F444661

General Info

Members Datasets Scaffolds Average Seq Length
441 227 882 67

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_12466126|Ga0157380_124661261
Length 77
Sequence VRRHPKEDSTMSVARVTEISSRSDRSFEAAINEGIERAHKTLRNVKSAWIKEQQVDIENGRIVAYRVNMLITFVLDD

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
150 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
158 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
161 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
162 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
163 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
164 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
165 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
166 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
209 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
210 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
227 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.36
Nodule 0
Rhizoplane 5.44
Rhizosphere 92.29
Stem 0
Stem Tuber 0
Unclassified 20.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_12466126 3300014326 Bacteria 586
2 JGI24750J21931_1086331 3300002070 Unclassified 527
3 Ga0058860_11654267 3300004801 Bacteria 516
4 Ga0065714_10326015 3300005288 Bacteria 663
5 Ga0065712_10001484 3300005290 Bacteria 5782
6 Ga0065712_10633271 3300005290 Unclassified 575
7 Ga0065712_10688188 3300005290 Unclassified 552
8 Ga0065715_10103165 3300005293 Bacteria 3054
9 Ga0065707_11034830 3300005295 Bacteria 531
10 Ga0070683_100049949 3300005329 Bacteria 3870
11 Ga0070690_100191604 3300005330 Unclassified 1418
12 Ga0070690_101326893 3300005330 Bacteria 577
13 Ga0070670_100026903 3300005331 Bacteria 4948
14 Ga0070670_100097097 3300005331 Bacteria 2535
15 Ga0070666_10144210 3300005335 Bacteria 1659
16 Ga0070666_10367797 3300005335 Unclassified 1031
17 Ga0070682_100031198 3300005337 Bacteria 3223
18 Ga0070682_100102494 3300005337 Bacteria 1892
19 Ga0068868_100109432 3300005338 Unclassified 2244
20 Ga0068868_100773734 3300005338 Bacteria 864
21 Ga0070660_100212443 3300005339 Bacteria 1571
22 Ga0070660_101451670 3300005339 Unclassified 583
23 Ga0070689_100059653 3300005340 Bacteria 2966
24 Ga0070691_10689427 3300005341 Unclassified 612
25 Ga0070691_10800037 3300005341 Unclassified 574
26 Ga0070687_100003530 3300005343 Bacteria 6087
27 Ga0070687_100171318 3300005343 Bacteria 1292
28 Ga0070661_100481012 3300005344 Bacteria 992
29 Ga0070692_10085817 3300005345 Bacteria 1703
30 Ga0070668_100085569 3300005347 Bacteria 2478
31 Ga0070669_100163187 3300005353 Bacteria 1733
32 Ga0070675_100004406 3300005354 Bacteria 10739
33 Ga0070675_100513927 3300005354 Bacteria 1080
34 Ga0070671_100052741 3300005355 Bacteria 3381
35 Ga0070674_100083776 3300005356 Bacteria 2285
36 Ga0070673_100486765 3300005364 Bacteria 1114
37 Ga0070688_100045063 3300005365 Bacteria 2723
38 Ga0070688_100071064 3300005365 Bacteria 2227
39 Ga0070659_100395544 3300005366 Bacteria 1166
40 Ga0070659_100884144 3300005366 Unclassified 780
41 Ga0070659_101492334 3300005366 Bacteria 602
42 Ga0070667_100110354 3300005367 Bacteria 2385
43 Ga0070667_100293484 3300005367 Bacteria 1463
44 Ga0070701_10123170 3300005438 Unclassified 1464
45 Ga0070701_11061218 3300005438 Bacteria 568
46 Ga0070701_11101195 3300005438 Bacteria 559
47 Ga0070700_100063059 3300005441 Unclassified 2344
48 Ga0070700_100065044 3300005441 Bacteria 2311
49 Ga0070694_100665123 3300005444 Bacteria 844
50 Ga0070694_100949807 3300005444 Bacteria 712
51 Ga0070663_100059080 3300005455 Bacteria 2756
52 Ga0070663_101712972 3300005455 Bacteria 562
53 Ga0070678_100065294 3300005456 Bacteria 2701
54 Ga0070678_100544502 3300005456 Bacteria 1030
55 Ga0070662_100116234 3300005457 Bacteria 2044
56 Ga0070662_100490609 3300005457 Bacteria 1024
57 Ga0070681_10525112 3300005458 Bacteria 1097
58 Ga0070681_10975460 3300005458 Bacteria 767
59 Ga0068867_100017791 3300005459 Bacteria 5047
60 Ga0068867_100312705 3300005459 Unclassified 1299
61 Ga0068867_101321866 3300005459 Bacteria 666
62 Ga0070685_10002775 3300005466 Bacteria 8958
63 Ga0070685_10448274 3300005466 Unclassified 903
64 Ga0070698_100032886 3300005471 Bacteria 5372
65 Ga0070698_100701453 3300005471 Bacteria 954
66 Ga0070699_101605698 3300005518 Bacteria 596
