F444608

General Info

Members Datasets Scaffolds Average Seq Length
441 201 882 45

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_101222906|Ga0070684_1012229061
Length 55
Sequence LTLTARGKVVRVDNELAKRLVWSGLLAATGALASIAAARVAAVVFRRIYGEDPPE

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
154 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
155 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.36
Nodule 0
Rhizoplane 4.31
Rhizosphere 93.2
Stem 0
Stem Tuber 0
Unclassified 10.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_101222906 3300005535 Bacteria 707
2 CNAas_1015572 3300000532 Bacteria 536
3 JGI24743J22301_10076416 3300001991 Bacteria 703
4 JGI24735J21928_10040452 3300002067 Bacteria 1361
5 JGI24750J21931_1047414 3300002070 Bacteria 664
6 JGI24749J21850_1067157 3300002076 Bacteria 550
7 JGI25404J52841_10039252 3300003659 Bacteria 1003
8 Ga0070676_10382710 3300005328 Bacteria 975
9 Ga0070683_100062781 3300005329 Bacteria 3454
10 Ga0070683_100126006 3300005329 Bacteria 2421
11 Ga0070683_100204481 3300005329 Bacteria 1876
12 Ga0070683_100275570 3300005329 Unclassified 1600
13 Ga0070683_100749229 3300005329 Unclassified 936
14 Ga0070683_101004834 3300005329 Bacteria 801
15 Ga0070683_101570836 3300005329 Bacteria 632
16 Ga0070670_100086733 3300005331 Bacteria 2690
17 Ga0070670_101130931 3300005331 Bacteria 715
18 Ga0070670_101935374 3300005331 Bacteria 543
19 Ga0068869_101196365 3300005334 Bacteria 668
20 Ga0070666_10943103 3300005335 Bacteria 639
21 Ga0070680_100204813 3300005336 Bacteria 1664
22 Ga0070680_100868322 3300005336 Bacteria 778
23 Ga0070682_100021503 3300005337 Bacteria 3808
24 Ga0068868_100025281 3300005338 Bacteria 4515
25 Ga0068868_100489126 3300005338 Bacteria 1076
26 Ga0068868_101406099 3300005338 Bacteria 651
27 Ga0068868_101681122 3300005338 Unclassified 598
28 Ga0070660_100001352 3300005339 Bacteria 16674
29 Ga0070660_100259486 3300005339 Bacteria 1419
30 Ga0070660_100760878 3300005339 Bacteria 814
31 Ga0070660_101058676 3300005339 Bacteria 686
32 Ga0070689_100014918 3300005340 Bacteria 5655
33 Ga0070689_100049017 3300005340 Bacteria 3259
34 Ga0070691_10029912 3300005341 Bacteria 2550
35 Ga0070687_101089495 3300005343 Bacteria 584
36 Ga0070661_100000032 3300005344 Bacteria 112964
37 Ga0070661_100123201 3300005344 Bacteria 1943
38 Ga0070661_100787303 3300005344 Bacteria 780
39 Ga0070661_101610257 3300005344 Bacteria 549
40 Ga0070692_10000694 3300005345 Bacteria 10830
41 Ga0070692_10319838 3300005345 Bacteria 954
42 Ga0070668_100140728 3300005347 Unclassified 1944
43 Ga0070668_100143782 3300005347 Bacteria 1924
44 Ga0070668_101685558 3300005347 Bacteria 582
45 Ga0070674_100000660 3300005356 Bacteria 17428
46 Ga0070674_100004239 3300005356 Bacteria 8151
47 Ga0070674_101762013 3300005356 Unclassified 561
48 Ga0070673_100047123 3300005364 Bacteria 3352
49 Ga0070673_101337859 3300005364 Bacteria 673
50 Ga0070673_102166303 3300005364 Bacteria 528
51 Ga0070673_102327145 3300005364 Unclassified 509
52 Ga0070688_100000031 3300005365 Bacteria 65288
53 Ga0070688_100000194 3300005365 Bacteria 32209
54 Ga0070688_100041881 3300005365 Bacteria 2814
55 Ga0070688_100339245 3300005365 Bacteria 1097
56 Ga0070688_100667174 3300005365 Unclassified 802
57 Ga0070688_101128236 3300005365 Unclassified 628
58 Ga0070659_100005633 3300005366 Bacteria 9006
59 Ga0070659_100085841 3300005366 Bacteria 2518
60 Ga0070659_102051873 3300005366 Bacteria 514
61 Ga0070713_100001127 3300005436 Bacteria 17066
62 Ga0070713_102256826 3300005436 Bacteria 527
63 Ga0070710_11152677 3300005437 Bacteria 571
64 Ga0070701_10029521 3300005438 Bacteria 2706
65 Ga0070700_100004306 3300005441 Bacteria 7429
66 Ga0070700_101533246 3300005441 Bacteria 567
67 Ga0070694_101090340 3300005444 Bacteria 666
68 Ga0070663_100014103 3300005455 Bacteria 5122
69 Ga0070663_100016320 3300005455 Bacteria 4820
70 Ga0070663_100294188 3300005455 Bacteria 1298
71 Ga0070663_100610471 3300005455 Bacteria 918
72 Ga0070663_101218834 3300005455 Unclassified 662
73 Ga0070663_101921588 3300005455 Bacteria 532
74 Ga0070663_102108362 3300005455 Unclassified 508
75 Ga0070678_100017899 3300005456 Bacteria 4577
