F444693

General Info

Members Datasets Scaffolds Average Seq Length
441 359 876 309

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0265050|Ga0373937_0265050_55_1083
Length 342
Sequence MTATMWPAHSIDRRRGPPGGDNQGEGTMGNLTRRRLVGTAAGLALLLSAGAVQAADTTIALVTINQQALFFNQINDGAQSAADKNGVKLVIFNANNQPTAQNTAIENYITQKVDGIVLVAIDVNGVKPAITAAKKAGIPVVAIDARIPDGDNAAFIGVDNQGAGADIGKFFADYVKSSKGGSAKIGIVGALNSFIQNQRLDGFKKAVTDSGAKVTFLDTVDGQNVQDVALTAAENLMTANPDMTALYATGEPALIGAISAVSSQKMTDKVKVFGWDLTAQAVKGIDEGWIVAVVQQDPYQEGVAGVESILKLKKGEKVSASIDIPVTIVTKANVDKFRSMFK

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
62 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
63 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
64 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
90 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
96 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
101 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
102 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
103 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
106 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
107 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
108 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
111 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
112 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
113 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
114 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
115 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
116 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
117 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
118 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
125 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
126 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
129 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
130 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
133 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
134 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
135 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
139 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
140 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
156 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
162 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
166 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
192 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
193 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
194 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
195 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
196 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
197 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
198 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
199 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
200 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
203 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
204 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
205 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
206 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
207 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
208 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
209 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
210 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
211 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
212 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
213 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
214 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
215 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
216 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
217 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
218 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
219 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
220 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
221 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
222 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
223 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
224 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
225 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
226 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
227 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
228 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
229 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
230 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
231 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
232 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
233 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
234 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
235 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
236 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
237 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
238 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
239 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
240 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
241 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
242 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
243 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
244 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
245 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
246 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
247 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
248 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
249 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
250 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
251 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
252 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
253 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
254 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
255 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
256 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
257 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
258 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
259 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
260 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
261 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
262 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
263 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
264 2636415599 Klebsiella variicola DX120E Isolate Unclassified
265 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
266 2643221607 Rhizobium sp. Root73 Isolate Unclassified
267 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
268 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
269 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
270 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
271 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
272 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
273 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
274 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
275 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
276 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
277 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
278 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
279 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
280 2775507074 Klebsiella sp. D5A Isolate Unclassified
281 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
282 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
283 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
284 2791355260 Rhizobium sp. L9 Isolate Nodule
285 2791355261 Rhizobium sp. J15 Isolate Nodule
286 2791355263 Rhizobium chutanense C5 Isolate Nodule
287 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
288 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
289 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
290 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
291 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
292 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
293 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
294 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
295 2847085930 Erwinia persicina B64 Isolate Bulb
296 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
297 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
298 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
299 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
300 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
301 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
302 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
303 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
304 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
305 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
306 2876601092 Pantoea endophytica 596 Isolate Unclassified
307 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
308 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
309 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
310 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
311 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
312 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
313 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
314 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
315 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
316 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
317 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
318 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
319 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
320 2909042592 Labrys sp. LIt4 Isolate Nodule
321 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
322 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
323 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
324 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
325 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
326 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
327 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
328 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
329 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
330 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
331 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
332 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
333 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
334 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
335 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
336 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
337 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
338 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
339 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
340 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
341 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
342 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
343 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
344 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
345 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
346 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
347 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
348 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
349 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
350 8005382845 Rhizobium sp. R634 Isolate Nodule
351 8005395548 Rhizobium sp. R339 Isolate Nodule
352 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
353 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
354 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
355 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
356 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
357 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
358 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
359 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 63.95
Metatranscriptomes 0.23
Isolates 35.83