67 Ga0070684_100161105 3300005535 Bacteria 2035
68 Ga0070684_102008182 3300005535 Bacteria 546
69 Ga0068853_100464310 3300005539 Unclassified 1192
70 Ga0068853_100620021 3300005539 Bacteria 1028
71 Ga0068853_100797637 3300005539 Bacteria 904
72 Ga0070672_100311768 3300005543 Bacteria 1336
73 Ga0070686_100090204 3300005544 Bacteria 2049
74 Ga0070686_100153698 3300005544 Unclassified 1614
75 Ga0070686_100565356 3300005544 Unclassified 891
76 Ga0070695_101904281 3300005545 Bacteria 500
77 Ga0070696_101022855 3300005546 Bacteria 691
78 Ga0070696_101358738 3300005546 Unclassified 605
79 Ga0070693_100262245 3300005547 Unclassified 1150
80 Ga0070693_100850026 3300005547 Unclassified 680
81 Ga0070665_100375377 3300005548 Bacteria 1429
82 Ga0070704_100497854 3300005549 Unclassified 1057
83 Ga0070704_101435182 3300005549 Bacteria 634
84 Ga0070664_100846753 3300005564 Bacteria 856
85 Ga0068856_101050904 3300005614 Bacteria 832
86 Ga0070702_100047188 3300005615 Bacteria 2445
87 Ga0068852_100207891 3300005616 Bacteria 1855
88 Ga0068852_101070456 3300005616 Unclassified 826
89 Ga0068859_100040292 3300005617 Bacteria 4689
90 Ga0068859_102129727 3300005617 Bacteria 619
91 Ga0068864_100095944 3300005618 Bacteria 2624
92 Ga0068864_100339753 3300005618 Bacteria 1415
93 Ga0068866_10320628 3300005718 Bacteria 975
94 Ga0068861_100743034 3300005719 Bacteria 916
95 Ga0068861_101396428 3300005719 Bacteria 684
96 Ga0068861_101991042 3300005719 Bacteria 579
97 Ga0068851_10282687 3300005834 Bacteria 949
98 Ga0068851_10319130 3300005834 Bacteria 897
99 Ga0068870_10021257 3300005840 Bacteria 3172
100 Ga0068870_10573603 3300005840 Bacteria 763
101 Ga0068863_101497625 3300005841 Unclassified 683
102 Ga0068863_102503253 3300005841 Unclassified 525
103 Ga0068858_100584101 3300005842 Bacteria 1083
104 Ga0068858_101168347 3300005842 Bacteria 756
105 Ga0068860_100199693 3300005843 Bacteria 1937
106 Ga0068862_100057527 3300005844 Bacteria 3335
107 Ga0068862_100532216 3300005844 Bacteria 1120
108 Ga0081539_10046186 3300005985 Bacteria 2498
109 Ga0075365_10665855 3300006038 Bacteria 735
110 Ga0075365_10683855 3300006038 Bacteria 725
111 Ga0075364_10536071 3300006051 Unclassified 800
112 Ga0075364_11071858 3300006051 Unclassified 547
113 Ga0070712_101627022 3300006175 Unclassified 565
114 Ga0097621_100246028 3300006237 Bacteria 1565
115 Ga0068871_100100557 3300006358 Bacteria 2422
116 Ga0068871_101350405 3300006358 Bacteria 671
117 Ga0075428_101923616 3300006844 Bacteria 614
118 Ga0075430_100034423 3300006846 Bacteria 4299
119 Ga0075433_11375365 3300006852 Bacteria 611
120 Ga0075434_100692501 3300006871 Bacteria 1037
121 Ga0075429_101866727 3300006880 Unclassified 521
122 Ga0075429_101917859 3300006880 Bacteria 513
123 Ga0068865_100092759 3300006881 Bacteria 2194
124 Ga0068865_101301902 3300006881 Bacteria 646
125 Ga0097620_100040290 3300006931 Bacteria 4689
126 Ga0097620_102130097 3300006931 Bacteria 619
127 Ga0105240_12240114 3300009093 Bacteria 566
128 Ga0111539_10041653 3300009094 Bacteria 5519
129 Ga0111539_10545255 3300009094 Bacteria 1351
130 Ga0111539_10550715 3300009094 Bacteria 1343
131 Ga0111539_10739008 3300009094 Bacteria 1145
132 Ga0105245_10031775 3300009098 Bacteria 4674
133 Ga0105245_10725078 3300009098 Bacteria 1029
134 Ga0105245_10788134 3300009098 Bacteria 988
135 Ga0105247_10732326 3300009101 Unclassified 748
136 Ga0114129_10181787 3300009147 Bacteria 2861
137 Ga0114129_10513620 3300009147 Bacteria 1563
138 Ga0114129_10571304 3300009147 Bacteria 1468
139 Ga0114129_11840001 3300009147 Bacteria 735
140 Ga0114129_12491268 3300009147 Viruses 619
141 Ga0105243_10088075 3300009148 Bacteria 2550
142 Ga0105243_10330359 3300009148 Bacteria 1392
143 Ga0105243_10986766 3300009148 Bacteria 844
144 Ga0105243_12635102 3300009148 Unclassified 543
145 Ga0105241_11667898 3300009174 Unclassified 618
146 Ga0105242_10050272 3300009176 Bacteria 3393
147 Ga0105242_10593579 3300009176 Bacteria 1069
148 Ga0105248_10157906 3300009177 Bacteria 2559
149 Ga0105248_10492871 3300009177 Bacteria 1381
150 Ga0105237_10837254 3300009545 Bacteria 927
151 Ga0105238_10020045 3300009551 Bacteria 6807
152 Ga0105238_10822115 3300009551 Bacteria 945
153 Ga0105249_10026345 3300009553 Bacteria 5238