76 Ga0070678_100044454 3300005456 Bacteria 3172
77 Ga0070662_100033979 3300005457 Bacteria 3594
78 Ga0070681_10315836 3300005458 Bacteria 1472
79 Ga0070681_11856024 3300005458 Bacteria 530
80 Ga0068867_100030884 3300005459 Bacteria 3866
81 Ga0068867_101431243 3300005459 Bacteria 642
82 Ga0070685_10000058 3300005466 Bacteria 64666
83 Ga0070685_10001757 3300005466 Bacteria 11345
84 Ga0070685_10189291 3300005466 Bacteria 1330
85 Ga0070685_10190271 3300005466 Bacteria 1327
86 Ga0070685_10526942 3300005466 Unclassified 840
87 Ga0070685_11167887 3300005466 Bacteria 584
88 Ga0070679_100005071 3300005530 Bacteria 12162
89 Ga0070679_100067242 3300005530 Bacteria 3574
90 Ga0070684_100001306 3300005535 Bacteria 17854
91 Ga0070684_100008028 3300005535 Bacteria 8239
92 Ga0070684_100137888 3300005535 Bacteria 2204
93 Ga0070684_100344663 3300005535 Bacteria 1370
94 Ga0070684_100628878 3300005535 Bacteria 999
95 Ga0070684_100931187 3300005535 Bacteria 814
96 Ga0070684_101080682 3300005535 Bacteria 754
97 Ga0068853_100004945 3300005539 Bacteria 10382
98 Ga0068853_100180536 3300005539 Bacteria 1914
99 Ga0068853_100184959 3300005539 Bacteria 1891
100 Ga0068853_100459891 3300005539 Bacteria 1198
101 Ga0068853_101079502 3300005539 Bacteria 774
102 Ga0068853_101945659 3300005539 Bacteria 570
103 Ga0068853_102244387 3300005539 Bacteria 529
104 Ga0070672_100210971 3300005543 Bacteria 1626
105 Ga0070672_100746194 3300005543 Bacteria 859
106 Ga0070686_100223612 3300005544 Bacteria 1362
107 Ga0070686_100592222 3300005544 Bacteria 873
108 Ga0070695_100307450 3300005545 Bacteria 1174
109 Ga0070696_100387005 3300005546 Bacteria 1091
110 Ga0070693_100453600 3300005547 Bacteria 900
111 Ga0070693_100576113 3300005547 Unclassified 809
112 Ga0070665_100000022 3300005548 Bacteria 379286
113 Ga0070665_100056281 3300005548 Bacteria 3943
114 Ga0070665_100207108 3300005548 Bacteria 1962
115 Ga0070665_101742765 3300005548 Bacteria 630
116 Ga0070665_102083341 3300005548 Unclassified 572
117 Ga0070704_100464742 3300005549 Bacteria 1092
118 Ga0068855_100200864 3300005563 Bacteria 2244
119 Ga0068855_100557471 3300005563 Bacteria 1240
120 Ga0068855_101840696 3300005563 Bacteria 614
121 Ga0068855_102404314 3300005563 Bacteria 526
122 Ga0068855_102603979 3300005563 Bacteria 502
123 Ga0070664_100012176 3300005564 Bacteria 6991
124 Ga0070664_100292066 3300005564 Bacteria 1472
125 Ga0070664_100763618 3300005564 Bacteria 903
126 Ga0070664_100843933 3300005564 Bacteria 858
127 Ga0068857_100299414 3300005577 Bacteria 1482
128 Ga0068857_100323305 3300005577 Bacteria 1425
129 Ga0068857_101750518 3300005577 Bacteria 608
130 Ga0068854_100000101 3300005578 Bacteria 59973
131 Ga0068854_100115184 3300005578 Bacteria 2033
132 Ga0068854_100578406 3300005578 Bacteria 956
133 Ga0068854_100833818 3300005578 Bacteria 806
134 Ga0068854_101919055 3300005578 Bacteria 545
135 Ga0068856_100000461 3300005614 Bacteria 44805
136 Ga0068856_100034850 3300005614 Bacteria 4932
137 Ga0068856_100058024 3300005614 Bacteria 3823
138 Ga0068856_100606840 3300005614 Bacteria 1115
139 Ga0068856_101172419 3300005614 Bacteria 785
140 Ga0068856_101267357 3300005614 Bacteria 753
141 Ga0068856_101320393 3300005614 Unclassified 736
142 Ga0070702_100234994 3300005615 Bacteria 1234
143 Ga0070702_100729039 3300005615 Bacteria 759
144 Ga0070702_101155144 3300005615 Bacteria 622
145 Ga0068852_100000024 3300005616 Bacteria 120479
146 Ga0068852_100020781 3300005616 Bacteria 5224
147 Ga0068852_101130435 3300005616 Bacteria 804
148 Ga0068852_101515898 3300005616 Bacteria 693
149 Ga0068864_100126070 3300005618 Bacteria 2295
150 Ga0068864_102422194 3300005618 Bacteria 531
151 Ga0068864_102582303 3300005618 Bacteria 514
152 Ga0068866_10000007 3300005718 Bacteria 121729
153 Ga0068866_10328367 3300005718 Bacteria 965
154 Ga0068866_10747015 3300005718 Unclassified 675
155 Ga0068866_10781827 3300005718 Unclassified 662
156 Ga0068861_100082264 3300005719 Bacteria 2523
157 Ga0068861_100200391 3300005719 Bacteria 1675
158 Ga0068861_101274922 3300005719 Bacteria 713
159 Ga0068861_101441174 3300005719 Bacteria 674
160 Ga0068851_10000401 3300005834 Bacteria 19649
161 Ga0068851_10263642 3300005834 Bacteria 981