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0.23
Endosphere 10.88
Nodule 11.79
Rhizoplane 12.93
Rhizosphere 47.85
Stem 0
Stem Tuber 0
Unclassified 1.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0265050 3300036401 Bacteria 1621
2 JGI24740J21852_10000076 3300001979 Bacteria 33154
3 JGI24740J21852_10032133 3300001979 Bacteria 1683
4 JGI24739J22299_10039116 3300001989 Bacteria 1591
5 JGI24739J22299_10043959 3300001989 Bacteria 1474
6 JGI25162J39368_1000125 3300002737 Bacteria 84782
7 JGI25162J39368_1000856 3300002737 Bacteria 20106
8 JGI25162J39368_1000857 3300002737 Bacteria 20074
9 JGI25159J45721_1001426 3300002987 Bacteria 9905
10 JGI25159J45721_1015432 3300002987 Bacteria 1672
11 JGI25151J46595_10000525 3300003187 Bacteria 35775
12 JGI25151J46595_10000987 3300003187 Bacteria 21509
13 JGI25165J46597_1000401 3300003214 Bacteria 45767
14 JGI25165J46597_1000595 3300003214 Bacteria 31117
15 JGI25153J46596_10000012 3300003215 Bacteria 308056
16 rootH2_10272260 3300003320 Bacteria 1835
17 rootL2_10114170 3300003322 Bacteria 5157
18 rootH1_10221137 3300003323 Bacteria 3826
19 rootH1_10221138 3300003323 Bacteria 2380
20 JGI25160J50197_1000030 3300003354 Bacteria 177919
21 JGI25161J50226_1000016 3300003374 Bacteria 177919
22 Ga0058692_1002237 3300003856 Bacteria 6576
23 Ga0058692_1008064 3300003856 Bacteria 2737
24 Ga0055543_1000006 3300004625 Bacteria 214206
25 Ga0065165_1000189 3300005262 Bacteria 108538
26 Ga0070658_10022131 3300005327 Bacteria 5099
27 Ga0070683_100586867 3300005329 Bacteria 1066
28 Ga0070670_100000925 3300005331 Bacteria 23056
29 Ga0068869_100294117 3300005334 Bacteria 1309
30 Ga0070666_10347120 3300005335 Bacteria 1061
31 Ga0070660_100168844 3300005339 Bacteria 1766
32 Ga0070714_100165666 3300005435 Bacteria 2003
33 Ga0070713_100231199 3300005436 Bacteria 1681
34 Ga0070711_100155867 3300005439 Bacteria 1727
35 Ga0070708_100010359 3300005445 Bacteria 7552
36 Ga0070663_100016908 3300005455 Bacteria 4748
37 Ga0070698_100005051 3300005471 Bacteria 14457
38 Ga0070699_100003074 3300005518 Bacteria 14812
39 Ga0070684_100498485 3300005535 Bacteria 1128
40 Ga0070665_100138888 3300005548 Bacteria 2433
41 Ga0068855_100243963 3300005563 Bacteria 2006
42 Ga0068854_100083771 3300005578 Bacteria 2358
43 Ga0068852_100060324 3300005616 Bacteria 3293
44 Ga0068859_100444280 3300005617 Bacteria 1393
45 Ga0081538_10037989 3300005981 Bacteria 3113
46 Ga0081540_1017640 3300005983 Bacteria 4410
47 Ga0070717_10017854 3300006028 Bacteria 5531
48 Ga0070717_10317155 3300006028 Unclassified 1388
49 Ga0075365_10035356 3300006038 Bacteria 3231
50 Ga0075365_10065964 3300006038 Bacteria 2427
51 Ga0075368_10007129 3300006042 Bacteria 3937
52 Ga0075364_10071991 3300006051 Bacteria 2277
53 Ga0075367_10025999 3300006178 Bacteria 3315
54 Ga0075370_10004425 3300006353 Bacteria 6821
55 Ga0097620_100444269 3300006931 Bacteria 1393
56 Ga0105251_10066633 3300009011 Bacteria 1683
57 Ga0105244_10004562 3300009036 Bacteria 9485
58 Ga0105250_10002702 3300009092 Bacteria 8768
59 Ga0105240_10529993 3300009093 Bacteria 1306
60 Ga0105245_10284299 3300009098 Bacteria 1618
61 Ga0105247_10282611 3300009101 Bacteria 1145
62 Ga0105248_10069759 3300009177 Bacteria 3947
63 Ga0105248_10504218 3300009177 Bacteria 1364
64 Ga0105237_10146662 3300009545 Bacteria 2355
65 Ga0105237_10234252 3300009545 Bacteria 1837
66 Ga0105238_10117342 3300009551 Bacteria 2641
67 Ga0105239_10013329 3300010375 Bacteria 9135
68 Ga0105239_10174816 3300010375 Bacteria 2402
69 Ga0157370_10002482 3300013104 Bacteria 22240
70 Ga0157370_10092554 3300013104 Bacteria 2838
71 Ga0157374_10377142 3300013296 Unclassified 1412
72 Ga0157378_10148914 3300013297 Bacteria 2179
73 Ga0163162_10000297 3300013306 Bacteria 45730
74 Ga0157375_10006784 3300013308 Bacteria 9972
75 Ga0163163_10360634 3300014325 Bacteria 1510
76 Ga0213874_10013547 3300021377 Bacteria 2115
77 Ga0213871_10008289 3300021441 Unclassified 2285
78 Ga0209436_103067 3300025208 Bacteria 4604
79 Ga0209437_100022 3300025233 Bacteria 625694
80 Ga0209437_100396 3300025233 Bacteria 41087
81 Ga0209148_1010787 3300025254 Bacteria 1721
82 Ga0209233_1000031 3300025261 Bacteria 624646
83 Ga0209233_1000365 3300025261 Bacteria 41069
84 Ga0209130_1000053 3300025284 Bacteria 214421
85 Ga0209130_1002027 3300025284 Bacteria 11027
86 Ga0209025_1000084 3300025294 Bacteria 263812
87 Ga0209758_1000059 3300025297 Bacteria 328458
88 Ga0209758_1001496 3300025297 Bacteria 27207
89 Ga0207426_1000054 3300025302 Bacteria 384435
90 Ga0207426_1000314 3300025302 Bacteria 94920
91 Ga0209257_1027297 3300025304 Bacteria 1903
92 Ga0207696_1000239 3300025711 Bacteria 75936
93 Ga0207696_1000270 3300025711 Bacteria 64583
94 Ga0207655_1000712 3300025728 Bacteria 38225
95 Ga0207655_1006684 3300025728 Bacteria 7600
96 Ga0207655_1015941 3300025728 Bacteria 4141
97 Ga0207713_1063424 3300025735 Bacteria 1395