154 Ga0105249_10176070 3300009553 Bacteria 2078
155 Ga0105239_10023733 3300010375 Bacteria 6753
156 Ga0105239_13108137 3300010375 Unclassified 541
157 Ga0105246_10085628 3300011119 Bacteria 2257
158 Ga0157374_10496329 3300013296 Bacteria 1225
159 Ga0157374_11291850 3300013296 Unclassified 752
160 Ga0157378_10318314 3300013297 Unclassified 1511
161 Ga0157378_11263905 3300013297 Bacteria 779
162 Ga0163162_10120222 3300013306 Bacteria 2730
163 Ga0157375_10046880 3300013308 Bacteria 4217
164 Ga0157375_10058708 3300013308 Bacteria 3808
165 Ga0163163_10061359 3300014325 Bacteria 3725
166 Ga0157380_10037432 3300014326 Bacteria 3759
167 Ga0157380_10412802 3300014326 Bacteria 1285
168 Ga0157377_10008500 3300014745 Bacteria 5008
169 Ga0157379_10340534 3300014968 Bacteria 1371
170 Ga0157376_12116186 3300014969 Bacteria 601
171 Ga0163161_10453002 3300017792 Bacteria 1037
172 Ga0163161_10641883 3300017792 Unclassified 879
173 Ga0163161_11034925 3300017792 Unclassified 702
174 Ga0206356_11347213 3300020070 Unclassified 524
175 Ga0207697_10336274 3300025315 Bacteria 670
176 Ga0207656_10556267 3300025321 Bacteria 584
177 Ga0207642_10215134 3300025899 Bacteria 1070
178 Ga0207688_10306604 3300025901 Bacteria 972
179 Ga0207680_10246014 3300025903 Bacteria 1234
180 Ga0207647_10648106 3300025904 Bacteria 579
181 Ga0207645_10591759 3300025907 Unclassified 753
182 Ga0207643_10006780 3300025908 Bacteria 6144
183 Ga0207643_10158319 3300025908 Bacteria 1361
184 Ga0207684_10361362 3300025910 Bacteria 1249
185 Ga0207684_10394911 3300025910 Bacteria 1189
186 Ga0207707_10458114 3300025912 Bacteria 1091
187 Ga0207695_11004215 3300025913 Bacteria 714
188 Ga0207671_11241731 3300025914 Unclassified 582
189 Ga0207662_10076581 3300025918 Bacteria 2033
190 Ga0207657_10523533 3300025919 Unclassified 928
191 Ga0207657_10927200 3300025919 Bacteria 670
192 Ga0207646_11898171 3300025922 Bacteria 508
193 Ga0207681_10253849 3300025923 Bacteria 1374
194 Ga0207681_10532295 3300025923 Bacteria 965
195 Ga0207681_10952905 3300025923 Unclassified 719
196 Ga0207694_10189961 3300025924 Unclassified 1668
197 Ga0207694_10259237 3300025924 Bacteria 1424
198 Ga0207694_10816159 3300025924 Bacteria 788
199 Ga0207650_10064219 3300025925 Bacteria 2747
200 Ga0207659_10058398 3300025926 Bacteria 2769
201 Ga0207659_10525093 3300025926 Bacteria 1004
202 Ga0207659_10964626 3300025926 Unclassified 733
203 Ga0207687_10113344 3300025927 Bacteria 2017
204 Ga0207644_10259925 3300025931 Bacteria 1388
205 Ga0207690_10007822 3300025932 Bacteria 6348
206 Ga0207690_10132249 3300025932 Bacteria 1828
207 Ga0207706_10009609 3300025933 Bacteria 8876
208 Ga0207706_10147825 3300025933 Bacteria 2067
209 Ga0207706_10214715 3300025933 Bacteria 1685
210 Ga0207686_10119640 3300025934 Bacteria 1790
211 Ga0207686_11424919 3300025934 Unclassified 570
212 Ga0207709_10152479 3300025935 Bacteria 1602
213 Ga0207709_10209553 3300025935 Bacteria 1398
214 Ga0207709_11321094 3300025935 Bacteria 596
215 Ga0207670_10104205 3300025936 Bacteria 2031
216 Ga0207670_10189284 3300025936 Bacteria 1556
217 Ga0207669_10089209 3300025937 Bacteria 2002
218 Ga0207669_10215132 3300025937 Bacteria 1406
219 Ga0207704_10039710 3300025938 Bacteria 2744
220 Ga0207691_10256997 3300025940 Bacteria 1506
221 Ga0207711_10099374 3300025941 Bacteria 2572
222 Ga0207711_10273988 3300025941 Bacteria 1553
223 Ga0207689_10837245 3300025942 Unclassified 777
224 Ga0207712_10003898 3300025961 Bacteria 9421
225 Ga0207712_10070035 3300025961 Bacteria 2518
226 Ga0207668_10337625 3300025972 Bacteria 1256
227 Ga0207668_10374486 3300025972 Bacteria 1197
228 Ga0207658_10189905 3300025986 Bacteria 1707
229 Ga0207677_10776329 3300026023 Bacteria 856
230 Ga0207677_11118733 3300026023 Unclassified 718
231 Ga0207703_11062015 3300026035 Bacteria 777
232 Ga0207639_10415738 3300026041 Bacteria 1215
233 Ga0207639_10650188 3300026041 Bacteria 975
234 Ga0207639_12303382 3300026041 Bacteria 500
235 Ga0207678_10055044 3300026067 Bacteria 3426
236 Ga0207708_10013524 3300026075 Bacteria 6101
237 Ga0207708_10236988 3300026075 Bacteria 1466
238 Ga0207648_10008432 3300026089 Bacteria 9984
239 Ga0207648_10032580 3300026089 Bacteria 4600
240 Ga0207676_10095956 3300026095 Bacteria 2447
241 Ga0207676_10184129 3300026095 Bacteria 1831