162 Ga0068863_100051824 3300005841 Bacteria 3889
163 Ga0068863_101332352 3300005841 Unclassified 725
164 Ga0068858_100000763 3300005842 Bacteria 33724
165 Ga0068858_100317314 3300005842 Bacteria 1489
166 Ga0068860_100005016 3300005843 Bacteria 13475
167 Ga0068860_100698519 3300005843 Bacteria 1024
168 Ga0068860_100928992 3300005843 Bacteria 887
169 Ga0068860_102222369 3300005843 Bacteria 569
170 Ga0068860_102742746 3300005843 Bacteria 511
171 Ga0068862_101215021 3300005844 Bacteria 753
172 Ga0068862_101276364 3300005844 Bacteria 735
173 Ga0068862_101780284 3300005844 Bacteria 625
174 Ga0081455_10015431 3300005937 Bacteria 7421
175 Ga0081455_10030926 3300005937 Bacteria 4854
176 Ga0081455_10046203 3300005937 Bacteria 3780
177 Ga0081455_10096321 3300005937 Bacteria 2386
178 Ga0081455_10316916 3300005937 Bacteria 1112
179 Ga0081540_1000545 3300005983 Bacteria 36477
180 Ga0081540_1075390 3300005983 Bacteria 1542
181 Ga0081540_1085083 3300005983 Bacteria 1409
182 Ga0081539_10001387 3300005985 Bacteria 41711
183 Ga0081539_10002845 3300005985 Bacteria 23058
184 Ga0081539_10181516 3300005985 Bacteria 987
185 Ga0081539_10301916 3300005985 Bacteria 688
186 Ga0075365_10470743 3300006038 Bacteria 888
187 Ga0075365_10576679 3300006038 Bacteria 796
188 Ga0075363_100005275 3300006048 Bacteria 5735
189 Ga0075363_100288171 3300006048 Bacteria 951
190 Ga0075364_10810153 3300006051 Bacteria 638
191 Ga0070715_10000003 3300006163 Bacteria 345282
192 Ga0070712_100719907 3300006175 Bacteria 852
193 Ga0075367_10440078 3300006178 Bacteria 826
194 Ga0097621_101835578 3300006237 Unclassified 578
195 Ga0075428_102628285 3300006844 Unclassified 514
196 Ga0075431_100201786 3300006847 Bacteria 2034
197 Ga0075431_100349364 3300006847 Bacteria 1487
198 Ga0075431_102191651 3300006847 Unclassified 507
199 Ga0075433_10852789 3300006852 Bacteria 795
200 Ga0075433_10937243 3300006852 Unclassified 755
201 Ga0068865_100000024 3300006881 Bacteria 94969
202 Ga0068865_100105636 3300006881 Bacteria 2069
203 Ga0068865_100421666 3300006881 Bacteria 1097
204 Ga0068865_100451858 3300006881 Bacteria 1062
205 Ga0105244_10586829 3300009036 Bacteria 511
206 Ga0111539_10033877 3300009094 Bacteria 6197
207 Ga0111539_10259433 3300009094 Bacteria 2023
208 Ga0111539_10459054 3300009094 Bacteria 1484
209 Ga0111539_11566826 3300009094 Bacteria 764
210 Ga0111539_11766849 3300009094 Bacteria 717
211 Ga0111539_11846042 3300009094 Bacteria 701
212 Ga0111539_12476221 3300009094 Bacteria 602
213 Ga0105245_10001160 3300009098 Bacteria 23842
214 Ga0105245_10009643 3300009098 Bacteria 8418
215 Ga0105245_10039808 3300009098 Bacteria 4184
216 Ga0105245_10063293 3300009098 Bacteria 3340
217 Ga0105245_10382584 3300009098 Bacteria 1402
218 Ga0105245_10505066 3300009098 Bacteria 1226
219 Ga0105247_10052473 3300009101 Bacteria 2514
220 Ga0105247_10230944 3300009101 Bacteria 1256
221 Ga0114129_10064882 3300009147 Bacteria 5097
222 Ga0105243_10030588 3300009148 Bacteria 4147
223 Ga0105243_10054378 3300009148 Bacteria 3178
224 Ga0105243_10164674 3300009148 Bacteria 1915
225 Ga0105243_10517183 3300009148 Bacteria 1134
226 Ga0105243_11794219 3300009148 Bacteria 644
227 Ga0105243_12301668 3300009148 Bacteria 576
228 Ga0105241_10066309 3300009174 Bacteria 2791
229 Ga0105242_10267469 3300009176 Bacteria 1547
230 Ga0105242_10793187 3300009176 Bacteria 937
231 Ga0105242_11117968 3300009176 Bacteria 803
232 Ga0105242_11415273 3300009176 Bacteria 723
233 Ga0105248_10000017 3300009177 Bacteria 298089
234 Ga0105248_10602925 3300009177 Bacteria 1239
235 Ga0105248_10787588 3300009177 Bacteria 1073
236 Ga0105237_10551482 3300009545 Bacteria 1159
237 Ga0105238_11203898 3300009551 Bacteria 782
238 Ga0105238_11629841 3300009551 Bacteria 675
239 Ga0105249_10010215 3300009553 Bacteria 8245
240 Ga0105249_10019317 3300009553 Bacteria 6078
241 Ga0105249_10029422 3300009553 Bacteria 4960
242 Ga0105249_10116732 3300009553 Bacteria 2530
243 Ga0105249_10853020 3300009553 Bacteria 976
244 Ga0105249_13324835 3300009553 Bacteria 517
245 Ga0105239_10032856 3300010375 Bacteria 5701
246 Ga0105239_10114779 3300010375 Bacteria 2987
247 Ga0105239_10362171 3300010375 Bacteria 1638