98 Ga0207680_10068256 3300025903 Bacteria 2193
99 Ga0207647_10002815 3300025904 Bacteria 13118
100 Ga0207647_10006008 3300025904 Bacteria 8847
101 Ga0207705_10084246 3300025909 Bacteria 2321
102 Ga0207671_10062681 3300025914 Bacteria 2762
103 Ga0207671_10166713 3300025914 Bacteria 1708
104 Ga0207657_10161676 3300025919 Bacteria 1818
105 Ga0207657_10212088 3300025919 Bacteria 1554
106 Ga0207694_10076650 3300025924 Bacteria 2619
107 Ga0207650_10001107 3300025925 Bacteria 19805
108 Ga0207711_10009440 3300025941 Bacteria 8141
109 Ga0207711_10014909 3300025941 Bacteria 6456
110 Ga0207640_10140089 3300025981 Bacteria 1762
111 Ga0207678_10042216 3300026067 Bacteria 3952
112 Ga0207678_10115282 3300026067 Bacteria 2292
113 Ga0207702_10391228 3300026078 Bacteria 1339
114 Ga0207674_10102694 3300026116 Bacteria 2839
115 Ga0209371_1001447 3300027312 Bacteria 16086
116 Ga0307515_10000136 3300028794 Bacteria 174265
117 Ga0307515_10012291 3300028794 Bacteria 16114
118 Ga0268256_1000474 3300030500 Bacteria 34547
119 Ga0268256_1007240 3300030500 Bacteria 3988
120 Ga0268256_1021653 3300030500 Bacteria 1704
121 Ga0265760_10042989 3300031090 Bacteria 1350
122 Ga0265339_10020250 3300031249 Bacteria 3889
123 Ga0307513_10000454 3300031456 Bacteria 59117
124 Ga0307513_10152880 3300031456 Bacteria 2213
125 Ga0307508_10016691 3300031616 Bacteria 6681
126 Ga0265314_10141304 3300031711 Bacteria 1488
127 Ga0307510_10164229 3300033180 Bacteria 1812
128 Ga0373931_0188026 3300035691 Bacteria 1227
129 Ga0436364_0095893 3300037853 Bacteria 3133
130 Ga0400483_145582 3300039062 Bacteria 2840
131 Ga0400483_152465 3300039062 Bacteria 2176
132 Ga0436365_0715858 3300039437 Bacteria 6642
133 Ga0436360_0479326 3300039438 Unclassified 3247
134 Ga0436361_0470581 3300039447 Bacteria 1683
135 Ga0436361_1108871 3300039447 Unclassified 1485
136 Ga0436363_1502314 3300039450 Bacteria 3355
137 Ga0436362_0611544 3300039453 Unclassified 1112
138 Ga0466959_0234121 3300045049 Bacteria 1270
139 Ga0495603_0000860 3300046455 Bacteria 17378
140 Ga0495590_0056924 3300046457 Bacteria 1366
141 Ga0495638_0001020 3300046460 Bacteria 27866
142 Ga0495638_0012080 3300046460 Bacteria 5933
143 Ga0495650_0000176 3300046471 Bacteria 139443
144 Ga0495580_0001717 3300046472 Bacteria 19250
145 Ga0495580_0007013 3300046472 Bacteria 9085
146 Ga0495605_0004950 3300046474 Bacteria 7783
147 Ga0495605_0014633 3300046474 Bacteria 4290
148 Ga0495584_0004564 3300046491 Bacteria 7428
149 Ga0495584_0016461 3300046491 Bacteria 3770
150 Ga0495585_0165288 3300046492 Bacteria 1146
151 Ga0495596_0033500 3300046500 Bacteria 2044
152 Ga0495607_0005244 3300046501 Bacteria 9329
153 Ga0495607_0082334 3300046501 Bacteria 1766
154 Ga0495583_0000619 3300046506 Bacteria 47858
155 Ga0495583_0006355 3300046506 Bacteria 7745
156 Ga0495606_0000436 3300046507 Bacteria 69104
157 Ga0495606_0018480 3300046507 Bacteria 5224
158 Ga0495606_0022735 3300046507 Bacteria 4557
159 Ga0495610_0089491 3300046512 Bacteria 1398
160 Ga0495616_0007913 3300046513 Bacteria 6339
161 Ga0495616_0027793 3300046513 Bacteria 2999
162 Ga0495628_0000614 3300046516 Bacteria 32697
163 Ga0495630_0055836 3300046517 Bacteria 2959
164 Ga0495643_0090226 3300046522 Bacteria 1582
165 Ga0495644_0015556 3300046523 Bacteria 2914
166 Ga0495648_0144643 3300046524 Bacteria 1247
167 Ga0495666_0016984 3300046526 Bacteria 3623
168 Ga0495642_0014652 3300046528 Bacteria 3040
169 Ga0495654_0001419 3300046530 Bacteria 16562
170 Ga0495665_0016423 3300046531 Bacteria 3989
171 Ga0495622_0011892 3300046557 Bacteria 4025
172 Ga0495611_0051603 3300046648 Bacteria 1854
173 Ga0495646_0005761 3300046680 Bacteria 7856
174 Ga0495670_0038615 3300046691 Bacteria 2381
175 Ga0495671_0009242 3300046692 Bacteria 5509
176 Ga0495649_0013722 3300046694 Bacteria 4667
177 Ga0495589_0000967 3300046794 Bacteria 17558
178 Ga0495660_0000010 3300046810 Bacteria 370769
179 Ga0495674_0000902 3300047319 Bacteria 28378
180 Ga0495674_0000942 3300047319 Bacteria 27786
181 Ga0495672_0000085 3300047320 Bacteria 156067
182 Ga0495672_0061711 3300047320 Bacteria 2159
183 Ga0495683_0010615 3300047323 Bacteria 4859
184 Ga0495683_0048186 3300047323 Bacteria 2136
185 Ga0495677_0017280 3300047445 Bacteria 2616
186 Ga0495673_0000245 3300047469 Bacteria 76471
187 Ga0495673_0015259 3300047469 Bacteria 3962
188 Ga0495673_0022683 3300047469 Bacteria 3072
189 Ga0495686_0000301 3300047472 Bacteria 84924
190 Ga0495626_0077978 3300048091 Bacteria 1476
191 Ga0496100_0006925 3300048903 Bacteria 6213
192 Ga0496100_0026454 3300048903 Bacteria 3558
193 Ga0496101_0056154 3300048904 Bacteria 2846
194 Ga0496102_0210321 3300048905 Bacteria 1834
195 Ga0496104_0048698 3300048907 Bacteria 3995
196 Ga0496104_0160224 3300048907 Bacteria 2159
197 Ga0496105_0012530 3300048908 Bacteria 6714
198 Ga0496105_0063886 3300048908 Bacteria 3038
