0495613_0380481
763 Ga0495624_0237135
764 Ga0495624_0314946
765 Ga0495624_0386775
766 Ga0495624_0499561
767 Ga0495624_0804155
768 Ga0495670_0002507
769 Ga0495670_0045121
770 Ga0495670_0285084
771 Ga0495671_0334268
772 Ga0495589_0088395
773 Ga0495589_0113026
774 Ga0495600_0678492
775 Ga0495581_0001112
776 Ga0495581_0195231
777 Ga0495636_0002792
778 Ga0495636_0100758
779 Ga0495636_0397161
780 Ga0495674_0229556
781 Ga0495676_0612891
782 Ga0495676_0616222
783 Ga0495676_0703541
784 Ga0495680_0071130
785 Ga0495680_0444492
786 Ga0495677_0009486
787 Ga0495673_0348626
788 Ga0495593_0280297
789 Ga0495602_0281233
790 Ga0495614_0093551
791 Ga0495615_0038387
792 Ga0495615_0073679
793 Ga0496102_0060238
794 Ga0496102_0595151
795 Ga0496108_0307072
796 Ga0496108_0464337
797 Ga0496109_0206841
798 Ga0496109_1640193
799 Ga0496109_1924769
800 Ga0496110_0111641
801 Ga0496110_0427049
802 Ga0496113_0325124
803 Ga0496113_0883043
804 Ga0496113_0997018
805 Ga0496114_0218482
806 Ga0496114_0908186
807 Ga0496115_1255571
808 Ga0501031_0023756
809 Ga0501032_0119610
810 Ga0501033_0025318
811 Ga0501034_0007153
812 Ga0501036_0030197
813 Ga0501037_0028547
814 Ga0501037_0677967
815 Ga0501038_0042753
816 Ga0501038_0557826
817 Ga0501039_0002512
818 Ga0501040_0001665
819 Ga0501041_0026980
820 Ga0501042_0003539
821 Ga0501043_0020821
822 Ga0501043_0029079
823 Ga0501046_0002411
824 Ga0501046_0005869
825 Ga0501047_0022951
826 Ga0501047_0110448
827 Ga0501048_0000274
828 Ga0501069_0397024
829 Ga0501069_0505082
830 Ga0501070_0009375
831 Ga0501071_0013627
832 Ga0501071_0194103
833 Ga0501071_0868706
834 Ga0501072_0094416
835 Ga0501072_0481334
836 Ga0501074_0014874
837 Ga0501074_0481106
838 Ga0501075_0000372
839 Ga0501076_0000442
840 Ga0501077_0030886
841 Ga0501079_0001650
842 Ga0501080_0116169
843 Ga0501080_0766471
844 Ga0501081_0006644
845 Ga0501081_0371608
846 Ga0501035_0067868
847 Ga0501044_0217353
848 Ga0501045_0001247
849 Ga0501045_0150909
850 nmdc:mga03n38_110637_c1
851 nmdc:mga03n38_643701_c1
852 nmdc:mga00v17_105191_c1
853 nmdc:mga00v17_487001_c1
854 nmdc:mga0yw44_381837_c1
855 nmdc:mga06z11_720230_c1
856 nmdc:mga05p37_103150_c1
857 nmdc:mga05p37_18307_c1
858 nmdc:mga05p37_375088_c1
859 nmdc:mga05p37_538301_c1
860 nmdc:mga09592_90497_c1
861 nmdc:mga0qj67_277048_c1
862 nmdc:mga06r32_222279_c1
863 nmdc:mga08y16_1193473_c1
864 nmdc:mga08y16_739617_c1
865 nmdc:mga08y16_844551_c1
866 nmdc:mga0n895_120564_c1
867 nmdc:mga0n895_1610141_c1
868 nmdc:mga0n895_9312_c1
869 nmdc:mga0rr50_594973_c1
870 nmdc:mga0rr50_71495_c1
871 nmdc:mga08x19_645098_c1
872 nmdc:mga0a205_1470186_c1
873 nmdc:mga0a205_692212_c1
874 nmdc:mga0a205_710_c1
875 Ga0495601_0195605
876 Ga0495595_0094568
877 Ga0495619_0138982
878 Ga0500616_0021569
879 Ga0501084_0008406
880 Ga0501084_0203042
881 Ga0501082_0000830
882 Ga0530510_0004549

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

7

127

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rk0-assembly1.cif.gz_A crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.8829 3 129
2rk0-assembly1.cif.gz_B crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.8644 3 129
2rk0-assembly1.cif.gz_B crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.8582 3 129
2rk0-assembly1.cif.gz_A crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.8581 3 129
3l7t-assembly2.cif.gz_C crystal structure of smu.1112c 0.8405 3 126
ID Description Score Start End Superfamily
af_O53680_11_192_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.862 4 130 3.10.180.10
2rk0B01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8542 9 129 3.10.180.10
2rk0B01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8477 9 129 3.10.180.10
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8454 78 130 3.30.720.110
af_O53680_11_192_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8375 4 130 3.10.180.10
ID Description Score Start End GO Terms
AF-K0UE30-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9757 2 130 GO:0051213
AF-A0A2X1S5H0-F1-model_v4 deleted 0.9711 1 130
AF-A0A2X1S5H0-F1-model_v4 deleted 0.9638 1 130
AF-A0A1A3KVY4-F1-model_v4 Glyoxalase 0.9614 3 130
AF-K0UE30-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.961 2 130 GO:0051213

Map