248 Ga0105239_11264161 3300010375 Bacteria 851
249 Ga0105239_11588255 3300010375 Unclassified 756
250 Ga0105246_10218241 3300011119 Bacteria 1493
251 Ga0105246_10457119 3300011119 Bacteria 1074
252 Ga0105246_10831950 3300011119 Bacteria 822
253 Ga0105246_12543625 3300011119 Bacteria 505
254 Ga0157338_1036512 3300012515 Bacteria 651
255 Ga0157371_10006597 3300013102 Bacteria 9537
256 Ga0157371_11441399 3300013102 Bacteria 536
257 Ga0157370_10003962 3300013104 Bacteria 17219
258 Ga0157370_10049845 3300013104 Bacteria 4005
259 Ga0157370_10622114 3300013104 Bacteria 988
260 Ga0157370_11410174 3300013104 Bacteria 627
261 Ga0157369_10000068 3300013105 Bacteria 144274
262 Ga0157374_11055506 3300013296 Bacteria 832
263 Ga0157378_10265870 3300013297 Bacteria 1647
264 Ga0157378_12661041 3300013297 Bacteria 553
265 Ga0157378_12684081 3300013297 Bacteria 551
266 Ga0163162_10128350 3300013306 Bacteria 2643
267 Ga0157372_10000239 3300013307 Bacteria 60707
268 Ga0157372_10185371 3300013307 Bacteria 2410
269 Ga0157372_10304262 3300013307 Bacteria 1855
270 Ga0157372_10310052 3300013307 Bacteria 1837
271 Ga0157372_11161889 3300013307 Bacteria 892
272 Ga0157372_11441451 3300013307 Bacteria 794
273 Ga0157372_11776589 3300013307 Bacteria 709
274 Ga0157372_12754449 3300013307 Bacteria 564
275 Ga0157372_13249806 3300013307 Bacteria 518
276 Ga0157375_10039340 3300013308 Bacteria 4552
277 Ga0157375_10265803 3300013308 Bacteria 1877
278 Ga0157375_10966830 3300013308 Bacteria 993
279 Ga0157375_12352532 3300013308 Unclassified 635
280 Ga0163163_10053467 3300014325 Bacteria 3986
281 Ga0163163_10781520 3300014325 Bacteria 1018
282 Ga0163163_12047666 3300014325 Bacteria 632
283 Ga0157380_10000039 3300014326 Bacteria 78322
284 Ga0157380_10340550 3300014326 Bacteria 1399
285 Ga0157380_10542945 3300014326 Bacteria 1139
286 Ga0157380_10577929 3300014326 Bacteria 1107
287 Ga0157380_11582591 3300014326 Unclassified 710
288 Ga0157380_12121337 3300014326 Bacteria 625
289 Ga0157377_10014066 3300014745 Bacteria 4066
290 Ga0157379_10149232 3300014968 Bacteria 2109
291 Ga0157379_10277687 3300014968 Bacteria 1524
292 Ga0157379_11515790 3300014968 Bacteria 653
293 Ga0157376_10009596 3300014969 Bacteria 7038
294 Ga0157376_10021677 3300014969 Bacteria 4993
295 Ga0157376_12093215 3300014969 Bacteria 604
296 Ga0157376_12151130 3300014969 Bacteria 596
297 Ga0157376_12199111 3300014969 Bacteria 590
298 Ga0182007_10244441 3300015262 Bacteria 642
299 Ga0206354_10794387 3300020081 Bacteria 810
300 Ga0206353_11605280 3300020082 Bacteria 687
301 Ga0224712_10560336 3300022467 Bacteria 556
302 Ga0207692_10484247 3300025898 Bacteria 783
303 Ga0207680_11161574 3300025903 Unclassified 551
304 Ga0207643_10300991 3300025908 Bacteria 998
305 Ga0207643_10830838 3300025908 Unclassified 599
306 Ga0207705_10438340 3300025909 Bacteria 1012
307 Ga0207705_11077740 3300025909 Bacteria 619
308 Ga0207662_10356414 3300025918 Bacteria 983
309 Ga0207657_10075594 3300025919 Bacteria 2842
310 Ga0207649_10202904 3300025920 Bacteria 1402
311 Ga0207652_10074004 3300025921 Bacteria 2965
312 Ga0207694_11571830 3300025924 Bacteria 554
313 Ga0207694_11773946 3300025924 Unclassified 519
314 Ga0207687_10321282 3300025927 Bacteria 1253
315 Ga0207690_10337582 3300025932 Bacteria 1188
316 Ga0207690_11096815 3300025932 Bacteria 663
317 Ga0207706_10552251 3300025933 Bacteria 991
318 Ga0207686_11801662 3300025934 Bacteria 507
319 Ga0207709_10102482 3300025935 Bacteria 1895
320 Ga0207709_11085658 3300025935 Bacteria 657
321 Ga0207669_10892296 3300025937 Bacteria 742
322 Ga0207704_10345627 3300025938 Bacteria 1156
323 Ga0207691_10142394 3300025940 Bacteria 2112
324 Ga0207689_11545340 3300025942 Unclassified 553
325 Ga0207661_10215155 3300025944 Bacteria 1696
326 Ga0207661_10400721 3300025944 Bacteria 1244
327 Ga0207661_11761868 3300025944 Bacteria 565
328 Ga0207679_10015456 3300025945 Bacteria 5045
329 Ga0207679_10383476 3300025945 Bacteria 1233
330 Ga0207679_11417945 3300025945 Unclassified 637
331 Ga0207712_11029945 3300025961 Bacteria 731
332 Ga0207640_10611092 3300025981 Bacteria 924
333 Ga0207640_11008111 3300025981 Bacteria 733
334 Ga0207640_11192559 3300025981 Bacteria 677