199 Ga0496106_0000002 3300048909 Bacteria 377020
200 Ga0496107_0032194 3300048910 Bacteria 3747
201 Ga0496107_0036946 3300048910 Bacteria 3505
202 Ga0496107_0162577 3300048910 Bacteria 1655
203 Ga0496108_0606956 3300048911 Bacteria 953
204 Ga0496111_0096337 3300048914 Bacteria 2172
205 Ga0496112_0009081 3300048915 Bacteria 8931
206 Ga0496113_0009880 3300048916 Bacteria 6285
207 Ga0496115_0011618 3300048918 Bacteria 6607
208 Ga0496116_0021442 3300048919 Bacteria 4874
209 Ga0496117_0013283 3300048920 Bacteria 7196
210 Ga0496118_0104197 3300048921 Bacteria 1905
211 Ga0496118_0133737 3300048921 Bacteria 1586
212 Ga0496119_0000366 3300048922 Bacteria 63412
213 Ga0496120_0000473 3300048923 Bacteria 63086
214 Ga0496121_0009480 3300048924 Bacteria 11178
215 Ga0496121_0011392 3300048924 Bacteria 9883
216 Ga0496121_0072518 3300048924 Bacteria 2764
217 Ga0496121_0149976 3300048924 Bacteria 1717
218 Ga0496122_0003292 3300048925 Bacteria 21384
219 Ga0496123_0003049 3300048926 Bacteria 19276
220 Ga0496124_0007095 3300048927 Bacteria 12003
221 Ga0496126_0000172 3300048929 Bacteria 147759
222 Ga0496126_0074837 3300048929 Bacteria 3007
223 Ga0495678_000387 3300049459 Bacteria 44396
224 Ga0495682_0000024 3300049460 Bacteria 153545
225 Ga0495682_0000040 3300049460 Bacteria 119566
226 Ga0495682_0008565 3300049460 Bacteria 4023
227 Ga0501031_0011901 3300049568 Bacteria 5672
228 Ga0501032_0051300 3300049569 Bacteria 2782
229 Ga0501032_0105614 3300049569 Bacteria 1865
230 Ga0501033_0015385 3300049570 Bacteria 5804
231 Ga0501034_0031373 3300049571 Bacteria 5397
232 Ga0501034_0047066 3300049571 Bacteria 4357
233 Ga0501034_0058268 3300049571 Bacteria 3881
234 Ga0501034_0087993 3300049571 Bacteria 3105
235 Ga0501036_0023731 3300049572 Bacteria 5168
236 Ga0501036_0032570 3300049572 Bacteria 4405
237 Ga0501037_0017041 3300049573 Bacteria 5345
238 Ga0501037_0032153 3300049573 Bacteria 3873
239 Ga0501038_0002394 3300049574 Bacteria 17469
240 Ga0501038_0008713 3300049574 Bacteria 9310
241 Ga0501038_0034021 3300049574 Bacteria 4483
242 Ga0501040_0295498 3300049576 Bacteria 1158
243 Ga0501043_0001293 3300049579 Bacteria 21959
244 Ga0501043_0085912 3300049579 Bacteria 2472
245 Ga0501046_0005361 3300049580 Bacteria 11468
246 Ga0501047_0091924 3300049581 Bacteria 2913
247 Ga0501048_0019019 3300049582 Bacteria 5047
248 Ga0501068_0170798 3300049584 Bacteria 1372
249 Ga0501069_0000173 3300049585 Bacteria 28962
250 Ga0501069_0038274 3300049585 Bacteria 2648
251 Ga0501070_0017123 3300049586 Bacteria 6082
252 Ga0501070_0022008 3300049586 Bacteria 5340
253 Ga0501072_0034681 3300049588 Bacteria 3955
254 Ga0501073_0005647 3300049589 Bacteria 9361
255 Ga0501073_0215237 3300049589 Bacteria 1327
256 Ga0501074_0013465 3300049590 Bacteria 5947
257 Ga0501075_0115108 3300049591 Bacteria 2045
258 Ga0501080_0025204 3300049742 Bacteria 5519
259 Ga0501080_0036432 3300049742 Bacteria 4591
260 Ga0501081_0233663 3300049743 Bacteria 1340
261 Ga0501083_0012585 3300049744 Bacteria 5917
262 Ga0501035_0002936 3300049822 Bacteria 16408
263 Ga0501035_0061679 3300049822 Bacteria 3337
264 Ga0501035_0307274 3300049822 Bacteria 1335
265 Ga0501044_0027174 3300049823 Bacteria 6051
266 Ga0501044_0124977 3300049823 Bacteria 2570
267 Ga0501044_0482727 3300049823 Unclassified 1142
268 nmdc:mga03n38_34019_c1 3300050490 Bacteria 2173
269 nmdc:mga07m45_142834_c1 3300050496 Bacteria 1387
270 Ga0500572_011515 3300053111 Bacteria 2143
271 Ga0500608_006908 3300053122 Bacteria 4659
272 Ga0500618_000936 3300053125 Bacteria 15012
273 Ga0500621_000007 3300053126 Bacteria 214505
274 Ga0500568_0000376 3300053139 Bacteria 34233
275 Ga0500568_0039929 3300053139 Bacteria 1892
276 Ga0500577_0011405 3300053142 Bacteria 2650
277 Ga0500588_0000767 3300053146 Bacteria 5521
278 Ga0500636_0000196 3300053177 Bacteria 32552
279 Ga0501082_0014679 3300060353 Bacteria 6750
280 Ga0501082_0194705 3300060353 Bacteria 1763
281 2503203451 2503198000 Bacteria 6884444
282 2509115866 2508501123 Bacteria 6283661
283 2509141152 2508501127 Bacteria 7037543
284 2511136111 2510917022 Bacteria 6504556
285 2511382362 2511231025 Bacteria 5324661
286 2511435279 2511231035 Bacteria 5341610
287 2512929667 2512875016 Bacteria 6529530
288 2513614078 2513237090 Bacteria 7096802
289 2513881605 2513237140 Bacteria 7076289
290 2514052348 2513237166 Bacteria 10373764
291 2523469031 2523231067 Bacteria 5230452
292 2551696016 2551306086 Bacteria 6843938
293 2551732542 2551306092 Bacteria 6992595
294 2555257842 2554235234 Bacteria 5762085
295 2563056616 2562617112 Bacteria 10918404
296 2585232253 2582581299 Bacteria 6518058
297 2585272159 2582581307 Bacteria 6597605
298 2585334922 2582581316 Bacteria 7774528
299 2585561780 2585427531 Bacteria 6992870
300 2585899627 2585427608 Bacteria 6544331
301 2585907010 2585427609 Bacteria 6667127
302 2587982431 2585428125 Bacteria 6662905
303 2588515248 2588253730 Bacteria 6881675