242 Ga0207674_10007678 3300026116 Bacteria 12558
243 Ga0207675_100053277 3300026118 Bacteria 3775
244 Ga0207675_100150195 3300026118 Bacteria 2217
245 Ga0207675_100356736 3300026118 Bacteria 1434
246 Ga0207675_102329030 3300026118 Unclassified 549
247 Ga0207683_10019431 3300026121 Bacteria 5802
248 Ga0207683_10154609 3300026121 Bacteria 2071
249 Ga0207698_10183868 3300026142 Bacteria 1855
250 Ga0207698_11758388 3300026142 Unclassified 635
251 Ga0207428_10116162 3300027907 Bacteria 2055
252 Ga0207428_10208247 3300027907 Bacteria 1470
253 Ga0268266_10134676 3300028379 Bacteria 2212
254 Ga0268266_10563985 3300028379 Bacteria 1092
255 Ga0268265_10617282 3300028380 Bacteria 1038
256 Ga0268264_10397300 3300028381 Bacteria 1324
257 Ga0268264_10903866 3300028381 Bacteria 886
258 Ga0268264_11198798 3300028381 Bacteria 769
259 Ga0268264_12350089 3300028381 Bacteria 540
260 Ga0316576_10002327 3300031727 Bacteria 10780
261 Ga0316578_10049472 3300031728 Bacteria 2457
262 Ga0307405_10400347 3300031731 Bacteria 1074
263 Ga0307410_11283409 3300031852 Unclassified 640
264 Ga0307409_101565912 3300031995 Bacteria 687
265 Ga0307416_100002766 3300032002 Bacteria 10183
266 Ga0307416_102349118 3300032002 Unclassified 633
267 Ga0307411_10437322 3300032005 Bacteria 1091
268 Ga0307415_101392719 3300032126 Bacteria 667
269 Ga0373961_0000533 3300035241 Bacteria 14489
270 Ga0316574_0294927 3300035398 Bacteria 1032
271 Ga0316574_0791707 3300035398 Unclassified 577
272 Ga0373931_0012942 3300035691 Bacteria 4052
273 Ga0316582_0311878 3300036647 Unclassified 1081
274 Ga0316584_0029595 3300036712 Bacteria 4043
275 Ga0400483_066879 3300039062 Bacteria 63337
276 Ga0439461_0026508 3300041410 Bacteria 1183
277 Ga0439465_0213976 3300041413 Bacteria 705
278 Ga0451807_1114457 3300041486 Unclassified 550
279 Ga0451807_1192828 3300041486 Archaea 2086
280 Ga0439444_0125130 3300042437 Unclassified 603
281 Ga0451577_0625581 3300042876 Unclassified 977
282 Ga0453683_0815979 3300044673 Unclassified 614
283 Ga0453683_0922536 3300044673 Unclassified 578
284 Ga0453684_0000298 3300044712 Bacteria 209777
285 Ga0453684_0085376 3300044712 Bacteria 3922
286 Ga0453684_0374990 3300044712 Bacteria 1599
287 Ga0453684_0843759 3300044712 Unclassified 985
288 Ga0451576_0000033 3300045051 Bacteria 393131
289 Ga0495584_0561246 3300046491 Unclassified 582
290 Ga0496100_0078455 3300048903 Bacteria 2223
291 Ga0496101_0165102 3300048904 Bacteria 1700
292 Ga0496102_0345103 3300048905 Bacteria 1402
293 Ga0496102_0396321 3300048905 Bacteria 1298
294 Ga0496102_1042811 3300048905 Unclassified 738
295 Ga0496103_0069269 3300048906 Bacteria 2205
296 Ga0496104_0169667 3300048907 Bacteria 2092
297 Ga0496106_0168881 3300048909 Bacteria 1733
298 Ga0496106_1458106 3300048909 Bacteria 527
299 Ga0496107_0320858 3300048910 Unclassified 1153
300 Ga0496108_0607216 3300048911 Bacteria 953
301 Ga0496108_1489447 3300048911 Unclassified 563
302 Ga0496109_0036112 3300048912 Bacteria 4460
303 Ga0496109_0200012 3300048912 Bacteria 1878
304 Ga0496110_0131092 3300048913 Bacteria 2264
305 Ga0496110_0418539 3300048913 Bacteria 1222
306 Ga0496111_0480538 3300048914 Bacteria 915
307 Ga0496111_1137555 3300048914 Bacteria 555
308 Ga0496112_0143082 3300048915 Bacteria 2360
309 Ga0496113_0279765 3300048916 Bacteria 1334
310 Ga0496113_0451512 3300048916 Bacteria 1033
311 Ga0496114_0165055 3300048917 Bacteria 1928
312 Ga0496117_0127368 3300048920 Bacteria 1551
313 Ga0496118_0075687 3300048921 Bacteria 2399
314 Ga0501296_076087 3300049519 Unclassified 526
315 Ga0501031_0051947 3300049568 Unclassified 2671
316 Ga0501031_0272052 3300049568 Unclassified 1100
317 Ga0501031_0278808 3300049568 Bacteria 1085
318 Ga0501034_1500930 3300049571 Bacteria 548
319 Ga0501036_0132345 3300049572 Bacteria 2105
320 Ga0501036_0557667 3300049572 Unclassified 952
321 Ga0501036_0568206 3300049572 Bacteria 942
322 Ga0501036_1101557 3300049572 Bacteria 649
323 Ga0501037_1060744 3300049573 Unclassified 526
324 Ga0501038_0063040 3300049574 Bacteria 3166
325 Ga0501038_0379340 3300049574 Bacteria 1097
326 Ga0501038_0669831 3300049574 Bacteria 780
327 Ga0501038_0878305 3300049574 Unclassified 663
328 Ga0501039_0054016 3300049575 Bacteria 3110
329 Ga0501039_0128293 3300049575 Bacteria 1990