335 Ga0207677_11257294 3300026023 Bacteria 679
336 Ga0207677_11961502 3300026023 Bacteria 544
337 Ga0207678_10105821 3300026067 Bacteria 2400
338 Ga0207678_10297396 3300026067 Bacteria 1387
339 Ga0207678_10431712 3300026067 Bacteria 1143
340 Ga0207678_11795052 3300026067 Bacteria 537
341 Ga0207708_10140527 3300026075 Bacteria 1894
342 Ga0207708_10702096 3300026075 Bacteria 865
343 Ga0207702_11121721 3300026078 Unclassified 780
344 Ga0207641_11103930 3300026088 Unclassified 792
345 Ga0207648_10862002 3300026089 Bacteria 845
346 Ga0207648_10942876 3300026089 Bacteria 807
347 Ga0207676_11178359 3300026095 Bacteria 759
348 Ga0207676_12204292 3300026095 Unclassified 549
349 Ga0207674_10728797 3300026116 Unclassified 957
350 Ga0207674_11086578 3300026116 Bacteria 769
351 Ga0207675_100548951 3300026118 Bacteria 1154
352 Ga0207683_12168930 3300026121 Bacteria 504
353 Ga0207698_10469054 3300026142 Bacteria 1219
354 Ga0207698_11993888 3300026142 Unclassified 595
355 Ga0207428_10216860 3300027907 Bacteria 1436
356 Ga0268266_11352443 3300028379 Bacteria 688
357 Ga0268265_12486519 3300028380 Unclassified 524
358 Ga0307413_11647817 3300031824 Unclassified 571
359 Ga0307410_11712201 3300031852 Bacteria 557
360 Ga0307407_10636381 3300031903 Unclassified 798
361 Ga0307407_10708381 3300031903 Bacteria 759
362 Ga0307412_12211882 3300031911 Bacteria 512
363 Ga0307409_102096975 3300031995 Bacteria 595
364 Ga0307409_102274431 3300031995 Bacteria 571
365 Ga0307416_100275931 3300032002 Bacteria 1654
366 Ga0395900_1661889 3300037418 Bacteria 550
367 Ga0395905_1844434 3300037471 Bacteria 511
368 Ga0395901_1333170 3300038443 Bacteria 678
369 Ga0451791_0172553 3300041451 Bacteria 564
370 Ga0451797_0262936 3300041453 Bacteria 1068
371 Ga0451833_1369450 3300041491 Bacteria 529
372 Ga0451853_3392121 3300041512 Bacteria 519
373 Ga0466963_0023557 3300044694 Bacteria 3911
374 Ga0466963_0059297 3300044694 Bacteria 2554
375 Ga0466963_0085802 3300044694 Bacteria 2138
376 Ga0466963_0380764 3300044694 Bacteria 994
377 Ga0466964_0757588 3300044706 Bacteria 545
378 Ga0466971_0060459 3300044719 Bacteria 1712
379 Ga0466970_0660657 3300044765 Bacteria 608
380 Ga0466957_0599172 3300044842 Unclassified 771
381 Ga0466960_0219008 3300044901 Bacteria 1047
382 Ga0466960_0653941 3300044901 Bacteria 628
383 Ga0466960_0980956 3300044901 Bacteria 518
384 Ga0466958_0160401 3300045836 Bacteria 1420
385 Ga0466958_1091077 3300045836 Unclassified 521
386 Ga0466967_0021660 3300045976 Bacteria 5227
387 Ga0466967_0065442 3300045976 Bacteria 3235
388 Ga0466967_0169528 3300045976 Bacteria 2053
389 Ga0466967_0266087 3300045976 Bacteria 1641
390 Ga0466967_0337637 3300045976 Bacteria 1456
391 Ga0466967_0377008 3300045976 Bacteria 1377
392 Ga0466967_0403615 3300045976 Bacteria 1330
393 Ga0466967_0785645 3300045976 Bacteria 945
394 Ga0466967_1677281 3300045976 Bacteria 633
395 Ga0495611_0354818 3300046648 Unclassified 673
396 Ga0495672_0085030 3300047320 Bacteria 1754
397 Ga0495675_0217997 3300047444 Bacteria 1156
398 Ga0496102_0473249 3300048905 Bacteria 1174
399 Ga0496103_0978437 3300048906 Unclassified 528
400 Ga0496104_1557008 3300048907 Unclassified 564
401 Ga0496108_0776066 3300048911 Bacteria 828
402 Ga0496109_0240246 3300048912 Bacteria 1705
403 Ga0496109_0358282 3300048912 Bacteria 1378
404 Ga0496109_2028690 3300048912 Unclassified 507
405 Ga0496110_0320326 3300048913 Bacteria 1412
406 Ga0496111_0373916 3300048914 Bacteria 1054
407 Ga0496111_0703765 3300048914 Bacteria 735
408 Ga0496112_0265900 3300048915 Bacteria 1664
409 Ga0496112_0411909 3300048915 Bacteria 1291
410 Ga0496113_0490056 3300048916 Bacteria 987
411 Ga0496113_0571954 3300048916 Bacteria 906
412 Ga0496113_1226569 3300048916 Bacteria 585
413 Ga0496114_1244433 3300048917 Unclassified 631
414 Ga0496115_1094273 3300048918 Bacteria 604
415 Ga0496119_0139523 3300048922 Bacteria 1311
416 Ga0496121_0104032 3300048924 Bacteria 2183
417 Ga0496126_0600356 3300048929 Bacteria 867
418 Ga0501031_0921156 3300049568 Bacteria 559
419 Ga0501034_0423401 3300049571 Bacteria 1252
420 Ga0501034_0831790 3300049571 Bacteria 814
421 Ga0501037_1056556 3300049573 Bacteria 527
422 Ga0501042_0418687 3300049578 Bacteria 971