304 2597815843 2597489875 Bacteria 7010078
305 2599335381 2599185156 Bacteria 5403036
306 2599409361 2599185169 Bacteria 5441380
307 2599937515 2599185301 Bacteria 6161860
308 2601522130 2600255254 Bacteria 5281859
309 2601527155 2600255255 Bacteria 5282785
310 2601613985 2600255280 Bacteria 5292309
311 2601618708 2600255281 Bacteria 5288753
312 2601642694 2600255287 Bacteria 5210468
313 2601647535 2600255288 Bacteria 5282738
314 2601652133 2600255289 Bacteria 5281907
315 2601657460 2600255290 Bacteria 5282218
316 2601662515 2600255291 Bacteria 5217298
317 2601695472 2600255298 Bacteria 5215185
318 2601700148 2600255299 Bacteria 5218662
319 2601705257 2600255300 Bacteria 5287774
320 2601710286 2600255301 Bacteria 5280532
321 2601715298 2600255302 Bacteria 5288235
322 2601720499 2600255303 Bacteria 5219315
323 2601725704 2600255304 Bacteria 5283973
324 2601730246 2600255305 Bacteria 5282329
325 2601735263 2600255306 Bacteria 5281613
326 2601739963 2600255307 Bacteria 5439064
327 2601750452 2600255309 Bacteria 5431045
328 2602017705 2600255392 Bacteria 5437392
329 2603659887 2602042052 Bacteria 5215873
330 2603665164 2602042053 Bacteria 5214361
331 2603837633 2602042103 Bacteria 5284714
332 2603842709 2602042104 Bacteria 5281639
333 2603847782 2602042105 Bacteria 5282303
334 2603852853 2602042106 Bacteria 5282744
335 2603870906 2602042110 Bacteria 5283285
336 2603875811 2602042111 Bacteria 5212080
337 2606048097 2603880178 Bacteria 5283018
338 2606069594 2603880184 Bacteria 5217896
339 2606145397 2603880202 Bacteria 5284684
340 2606175499 2603880211 Bacteria 5284226
341 2616555926 2615840698 Bacteria 7319877
342 2617385613 2617270742 Bacteria 6808054
343 2637225262 2636415599 Bacteria 5718434
344 2643988993 2643221595 Bacteria 6565519
345 2644048502 2643221607 Bacteria 6314006
346 2644152178 2643221627 Bacteria 6761570
347 2644201863 2643221636 Bacteria 6583769
348 2644481304 2643221686 Bacteria 6310811
349 2644498308 2643221689 Bacteria 6042950
350 2671585953 2671180115 Bacteria 5353919
351 2676406506 2675903046 Bacteria 5451247
352 2713481376 2711768613 Bacteria 11048459
353 2739349919 2738543031 Bacteria 5769731
354 2756673156 2756170246 Bacteria 7451806
355 2765467313 2765235802 Bacteria 5618596
356 2770198063 2767802442 Bacteria 5747986
357 2776269911 2775506902 Bacteria 6208009
358 2776281028 2775506904 Bacteria 5954060
359 2777022730 2775507074 Bacteria 5532402
360 2778178001 2775507266 Bacteria 7392367
361 2791924176 2791354903 Bacteria 4937680
362 2793280544 2791355253 Bacteria 5171699
363 2793323252 2791355260 Bacteria 6598818
364 2793331545 2791355261 Bacteria 6661293
365 2793344550 2791355263 Bacteria 6872478
366 2837680412 2837678835 Bacteria 5252418
367 2839998069 2839993093 Bacteria 5512535
368 2840766089 2840764183 Bacteria 6358399
369 2841735041 2841734538 Bacteria 6784580
370 2842397235 2842395702 Bacteria 6780583
371 2842487362 2842482326 Bacteria 7212537
372 2842928213 2842922631 Bacteria 5824079
373 2844537986 2844533157 Bacteria 7517899
374 2847089485 2847085930 Bacteria 5070450
375 2847671706 2847670302 Bacteria 6165597
376 2852394142 2852387548 Bacteria 8025568
377 2856318563 2856314179 Bacteria 6477897
378 2856347171 2856342000 Bacteria 7176905
379 2869164283 2869162929 Bacteria 6399702
380 2871481188 2871474448 Bacteria 6806570
381 2874131196 2874123672 Bacteria 7238285
382 2874176441 2874168670 Bacteria 8062617
383 2876366771 2876363079 Bacteria 6544991
384 2876373554 2876369609 Bacteria 6807521
385 2876604827 2876601092 Bacteria 5114497
386 2878037900 2878035449 Bacteria 6555736
387 2878792604 2878788777 Bacteria 6567085
388 2881611848 2881609920 Bacteria 4405319
389 2888349063 2888343758 Bacteria 6611049
390 2894819250 2894817345 Bacteria 4892941
391 2903452946 2903448605 Bacteria 7357801
392 2903524638 2903521522 Bacteria 6525694
393 2903531119 2903528002 Bacteria 6586099
394 2904513847 2904513164 Bacteria 5476410
395 2904580305 2904578770 Bacteria 5302906
396 2906328671 2906328253 Bacteria 6585166
397 2906418601 2906414383 Bacteria 6580790
398 2908671523 2908669403 Bacteria 5740494
399 2909042887 2909042592 Bacteria 6499737
400 2917558328 2917554339 Bacteria 4987857
401 2919109062 2919108558 Bacteria 5897419
402 2919120019 2919119836 Bacteria 5208557
403 2924755576 2924754689 Bacteria 6774424
404 2937063714 2937056579 Bacteria 7107896
405 2937838737 2937836603 Bacteria 6811263
406 2937850710 2937848649 Bacteria 6983481
407 2939605482 2939602548 Bacteria 4950493
408 2958074524 2958071322 Bacteria 6815895
409 2963649565 2963644680 Bacteria 6530403
410 2964614042 2964607997 Bacteria 7101408
411 2968084727 2968083720 Bacteria 7351627
412 2969082277 2969079654 Bacteria 5439582
413 2970055104 2970054988 Bacteria 6611507
414 2970529144 2970524798 Bacteria 6840927
415 2970543145 2970540015 Bacteria 6977556