330 Ga0501039_0128922 3300049575 Bacteria 1985
331 Ga0501039_0479309 3300049575 Bacteria 977
332 Ga0501039_1054626 3300049575 Bacteria 631
333 Ga0501040_0029046 3300049576 Archaea 3731
334 Ga0501040_0371856 3300049576 Bacteria 1025
335 Ga0501040_1266620 3300049576 Unclassified 535
336 Ga0501041_0029495 3300049577 Bacteria 3309
337 Ga0501041_0109835 3300049577 Bacteria 1711
338 Ga0501042_0148840 3300049578 Bacteria 1688
339 Ga0501042_0392742 3300049578 Bacteria 1005
340 Ga0501042_0531575 3300049578 Bacteria 854
341 Ga0501042_0778907 3300049578 Bacteria 696
342 Ga0501042_0862739 3300049578 Bacteria 659
343 Ga0501046_0206256 3300049580 Bacteria 1461
344 Ga0501046_0674694 3300049580 Bacteria 729
345 Ga0501048_0054086 3300049582 Bacteria 2852
346 Ga0501048_0316596 3300049582 Bacteria 1111
347 Ga0501048_0524666 3300049582 Unclassified 849
348 Ga0501048_0748689 3300049582 Unclassified 702
349 Ga0501068_0695607 3300049584 Unclassified 665
350 Ga0501069_0140041 3300049585 Bacteria 1388
351 Ga0501069_0703350 3300049585 Bacteria 610
352 Ga0501070_1351875 3300049586 Unclassified 543
353 Ga0501071_0015806 3300049587 Bacteria 5185
354 Ga0501071_0067664 3300049587 Bacteria 2598
355 Ga0501071_0403597 3300049587 Bacteria 1044
356 Ga0501071_0685506 3300049587 Bacteria 789
357 Ga0501071_0745731 3300049587 Unclassified 754
358 Ga0501071_1071148 3300049587 Bacteria 623
359 Ga0501071_1526526 3300049587 Unclassified 516
360 Ga0501072_0043749 3300049588 Bacteria 3520
361 Ga0501072_0082484 3300049588 Bacteria 2549
362 Ga0501072_0128160 3300049588 Bacteria 2022
363 Ga0501072_0140845 3300049588 Bacteria 1923
364 Ga0501072_0448001 3300049588 Bacteria 1022
365 Ga0501074_0081999 3300049590 Bacteria 2313
366 Ga0501074_0279360 3300049590 Bacteria 1187
367 Ga0501074_0729341 3300049590 Unclassified 699
368 Ga0501075_0001609 3300049591 Bacteria 14795
369 Ga0501075_0181684 3300049591 Bacteria 1605
370 Ga0501075_0311760 3300049591 Bacteria 1199
371 Ga0501075_0516835 3300049591 Bacteria 911
372 Ga0501075_0950670 3300049591 Bacteria 653
373 Ga0501075_1021355 3300049591 Unclassified 628
374 Ga0501075_1096084 3300049591 Unclassified 605
375 Ga0501076_0019083 3300049592 Bacteria 5233
376 Ga0501076_0075893 3300049592 Bacteria 2695
377 Ga0501076_0192334 3300049592 Bacteria 1665
378 Ga0501076_0257606 3300049592 Bacteria 1428
379 Ga0501076_0844942 3300049592 Unclassified 755
380 Ga0501076_1671594 3300049592 Bacteria 522
381 Ga0501077_0020148 3300049593 Bacteria 4222
382 Ga0501077_0148219 3300049593 Bacteria 1489
383 Ga0501077_0193730 3300049593 Bacteria 1291
384 Ga0501077_0316390 3300049593 Bacteria 995
385 Ga0501077_0461860 3300049593 Bacteria 813
386 Ga0501243_042198 3300049675 Unclassified 804
387 Ga0501225_0258043 3300049705 Bacteria 576
388 Ga0501079_0200328 3300049741 Bacteria 1559
389 Ga0501079_0286316 3300049741 Bacteria 1288
390 Ga0501079_0298756 3300049741 Bacteria 1260
391 Ga0501079_0426178 3300049741 Bacteria 1041
392 Ga0501079_0533861 3300049741 Unclassified 922
393 Ga0501079_0975397 3300049741 Bacteria 667
394 Ga0501080_0176775 3300049742 Bacteria 1966
395 Ga0501080_0227078 3300049742 Bacteria 1707
396 Ga0501080_1256678 3300049742 Unclassified 635
397 Ga0501081_0087897 3300049743 Bacteria 2183
398 Ga0501081_0099430 3300049743 Bacteria 2055
399 Ga0501081_0190905 3300049743 Unclassified 1483
400 Ga0501081_0654726 3300049743 Bacteria 787
401 Ga0501081_0907484 3300049743 Unclassified 664
402 Ga0501081_1206539 3300049743 Bacteria 573
403 Ga0501035_0071095 3300049822 Bacteria 3082
404 Ga0501035_0892770 3300049822 Bacteria 704
405 Ga0501035_1357187 3300049822 Bacteria 546
406 Ga0501044_1155326 3300049823 Bacteria 643
407 Ga0501045_0053879 3300049824 Bacteria 2940
408 Ga0501045_0069848 3300049824 Bacteria 2583
409 Ga0501045_0096085 3300049824 Unclassified 2192
410 Ga0501045_0857416 3300049824 Bacteria 668
411 nmdc:mga00v17_824307_c1 3300050491 Unclassified 590
412 nmdc:mga0yw44_1105214_c1 3300050492 Bacteria 536
413 nmdc:mga05p37_1800309_c1 3300050507 Bacteria 591
414 nmdc:mga05p37_18043_c1 3300050507 Bacteria 8523
415 nmdc:mga05p37_351148_c1 3300050507 Bacteria 1736
416 nmdc:mga05p37_509289_c1 3300050507 Bacteria 1379
417 nmdc:mga09592_1395337_c1 3300050508 Unclassified 573
418 nmdc:mga09592_9817_c1 3300050508 Bacteria 7781