423 Ga0501043_0276382 3300049579 Unclassified 1288
424 Ga0501047_0649628 3300049581 Unclassified 874
425 Ga0501067_0358633 3300049583 Bacteria 813
426 Ga0501068_0066679 3300049584 Bacteria 2193
427 Ga0501069_0191451 3300049585 Bacteria 1183
428 Ga0501070_0160628 3300049586 Bacteria 1852
429 Ga0501070_0499273 3300049586 Bacteria 978
430 Ga0501071_0172216 3300049587 Bacteria 1620
431 Ga0501072_1247278 3300049588 Unclassified 577
432 Ga0501074_0010437 3300049590 Bacteria 6740
433 Ga0501074_0035304 3300049590 Bacteria 3622
434 Ga0501079_0020627 3300049741 Bacteria 5038
435 Ga0501080_0070020 3300049742 Bacteria 3262
436 Ga0501083_0436079 3300049744 Bacteria 852
437 Ga0501044_0648980 3300049823 Bacteria 944
438 nmdc:mga08y16_1696156_c1 3300050511 Bacteria 587
439 nmdc:mga08y16_675504_c1 3300050511 Bacteria 1035
440 Ga0495655_0202572 3300053083 Unclassified 649
441 Ga0466962_0028806 3300061719 Bacteria 2660
442 Ga0070684_101222906
443 CNAas_1015572
444 JGI24743J22301_10076416
445 JGI24735J21928_10040452
446 JGI24750J21931_1047414
447 JGI24749J21850_1067157
448 JGI25404J52841_10039252
449 Ga0070676_10382710
450 Ga0070683_100062781
451 Ga0070683_100126006
452 Ga0070683_100204481
453 Ga0070683_100275570
454 Ga0070683_100749229
455 Ga0070683_101004834
456 Ga0070683_101570836
457 Ga0070670_100086733
458 Ga0070670_101130931
459 Ga0070670_101935374
460 Ga0068869_101196365
461 Ga0070666_10943103
462 Ga0070680_100204813
463 Ga0070680_100868322
464 Ga0070682_100021503
465 Ga0068868_100025281
466 Ga0068868_100489126
467 Ga0068868_101406099
468 Ga0068868_101681122
469 Ga0070660_100001352
470 Ga0070660_100259486
471 Ga0070660_100760878
472 Ga0070660_101058676
473 Ga0070689_100014918
474 Ga0070689_100049017
475 Ga0070691_10029912
476 Ga0070687_101089495
477 Ga0070661_100000032
478 Ga0070661_100123201
479 Ga0070661_100787303
480 Ga0070661_101610257
481 Ga0070692_10000694
482 Ga0070692_10319838
483 Ga0070668_100140728
484 Ga0070668_100143782
485 Ga0070668_101685558
486 Ga0070674_100000660
487 Ga0070674_100004239
488 Ga0070674_101762013
489 Ga0070673_100047123
490 Ga0070673_101337859
491 Ga0070673_102166303
492 Ga0070673_102327145
493 Ga0070688_100000031
494 Ga0070688_100000194
495 Ga0070688_100041881
496 Ga0070688_100339245
497 Ga0070688_100667174
498 Ga0070688_101128236
499 Ga0070659_100005633
500 Ga0070659_100085841
501 Ga0070659_102051873
502 Ga0070713_100001127
503 Ga0070713_102256826
504 Ga0070710_11152677
505 Ga0070701_10029521
506 Ga0070700_100004306
507 Ga0070700_101533246
508 Ga0070694_101090340
509 Ga0070663_100014103
510 Ga0070663_100016320
511 Ga0070663_100294188
512 Ga0070663_100610471
513 Ga0070663_101218834
514 Ga0070663_101921588
515 Ga0070663_102108362
516 Ga0070678_100017899
517 Ga0070678_100044454
518 Ga0070662_100033979
519 Ga0070681_10315836
520 Ga0070681_11856024
521 Ga0068867_100030884
522 Ga0068867_101431243
523 Ga0070685_10000058
524 Ga0070685_10001757
525 Ga0070685_10189291
526 Ga0070685_10190271
527 Ga0070685_10526942
528 Ga0070685_11167887
529 Ga0070679_100005071
530 Ga0070679_100067242
531 Ga0070684_100001306
532 Ga0070684_100008028
533 Ga0070684_100137888
534 Ga0070684_100344663
535 Ga0070684_100628878
536 Ga0070684_100931187
537 Ga0070684_101080682
538 Ga0068853_100004945
539 Ga0068853_100180536
540 Ga0068853_100184959
541 Ga0068853_100459891
542 Ga0068853_101079502
543 Ga0068853_101945659
544 Ga0068853_102244387
545 Ga0070672_100210971
546 Ga0070672_100746194
547 Ga0070686_100223612
548 Ga0070686_100592222
549 Ga0070695_100307450
550 Ga0070696_100387005
551 Ga0070693_100453600
552 Ga0070693_100576113
553 Ga0070665_100000022
554 Ga0070665_100056281
555 Ga0070665_100207108
556 Ga0070665_101742765
557 Ga0070665_102083341
558 Ga0070704_100464742
559 Ga0068855_100200864
560 Ga0068855_100557471
561 Ga0068855_101840696
562 Ga0068855_102404314
563 Ga0068855_102603979
564 Ga0070664_100012176
565 Ga0070664_100292066
566 Ga0070664_100763618
567 Ga0070664_100843933
568 Ga0068857_100299414
569 Ga0068857_100323305
570 Ga0068857_101750518
571 Ga0068854_100000101
572 Ga0068854_100115184
573 Ga0068854_100578406
574 Ga0068854_100833818
575 Ga0068854_101919055
576 Ga0068856_100000461