416 2971823617 2971820967 Bacteria 5823634
417 2977865381 2977864932 Bacteria 7534097
418 2977927601 2977922695 Bacteria 6956781
419 2977990805 2977986579 Bacteria 6581278
420 2978976918 2978975091 Bacteria 4704313
421 2984564704 2984559226 Bacteria 5683096
422 2984597432 2984595703 Bacteria 5682994
423 2989774814 2989771324 Bacteria 5605128
424 3004214498 3004211236 Bacteria 7417683
425 3004219179 3004218560 Bacteria 7421728
426 637079411 637000159 Bacteria 7596297
427 8004402159 8004395343 Bacteria 6620908
428 8004639125 8004633249 Bacteria 6723080
429 8005383517 8005382845 Bacteria 6732062
430 8005398067 8005395548 Bacteria 6806915
431 8005686187 8005682033 Bacteria 6726518
432 8005699148 8005695170 Bacteria 6912330
433 8018155191 8018150411 Bacteria 5549903
434 8024487623 8024486573 Bacteria 6540512
435 8046774229 8046767195 Bacteria 7547379
436 8054559372 8054558443 Bacteria 5204801
437 8055434751 8055431914 Bacteria 4551896
438 8055623370 8055617313 Bacteria 7548464
439 Ga0373937_0265050
440 JGI24740J21852_10000076
441 JGI24740J21852_10032133
442 JGI24739J22299_10039116
443 JGI24739J22299_10043959
444 JGI25162J39368_1000125
445 JGI25162J39368_1000856
446 JGI25162J39368_1000857
447 JGI25159J45721_1001426
448 JGI25159J45721_1015432
449 JGI25151J46595_10000525
450 JGI25151J46595_10000987
451 JGI25165J46597_1000401
452 JGI25165J46597_1000595
453 JGI25153J46596_10000012
454 rootH2_10272260
455 rootL2_10114170
456 rootH1_10221137
457 rootH1_10221138
458 JGI25160J50197_1000030
459 JGI25161J50226_1000016
460 Ga0058692_1002237
461 Ga0058692_1008064
462 Ga0055543_1000006
463 Ga0065165_1000189
464 Ga0070658_10022131
465 Ga0070683_100586867
466 Ga0070670_100000925
467 Ga0068869_100294117
468 Ga0070666_10347120
469 Ga0070660_100168844
470 Ga0070714_100165666
471 Ga0070713_100231199
472 Ga0070711_100155867
473 Ga0070708_100010359
474 Ga0070663_100016908
475 Ga0070698_100005051
476 Ga0070699_100003074
477 Ga0070684_100498485
478 Ga0070665_100138888
479 Ga0068855_100243963
480 Ga0068854_100083771
481 Ga0068852_100060324
482 Ga0068859_100444280
483 Ga0081538_10037989
484 Ga0081540_1017640
485 Ga0070717_10017854
486 Ga0070717_10317155
487 Ga0075365_10035356
488 Ga0075365_10065964
489 Ga0075368_10007129
490 Ga0075364_10071991
491 Ga0075367_10025999
492 Ga0075370_10004425
493 Ga0097620_100444269
494 Ga0105251_10066633
495 Ga0105244_10004562
496 Ga0105250_10002702
497 Ga0105240_10529993
498 Ga0105245_10284299
499 Ga0105247_10282611
500 Ga0105248_10069759
501 Ga0105248_10504218
502 Ga0105237_10146662
503 Ga0105237_10234252
504 Ga0105238_10117342
505 Ga0105239_10013329
506 Ga0105239_10174816
507 Ga0157370_10002482
508 Ga0157370_10092554
509 Ga0157374_10377142
510 Ga0157378_10148914
511 Ga0163162_10000297
512 Ga0157375_10006784
513 Ga0163163_10360634
514 Ga0213874_10013547
515 Ga0213871_10008289
516 Ga0209436_103067
517 Ga0209437_100022
518 Ga0209437_100396
519 Ga0209148_1010787
520 Ga0209233_1000031
521 Ga0209233_1000365
522 Ga0209130_1000053
523 Ga0209130_1002027
524 Ga0209025_1000084
525 Ga0209758_1000059
526 Ga0209758_1001496
527 Ga0207426_1000054
528 Ga0207426_1000314
529 Ga0209257_1027297
530 Ga0207696_1000239
531 Ga0207696_1000270
532 Ga0207655_1000712
533 Ga0207655_1006684
534 Ga0207655_1015941
535 Ga0207713_1063424
536 Ga0207680_10068256
537 Ga0207647_10002815
538 Ga0207647_10006008
539 Ga0207705_10084246
540 Ga0207671_10062681
541 Ga0207671_10166713
542 Ga0207657_10161676
543 Ga0207657_10212088
544 Ga0207694_10076650
545 Ga0207650_10001107
546 Ga0207711_10009440
547 Ga0207711_10014909
548 Ga0207640_10140089
549 Ga0207678_10042216
550 Ga0207678_10115282
551 Ga0207702_10391228
552 Ga0207674_10102694
553 Ga0209371_1001447
554 Ga0307515_10000136
555 Ga0307515_10012291
556 Ga0268256_1000474
557 Ga0268256_1007240
558 Ga0268256_1021653
559 Ga0265760_10042989
560 Ga0265339_10020250
561 Ga0307513_10000454
562 Ga0307513_10152880
563 Ga0307508_10016691
564 Ga0265314_10141304
565 Ga0307510_10164229
566 Ga0373931_0188026
567 Ga0436364_0095893
568 Ga0400483_145582
569 Ga0400483_152465
570 Ga0436365_0715858
571 Ga0436360_0479326
572 Ga0436361_0470581
573 Ga0436361_1108871
574 Ga0436363_1502314
575 Ga0436362_0611544
576 Ga0466959_0234121
577 Ga0495603_0000860
578 Ga0495590_0056924
579 Ga0495638_0001020
580 Ga0495638_0012080
581 Ga0495650_0000176
582 Ga0495580_0001717
583 Ga0495580_0007013
584 Ga0495605_0004950
585 Ga0495605_0014633
586 Ga0495584_0004564
587 Ga0495584_0016461
588 Ga0495585_0165288
589 Ga0495596_0033500
590 Ga0495607_0005244
591 Ga0495607_0082334
592 Ga0495583_0000619
593 Ga0495583_0006355
594 Ga0495606_0000436
595 Ga0495606_0018480
596 Ga0495606_0022735
597 Ga0495610_0089491
598 Ga0495616_0007913
599 Ga0495616_0027793
600 Ga0495628_0000614
601 Ga0495630_0055836
602 Ga0495643_0090226
603 Ga0495644_0015556
604 Ga0495648_0144643
605 Ga0495666_0016984
606 Ga0495642_0014652