419 nmdc:mga0qj67_126307_c1 3300050509 Bacteria 2070
420 nmdc:mga0qj67_257014_c1 3300050509 Bacteria 1417
421 nmdc:mga06r32_1877516_c1 3300050510 Unclassified 534
422 nmdc:mga08y16_454434_c1 3300050511 Bacteria 1306
423 nmdc:mga08y16_885687_c1 3300050511 Bacteria 880
424 nmdc:mga0n895_1188232_c1 3300050512 Unclassified 737
425 Ga0501084_0122781 3300054114 Bacteria 2184
426 Ga0501084_0201538 3300054114 Unclassified 1679
427 Ga0501084_0244606 3300054114 Bacteria 1514
428 Ga0501084_0308166 3300054114 Unclassified 1337
429 Ga0501084_0322236 3300054114 Bacteria 1305
430 Ga0501084_0440701 3300054114 Bacteria 1101
431 Ga0501084_0714929 3300054114 Bacteria 845
432 Ga0501082_0057839 3300060353 Bacteria 3340
433 Ga0501082_0218605 3300060353 Bacteria 1658
434 Ga0501082_0427382 3300060353 Bacteria 1157
435 Ga0501082_0509217 3300060353 Bacteria 1052
436 Ga0501082_0664606 3300060353 Bacteria 912
437 Ga0501082_0760797 3300060353 Bacteria 848
438 Ga0530510_0008606 3300061734 Bacteria 7129
439 Ga0530510_0312902 3300061734 Bacteria 1176
440 Ga0530510_0331642 3300061734 Bacteria 1141
441 Ga0530510_0994011 3300061734 Unclassified 642
442 Ga0157380_12466126
443 JGI24750J21931_1086331
444 Ga0058860_11654267
445 Ga0065714_10326015
446 Ga0065712_10001484
447 Ga0065712_10633271
448 Ga0065712_10688188
449 Ga0065715_10103165
450 Ga0065707_11034830
451 Ga0070683_100049949
452 Ga0070690_100191604
453 Ga0070690_101326893
454 Ga0070670_100026903
455 Ga0070670_100097097
456 Ga0070666_10144210
457 Ga0070666_10367797
458 Ga0070682_100031198
459 Ga0070682_100102494
460 Ga0068868_100109432
461 Ga0068868_100773734
462 Ga0070660_100212443
463 Ga0070660_101451670
464 Ga0070689_100059653
465 Ga0070691_10689427
466 Ga0070691_10800037
467 Ga0070687_100003530
468 Ga0070687_100171318
469 Ga0070661_100481012
470 Ga0070692_10085817
471 Ga0070668_100085569
472 Ga0070669_100163187
473 Ga0070675_100004406
474 Ga0070675_100513927
475 Ga0070671_100052741
476 Ga0070674_100083776
477 Ga0070673_100486765
478 Ga0070688_100045063
479 Ga0070688_100071064
480 Ga0070659_100395544
481 Ga0070659_100884144
482 Ga0070659_101492334
483 Ga0070667_100110354
484 Ga0070667_100293484
485 Ga0070701_10123170
486 Ga0070701_11061218
487 Ga0070701_11101195
488 Ga0070700_100063059
489 Ga0070700_100065044
490 Ga0070694_100665123
491 Ga0070694_100949807
492 Ga0070663_100059080
493 Ga0070663_101712972
494 Ga0070678_100065294
495 Ga0070678_100544502
496 Ga0070662_100116234
497 Ga0070662_100490609
498 Ga0070681_10525112
499 Ga0070681_10975460
500 Ga0068867_100017791
501 Ga0068867_100312705
502 Ga0068867_101321866
503 Ga0070685_10002775
504 Ga0070685_10448274
505 Ga0070698_100032886
506 Ga0070698_100701453
507 Ga0070699_101605698
508 Ga0070684_100161105
509 Ga0070684_102008182
510 Ga0068853_100464310
511 Ga0068853_100620021
512 Ga0068853_100797637
513 Ga0070672_100311768
514 Ga0070686_100090204
515 Ga0070686_100153698
516 Ga0070686_100565356
517 Ga0070695_101904281
518 Ga0070696_101022855
519 Ga0070696_101358738
520 Ga0070693_100262245
521 Ga0070693_100850026
522 Ga0070665_100375377
523 Ga0070704_100497854
524 Ga0070704_101435182
525 Ga0070664_100846753
526 Ga0068856_101050904
527 Ga0070702_100047188
528 Ga0068852_100207891
529 Ga0068852_101070456
530 Ga0068859_100040292
531 Ga0068859_102129727
532 Ga0068864_100095944
533 Ga0068864_100339753
534 Ga0068866_10320628
535 Ga0068861_100743034
536 Ga0068861_101396428
537 Ga0068861_101991042
538 Ga0068851_10282687
539 Ga0068851_10319130
540 Ga0068870_10021257
541 Ga0068870_10573603
542 Ga0068863_101497625
543 Ga0068863_102503253
544 Ga0068858_100584101
545 Ga0068858_101168347
546 Ga0068860_100199693
547 Ga0068862_100057527
548 Ga0068862_100532216
549 Ga0081539_10046186
550 Ga0075365_10665855
551 Ga0075365_10683855
552 Ga0075364_10536071
553 Ga0075364_11071858
554 Ga0070712_101627022
555 Ga0097621_100246028
556 Ga0068871_100100557
557 Ga0068871_101350405
558 Ga0075428_101923616
559 Ga0075430_100034423
560 Ga0075433_11375365
561 Ga0075434_100692501
562 Ga0075429_101866727
563 Ga0075429_101917859
564 Ga0068865_100092759
565 Ga0068865_101301902
566 Ga0097620_100040290
567 Ga0097620_102130097
568 Ga0105240_12240114
569 Ga0111539_10041653
570 Ga0111539_10545255
571 Ga0111539_10550715