577 Ga0068856_100034850
578 Ga0068856_100058024
579 Ga0068856_100606840
580 Ga0068856_101172419
581 Ga0068856_101267357
582 Ga0068856_101320393
583 Ga0070702_100234994
584 Ga0070702_100729039
585 Ga0070702_101155144
586 Ga0068852_100000024
587 Ga0068852_100020781
588 Ga0068852_101130435
589 Ga0068852_101515898
590 Ga0068864_100126070
591 Ga0068864_102422194
592 Ga0068864_102582303
593 Ga0068866_10000007
594 Ga0068866_10328367
595 Ga0068866_10747015
596 Ga0068866_10781827
597 Ga0068861_100082264
598 Ga0068861_100200391
599 Ga0068861_101274922
600 Ga0068861_101441174
601 Ga0068851_10000401
602 Ga0068851_10263642
603 Ga0068863_100051824
604 Ga0068863_101332352
605 Ga0068858_100000763
606 Ga0068858_100317314
607 Ga0068860_100005016
608 Ga0068860_100698519
609 Ga0068860_100928992
610 Ga0068860_102222369
611 Ga0068860_102742746
612 Ga0068862_101215021
613 Ga0068862_101276364
614 Ga0068862_101780284
615 Ga0081455_10015431
616 Ga0081455_10030926
617 Ga0081455_10046203
618 Ga0081455_10096321
619 Ga0081455_10316916
620 Ga0081540_1000545
621 Ga0081540_1075390
622 Ga0081540_1085083
623 Ga0081539_10001387
624 Ga0081539_10002845
625 Ga0081539_10181516
626 Ga0081539_10301916
627 Ga0075365_10470743
628 Ga0075365_10576679
629 Ga0075363_100005275
630 Ga0075363_100288171
631 Ga0075364_10810153
632 Ga0070715_10000003
633 Ga0070712_100719907
634 Ga0075367_10440078
635 Ga0097621_101835578
636 Ga0075428_102628285
637 Ga0075431_100201786
638 Ga0075431_100349364
639 Ga0075431_102191651
640 Ga0075433_10852789
641 Ga0075433_10937243
642 Ga0068865_100000024
643 Ga0068865_100105636
644 Ga0068865_100421666
645 Ga0068865_100451858
646 Ga0105244_10586829
647 Ga0111539_10033877
648 Ga0111539_10259433
649 Ga0111539_10459054
650 Ga0111539_11566826
651 Ga0111539_11766849
652 Ga0111539_11846042
653 Ga0111539_12476221
654 Ga0105245_10001160
655 Ga0105245_10009643
656 Ga0105245_10039808
657 Ga0105245_10063293
658 Ga0105245_10382584
659 Ga0105245_10505066
660 Ga0105247_10052473
661 Ga0105247_10230944
662 Ga0114129_10064882
663 Ga0105243_10030588
664 Ga0105243_10054378
665 Ga0105243_10164674
666 Ga0105243_10517183
667 Ga0105243_11794219
668 Ga0105243_12301668
669 Ga0105241_10066309
670 Ga0105242_10267469
671 Ga0105242_10793187
672 Ga0105242_11117968
673 Ga0105242_11415273
674 Ga0105248_10000017
675 Ga0105248_10602925
676 Ga0105248_10787588
677 Ga0105237_10551482
678 Ga0105238_11203898
679 Ga0105238_11629841
680 Ga0105249_10010215
681 Ga0105249_10019317
682 Ga0105249_10029422
683 Ga0105249_10116732
684 Ga0105249_10853020
685 Ga0105249_13324835
686 Ga0105239_10032856
687 Ga0105239_10114779
688 Ga0105239_10362171
689 Ga0105239_11264161
690 Ga0105239_11588255
691 Ga0105246_10218241
692 Ga0105246_10457119
693 Ga0105246_10831950
694 Ga0105246_12543625
695 Ga0157338_1036512
696 Ga0157371_10006597
697 Ga0157371_11441399
698 Ga0157370_10003962
699 Ga0157370_10049845
700 Ga0157370_10622114
701 Ga0157370_11410174
702 Ga0157369_10000068
703 Ga0157374_11055506
704 Ga0157378_10265870
705 Ga0157378_12661041
706 Ga0157378_12684081
707 Ga0163162_10128350
708 Ga0157372_10000239
709 Ga0157372_10185371
710 Ga0157372_10304262
711 Ga0157372_10310052
712 Ga0157372_11161889
713 Ga0157372_11441451
714 Ga0157372_11776589
715 Ga0157372_12754449
716 Ga0157372_13249806
717 Ga0157375_10039340
718 Ga0157375_10265803
719 Ga0157375_10966830
720 Ga0157375_12352532
721 Ga0163163_10053467
722 Ga0163163_10781520
723 Ga0163163_12047666
724 Ga0157380_10000039
725 Ga0157380_10340550
726 Ga0157380_10542945
727 Ga0157380_10577929
728 Ga0157380_11582591
729 Ga0157380_12121337
730 Ga0157377_10014066
731 Ga0157379_10149232
732 Ga0157379_10277687
733 Ga0157379_11515790
734 Ga0157376_10009596
735 Ga0157376_10021677
736 Ga0157376_12093215
737 Ga0157376_12151130
738 Ga0157376_12199111
739 Ga0182007_10244441
740 Ga0206354_10794387
741 Ga0206353_11605280
742 Ga0224712_10560336
743 Ga0207692_10484247
744 Ga0207680_11161574
745 Ga0207643_10300991
746 Ga0207643_10830838
747 Ga0207705_10438340
748 Ga0207705_11077740
749 Ga0207662_10356414
750 Ga0207657_10075594
751 Ga0207649_10202904
752 Ga0207652_10074004
753 Ga0207694_11571830
754 Ga0207694_11773946
755 Ga0207687_10321282