607 Ga0495654_0001419
608 Ga0495665_0016423
609 Ga0495622_0011892
610 Ga0495611_0051603
611 Ga0495646_0005761
612 Ga0495670_0038615
613 Ga0495671_0009242
614 Ga0495649_0013722
615 Ga0495589_0000967
616 Ga0495660_0000010
617 Ga0495674_0000902
618 Ga0495674_0000942
619 Ga0495672_0000085
620 Ga0495672_0061711
621 Ga0495683_0010615
622 Ga0495683_0048186
623 Ga0495677_0017280
624 Ga0495673_0000245
625 Ga0495673_0015259
626 Ga0495673_0022683
627 Ga0495686_0000301
628 Ga0495626_0077978
629 Ga0496100_0006925
630 Ga0496100_0026454
631 Ga0496101_0056154
632 Ga0496102_0210321
633 Ga0496104_0048698
634 Ga0496104_0160224
635 Ga0496105_0012530
636 Ga0496105_0063886
637 Ga0496106_0000002
638 Ga0496107_0032194
639 Ga0496107_0036946
640 Ga0496107_0162577
641 Ga0496108_0606956
642 Ga0496111_0096337
643 Ga0496112_0009081
644 Ga0496113_0009880
645 Ga0496115_0011618
646 Ga0496116_0021442
647 Ga0496117_0013283
648 Ga0496118_0104197
649 Ga0496118_0133737
650 Ga0496119_0000366
651 Ga0496120_0000473
652 Ga0496121_0009480
653 Ga0496121_0011392
654 Ga0496121_0072518
655 Ga0496121_0149976
656 Ga0496122_0003292
657 Ga0496123_0003049
658 Ga0496124_0007095
659 Ga0496126_0000172
660 Ga0496126_0074837
661 Ga0495678_000387
662 Ga0495682_0000024
663 Ga0495682_0000040
664 Ga0495682_0008565
665 Ga0501031_0011901
666 Ga0501032_0051300
667 Ga0501032_0105614
668 Ga0501033_0015385
669 Ga0501034_0031373
670 Ga0501034_0047066
671 Ga0501034_0058268
672 Ga0501034_0087993
673 Ga0501036_0023731
674 Ga0501036_0032570
675 Ga0501037_0017041
676 Ga0501037_0032153
677 Ga0501038_0002394
678 Ga0501038_0008713
679 Ga0501038_0034021
680 Ga0501040_0295498
681 Ga0501043_0001293
682 Ga0501043_0085912
683 Ga0501046_0005361
684 Ga0501047_0091924
685 Ga0501048_0019019
686 Ga0501068_0170798
687 Ga0501069_0000173
688 Ga0501069_0038274
689 Ga0501070_0017123
690 Ga0501070_0022008
691 Ga0501072_0034681
692 Ga0501073_0005647
693 Ga0501073_0215237
694 Ga0501074_0013465
695 Ga0501075_0115108
696 Ga0501080_0025204
697 Ga0501080_0036432
698 Ga0501081_0233663
699 Ga0501083_0012585
700 Ga0501035_0002936
701 Ga0501035_0061679
702 Ga0501035_0307274
703 Ga0501044_0027174
704 Ga0501044_0124977
705 Ga0501044_0482727
706 nmdc:mga03n38_34019_c1
707 nmdc:mga07m45_142834_c1
708 Ga0500572_011515
709 Ga0500608_006908
710 Ga0500618_000936
711 Ga0500621_000007
712 Ga0500568_0000376
713 Ga0500568_0039929
714 Ga0500577_0011405
715 Ga0500588_0000767
716 Ga0500636_0000196
717 Ga0501082_0014679
718 Ga0501082_0194705
719 2503203451
720 2509115866
721 2509141152
722 2511136111
723 2511382362
724 2511435279
725 2512929667
726 2513614078
727 2513881605
728 2514052348
729 2523469031
730 2551696016
731 2551732542
732 2555257842
733 2563056616
734 2585232253
735 2585272159
736 2585334922
737 2585561780
738 2585899627
739 2585907010
740 2587982431
741 2588515248
742 2597815843
743 2599335381
744 2599409361
745 2599937515
746 2601522130
747 2601527155
748 2601613985
749 2601618708
750 2601642694
751 2601647535
752 2601652133
753 2601657460
754 2601662515
755 2601695472
756 2601700148
757 2601705257
758 2601710286
759 2601715298
760 2601720499
761 2601725704
762 2601730246
763 2601735263
764 2601739963
765 2601750452
766 2602017705
767 2603659887
768 2603665164
769 2603837633
770 2603842709
771 2603847782
772 2603852853
773 2603870906
774 2603875811
775 2606048097
776 2606069594
777 2606145397
778 2606175499
779 2616555926
780 2617385613
781 2637225262
782 2643988993
783 2644048502
784 2644152178
785 2644201863
786 2644481304
787 2644498308
788 2671585953
789 2676406506
790 2713481376
791 2739349919
792 2756673156
793 2765467313
794 2770198063
795 2776269911
796 2776281028
797 2777022730
798 2778178001
799 2791924176
800 2793280544
801 2793323252
802 2793331545
803 2793344550
804 2837680412
805 2839998069
806 2840766089
807 2841735041
808 2842397235
809 2842487362
810 2842928213
811 2844537986
812 2847089485
813 2847671706
814 2852394142
815 2856318563
816 2856347171
817 2869164283
818 2871481188
819 2874131196
820 2874176441
821 2876366771
822 2876373554
823 2876604827
824 2878037900
825 2878792604
826 2881611848
827 2888349063
828 2894819250
829 2903452946
830 2903524638
831 2903531119
832 2904513847
833 2904580305
834 2906328671
835 2906418601
836 2908671523
837 2909042887
838 2917558328
839 2919109062
840 2919120019
841 2924755576
842 2937063714
843 2937838737
844 2937850710
845 2939605482
846 2958074524
847 2963649565
848 2964614042
849 2968084727
850 2969082277
851 2970055104
852 2970529144
853 2970543145
854 2971823617
855 2977865381
856 2977927601
857 2977990805
858 2978976918
859 2984564704
860 2984597432
861 2989774814
862 3004214498
863 3004219179
864 637079411
865 8004402159
866 8004639125
867 8005383517
868 8005398067
869 8005686187
870 8005699148
871 8018155191
872 8024487623
873 8046774229
874 8054559372
875 8055434751
876 8055623370