572 Ga0111539_10739008
573 Ga0105245_10031775
574 Ga0105245_10725078
575 Ga0105245_10788134
576 Ga0105247_10732326
577 Ga0114129_10181787
578 Ga0114129_10513620
579 Ga0114129_10571304
580 Ga0114129_11840001
581 Ga0114129_12491268
582 Ga0105243_10088075
583 Ga0105243_10330359
584 Ga0105243_10986766
585 Ga0105243_12635102
586 Ga0105241_11667898
587 Ga0105242_10050272
588 Ga0105242_10593579
589 Ga0105248_10157906
590 Ga0105248_10492871
591 Ga0105237_10837254
592 Ga0105238_10020045
593 Ga0105238_10822115
594 Ga0105249_10026345
595 Ga0105249_10176070
596 Ga0105239_10023733
597 Ga0105239_13108137
598 Ga0105246_10085628
599 Ga0157374_10496329
600 Ga0157374_11291850
601 Ga0157378_10318314
602 Ga0157378_11263905
603 Ga0163162_10120222
604 Ga0157375_10046880
605 Ga0157375_10058708
606 Ga0163163_10061359
607 Ga0157380_10037432
608 Ga0157380_10412802
609 Ga0157377_10008500
610 Ga0157379_10340534
611 Ga0157376_12116186
612 Ga0163161_10453002
613 Ga0163161_10641883
614 Ga0163161_11034925
615 Ga0206356_11347213
616 Ga0207697_10336274
617 Ga0207656_10556267
618 Ga0207642_10215134
619 Ga0207688_10306604
620 Ga0207680_10246014
621 Ga0207647_10648106
622 Ga0207645_10591759
623 Ga0207643_10006780
624 Ga0207643_10158319
625 Ga0207684_10361362
626 Ga0207684_10394911
627 Ga0207707_10458114
628 Ga0207695_11004215
629 Ga0207671_11241731
630 Ga0207662_10076581
631 Ga0207657_10523533
632 Ga0207657_10927200
633 Ga0207646_11898171
634 Ga0207681_10253849
635 Ga0207681_10532295
636 Ga0207681_10952905
637 Ga0207694_10189961
638 Ga0207694_10259237
639 Ga0207694_10816159
640 Ga0207650_10064219
641 Ga0207659_10058398
642 Ga0207659_10525093
643 Ga0207659_10964626
644 Ga0207687_10113344
645 Ga0207644_10259925
646 Ga0207690_10007822
647 Ga0207690_10132249
648 Ga0207706_10009609
649 Ga0207706_10147825
650 Ga0207706_10214715
651 Ga0207686_10119640
652 Ga0207686_11424919
653 Ga0207709_10152479
654 Ga0207709_10209553
655 Ga0207709_11321094
656 Ga0207670_10104205
657 Ga0207670_10189284
658 Ga0207669_10089209
659 Ga0207669_10215132
660 Ga0207704_10039710
661 Ga0207691_10256997
662 Ga0207711_10099374
663 Ga0207711_10273988
664 Ga0207689_10837245
665 Ga0207712_10003898
666 Ga0207712_10070035
667 Ga0207668_10337625
668 Ga0207668_10374486
669 Ga0207658_10189905
670 Ga0207677_10776329
671 Ga0207677_11118733
672 Ga0207703_11062015
673 Ga0207639_10415738
674 Ga0207639_10650188
675 Ga0207639_12303382
676 Ga0207678_10055044
677 Ga0207708_10013524
678 Ga0207708_10236988
679 Ga0207648_10008432
680 Ga0207648_10032580
681 Ga0207676_10095956
682 Ga0207676_10184129
683 Ga0207674_10007678
684 Ga0207675_100053277
685 Ga0207675_100150195
686 Ga0207675_100356736
687 Ga0207675_102329030
688 Ga0207683_10019431
689 Ga0207683_10154609
690 Ga0207698_10183868
691 Ga0207698_11758388
692 Ga0207428_10116162
693 Ga0207428_10208247
694 Ga0268266_10134676
695 Ga0268266_10563985
696 Ga0268265_10617282
697 Ga0268264_10397300
698 Ga0268264_10903866
699 Ga0268264_11198798
700 Ga0268264_12350089
701 Ga0316576_10002327
702 Ga0316578_10049472
703 Ga0307405_10400347
704 Ga0307410_11283409
705 Ga0307409_101565912
706 Ga0307416_100002766
707 Ga0307416_102349118
708 Ga0307411_10437322
709 Ga0307415_101392719
710 Ga0373961_0000533
711 Ga0316574_0294927
712 Ga0316574_0791707
713 Ga0373931_0012942
714 Ga0316582_0311878
715 Ga0316584_0029595
716 Ga0400483_066879
717 Ga0439461_0026508
718 Ga0439465_0213976
719 Ga0451807_1114457
720 Ga0451807_1192828
721 Ga0439444_0125130
722 Ga0451577_0625581
723 Ga0453683_0815979
724 Ga0453683_0922536
725 Ga0453684_0000298
726 Ga0453684_0085376
727 Ga0453684_0374990
728 Ga0453684_0843759
729 Ga0451576_0000033
730 Ga0495584_0561246
731 Ga0496100_0078455
732 Ga0496101_0165102
733 Ga0496102_0345103
734 Ga0496102_0396321
735 Ga0496102_1042811
736 Ga0496103_0069269
737 Ga0496104_0169667
738 Ga0496106_0168881
739 Ga0496106_1458106
740 Ga0496107_0320858
741 Ga0496108_0607216
742 Ga0496108_1489447
743 Ga0496109_0036112
744 Ga0496109_0200012
745 Ga0496110_0131092
746 Ga0496110_0418539
747 Ga0496111_0480538
748 Ga0496111_1137555
749 Ga0496112_0143082
750 Ga0496113_0279765
751 Ga0496113_0451512
752 Ga0496114_0165055
753 Ga0496117_0127368
754 Ga0496118_0075687
755 Ga0501296_076087
756 Ga0501031_0051947
757 Ga0501031_0272052