756 Ga0207690_10337582
757 Ga0207690_11096815
758 Ga0207706_10552251
759 Ga0207686_11801662
760 Ga0207709_10102482
761 Ga0207709_11085658
762 Ga0207669_10892296
763 Ga0207704_10345627
764 Ga0207691_10142394
765 Ga0207689_11545340
766 Ga0207661_10215155
767 Ga0207661_10400721
768 Ga0207661_11761868
769 Ga0207679_10015456
770 Ga0207679_10383476
771 Ga0207679_11417945
772 Ga0207712_11029945
773 Ga0207640_10611092
774 Ga0207640_11008111
775 Ga0207640_11192559
776 Ga0207677_11257294
777 Ga0207677_11961502
778 Ga0207678_10105821
779 Ga0207678_10297396
780 Ga0207678_10431712
781 Ga0207678_11795052
782 Ga0207708_10140527
783 Ga0207708_10702096
784 Ga0207702_11121721
785 Ga0207641_11103930
786 Ga0207648_10862002
787 Ga0207648_10942876
788 Ga0207676_11178359
789 Ga0207676_12204292
790 Ga0207674_10728797
791 Ga0207674_11086578
792 Ga0207675_100548951
793 Ga0207683_12168930
794 Ga0207698_10469054
795 Ga0207698_11993888
796 Ga0207428_10216860
797 Ga0268266_11352443
798 Ga0268265_12486519
799 Ga0307413_11647817
800 Ga0307410_11712201
801 Ga0307407_10636381
802 Ga0307407_10708381
803 Ga0307412_12211882
804 Ga0307409_102096975
805 Ga0307409_102274431
806 Ga0307416_100275931
807 Ga0395900_1661889
808 Ga0395905_1844434
809 Ga0395901_1333170
810 Ga0451791_0172553
811 Ga0451797_0262936
812 Ga0451833_1369450
813 Ga0451853_3392121
814 Ga0466963_0023557
815 Ga0466963_0059297
816 Ga0466963_0085802
817 Ga0466963_0380764
818 Ga0466964_0757588
819 Ga0466971_0060459
820 Ga0466970_0660657
821 Ga0466957_0599172
822 Ga0466960_0219008
823 Ga0466960_0653941
824 Ga0466960_0980956
825 Ga0466958_0160401
826 Ga0466958_1091077
827 Ga0466967_0021660
828 Ga0466967_0065442
829 Ga0466967_0169528
830 Ga0466967_0266087
831 Ga0466967_0337637
832 Ga0466967_0377008
833 Ga0466967_0403615
834 Ga0466967_0785645
835 Ga0466967_1677281
836 Ga0495611_0354818
837 Ga0495672_0085030
838 Ga0495675_0217997
839 Ga0496102_0473249
840 Ga0496103_0978437
841 Ga0496104_1557008
842 Ga0496108_0776066
843 Ga0496109_0240246
844 Ga0496109_0358282
845 Ga0496109_2028690
846 Ga0496110_0320326
847 Ga0496111_0373916
848 Ga0496111_0703765
849 Ga0496112_0265900
850 Ga0496112_0411909
851 Ga0496113_0490056
852 Ga0496113_0571954
853 Ga0496113_1226569
854 Ga0496114_1244433
855 Ga0496115_1094273
856 Ga0496119_0139523
857 Ga0496121_0104032
858 Ga0496126_0600356
859 Ga0501031_0921156
860 Ga0501034_0423401
861 Ga0501034_0831790
862 Ga0501037_1056556
863 Ga0501042_0418687
864 Ga0501043_0276382
865 Ga0501047_0649628
866 Ga0501067_0358633
867 Ga0501068_0066679
868 Ga0501069_0191451
869 Ga0501070_0160628
870 Ga0501070_0499273
871 Ga0501071_0172216
872 Ga0501072_1247278
873 Ga0501074_0010437
874 Ga0501074_0035304
875 Ga0501079_0020627
876 Ga0501080_0070020
877 Ga0501083_0436079
878 Ga0501044_0648980
879 nmdc:mga08y16_1696156_c1
880 nmdc:mga08y16_675504_c1
881 Ga0495655_0202572
882 Ga0466962_0028806

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8t0m-assembly1.cif.gz_S proteasome 20s core particle from pre1-1 pre4-1 double mutant 0.9394 20 43
8bzl-assembly1.cif.gz_U human 20s proteasome in complex with peptide activator peptide blm42 0.9285 21 43
5le5-assembly1.cif.gz_U native human 20s proteasome at 1.8 angstrom 0.9279 21 43
8bzl-assembly1.cif.gz_G human 20s proteasome in complex with peptide activator peptide blm42 0.9279 21 43
5ley-assembly1.cif.gz_U human 20s proteasome complex with oprozomib at 1.9 angstrom 0.9262 21 43
ID Description Score Start End Superfamily
5a0qU00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9125 20 43 3.60.20.10
af_Q6GQM3_1_252_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9056 21 43 3.60.20.10
af_A0A1D6HE74_1_153_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.904 24 43 3.60.20.10
6qm7O00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8923 21 43 3.60.20.10
5fmgU00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8816 20 43 3.60.20.10
ID Description Score Start End GO Terms
AF-A0A7V9GYT9-F1-model_v4 DUF4235 domain-containing protein 0.901 2 44
AF-A0A7V9GYT9-F1-model_v4 DUF4235 domain-containing protein 0.8642 2 44
AF-A0A484R0N1-F1-model_v4 Phage protein 0.6054 1 44
AF-A0A484R0N1-F1-model_v4 Phage protein 0.5964 1 44

Map