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13407

Peripla_BP_4

Periplasmic binding protein domain

59

317

0.96

PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

56

332

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hsg-assembly1.cif.gz_A crystal structure of an abc transporter solute binding protein from klebsiella pneumoniae (kpn_01730, target efi-511059), apo open structure 0.9852 28 312
5hsg-assembly1.cif.gz_A crystal structure of an abc transporter solute binding protein from klebsiella pneumoniae (kpn_01730, target efi-511059), apo open structure 0.9784 28 312
7pu4-assembly2.cif.gz_C crystal structure of the dimer rbp-n and rbp-trunc from thermotoga maritima ribose binding protein 0.9414 28 146
1gud-assembly2.cif.gz_B hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations 0.9117 27 302
2fn9-assembly2.cif.gz_B thermotoga maritima ribose binding protein unliganded form 0.9052 28 302
ID Description Score Start End Superfamily
5hsgA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9791 128 312 3.40.50.2300
5hsgA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.973 128 312 3.40.50.2300
4kq9A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9597 27 116 3.40.50.2300
af_P02925_28_128_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9585 30 126 3.40.50.2300
5dteD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9583 28 120 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7H4MZA1-F1-model_v4 Putative ABC transport system nucleotide binding/ATPase component 0.9914 203 313 GO:0030246
GO:0030313
AF-A0A7H4MZA1-F1-model_v4 Putative ABC transport system nucleotide binding/ATPase component 0.9655 203 313 GO:0030246
GO:0030313
AF-A0A660R927-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9441 27 307 GO:0030246
GO:0030313
AF-A0A6C1QXF3-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9223 41 312 GO:0005886
GO:0030246
GO:0030313
AF-A0A7C6JXN6-F1-model_v4 Substrate-binding domain-containing protein 0.9087 27 313 GO:0007165
GO:0016020

Map