758 Ga0501031_0278808
759 Ga0501034_1500930
760 Ga0501036_0132345
761 Ga0501036_0557667
762 Ga0501036_0568206
763 Ga0501036_1101557
764 Ga0501037_1060744
765 Ga0501038_0063040
766 Ga0501038_0379340
767 Ga0501038_0669831
768 Ga0501038_0878305
769 Ga0501039_0054016
770 Ga0501039_0128293
771 Ga0501039_0128922
772 Ga0501039_0479309
773 Ga0501039_1054626
774 Ga0501040_0029046
775 Ga0501040_0371856
776 Ga0501040_1266620
777 Ga0501041_0029495
778 Ga0501041_0109835
779 Ga0501042_0148840
780 Ga0501042_0392742
781 Ga0501042_0531575
782 Ga0501042_0778907
783 Ga0501042_0862739
784 Ga0501046_0206256
785 Ga0501046_0674694
786 Ga0501048_0054086
787 Ga0501048_0316596
788 Ga0501048_0524666
789 Ga0501048_0748689
790 Ga0501068_0695607
791 Ga0501069_0140041
792 Ga0501069_0703350
793 Ga0501070_1351875
794 Ga0501071_0015806
795 Ga0501071_0067664
796 Ga0501071_0403597
797 Ga0501071_0685506
798 Ga0501071_0745731
799 Ga0501071_1071148
800 Ga0501071_1526526
801 Ga0501072_0043749
802 Ga0501072_0082484
803 Ga0501072_0128160
804 Ga0501072_0140845
805 Ga0501072_0448001
806 Ga0501074_0081999
807 Ga0501074_0279360
808 Ga0501074_0729341
809 Ga0501075_0001609
810 Ga0501075_0181684
811 Ga0501075_0311760
812 Ga0501075_0516835
813 Ga0501075_0950670
814 Ga0501075_1021355
815 Ga0501075_1096084
816 Ga0501076_0019083
817 Ga0501076_0075893
818 Ga0501076_0192334
819 Ga0501076_0257606
820 Ga0501076_0844942
821 Ga0501076_1671594
822 Ga0501077_0020148
823 Ga0501077_0148219
824 Ga0501077_0193730
825 Ga0501077_0316390
826 Ga0501077_0461860
827 Ga0501243_042198
828 Ga0501225_0258043
829 Ga0501079_0200328
830 Ga0501079_0286316
831 Ga0501079_0298756
832 Ga0501079_0426178
833 Ga0501079_0533861
834 Ga0501079_0975397
835 Ga0501080_0176775
836 Ga0501080_0227078
837 Ga0501080_1256678
838 Ga0501081_0087897
839 Ga0501081_0099430
840 Ga0501081_0190905
841 Ga0501081_0654726
842 Ga0501081_0907484
843 Ga0501081_1206539
844 Ga0501035_0071095
845 Ga0501035_0892770
846 Ga0501035_1357187
847 Ga0501044_1155326
848 Ga0501045_0053879
849 Ga0501045_0069848
850 Ga0501045_0096085
851 Ga0501045_0857416
852 nmdc:mga00v17_824307_c1
853 nmdc:mga0yw44_1105214_c1
854 nmdc:mga05p37_1800309_c1
855 nmdc:mga05p37_18043_c1
856 nmdc:mga05p37_351148_c1
857 nmdc:mga05p37_509289_c1
858 nmdc:mga09592_1395337_c1
859 nmdc:mga09592_9817_c1
860 nmdc:mga0qj67_126307_c1
861 nmdc:mga0qj67_257014_c1
862 nmdc:mga06r32_1877516_c1
863 nmdc:mga08y16_454434_c1
864 nmdc:mga08y16_885687_c1
865 nmdc:mga0n895_1188232_c1
866 Ga0501084_0122781
867 Ga0501084_0201538
868 Ga0501084_0244606
869 Ga0501084_0308166
870 Ga0501084_0322236
871 Ga0501084_0440701
872 Ga0501084_0714929
873 Ga0501082_0057839
874 Ga0501082_0218605
875 Ga0501082_0427382
876 Ga0501082_0509217
877 Ga0501082_0664606
878 Ga0501082_0760797
879 Ga0530510_0008606
880 Ga0530510_0312902
881 Ga0530510_0331642
882 Ga0530510_0994011

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07311

Dodecin

Dodecin

13

76

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ri3-assembly1.cif.gz_A dodecin from streptomyces davaonensis 0.9476 2 67
6r1e-assembly1.cif.gz_A structure of dodecin from streptomyces coelicolor 0.9425 2 67
2vxa-assembly1.cif.gz_A h. halophila dodecin in complex with riboflavin 0.9414 1 66
2v19-assembly1.cif.gz_D crystal structure of the t. thermophilus dodecin r45a mutant 0.9361 1 67
2vyx-assembly1.cif.gz_F crystal structure of the t. thermophilus dodecin w38f mutant 0.9303 1 67
ID Description Score Start End Superfamily
2vkfA00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.9084 3 66 3.30.1660.10
2vkfA00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.8951 3 66 3.30.1660.10
3oqtP00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.8903 1 67 3.30.1660.10
af_G2TRR0_12_69_3.30.1660.10 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.8783 7 61 3.30.1660.10
3oqtP00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.8783 1 67 3.30.1660.10
ID Description Score Start End GO Terms
AF-A0A7K0JRP6-F1-model_v4 deleted 1.005 7 66
AF-A0A363TRW0-F1-model_v4 Dodecin domain-containing protein 0.9933 3 67
AF-A0A7W9DVU8-F1-model_v4 deleted 0.9931 12 67
AF-A0A537VDW4-F1-model_v4 Dodecin domain-containing protein 0.9889 3 67
AF-A0A0T6AJ01-F1-model_v4 Dodecin domain-containing protein 0.9881 2 67

Map