F444601

General Info

Members Datasets Scaffolds Average Seq Length
441 187 882 99

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_100596706|Ga0070700_1005967061
Length 105
Sequence VFNSWYGIINVANLYFSIKLKTMTLIGFLVLLAIAAICGAIGQSLAGYDLGGCLVSIAGKMGLPEFFTINIQGKPFPIIWSVIGSALFTLIVALIRRAFLGGKRY

Samples

Sample ID Description Type Environment
1 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
146 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
147 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
148 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
149 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
152 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
155 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
164 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
165 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
166 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
167 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
168 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
169 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
170 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
171 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
172 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
173 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
174 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
175 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
176 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
186 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
187 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.13
Nodule 0
Rhizoplane 0.45
Rhizosphere 98.19
Stem 0
Stem Tuber 0
Unclassified 15.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070700_100596706 3300005441 Bacteria 865
2 JGI24751J29686_10016050 3300002459 Bacteria 1545
3 Ga0065714_10093375 3300005288 Bacteria 1849
4 Ga0065712_10002383 3300005290 Bacteria 4734
5 Ga0065712_10010497 3300005290 Unclassified 1934
6 Ga0065712_10014311 3300005290 Bacteria 1918
7 Ga0065712_10017165 3300005290 Bacteria 2570
8 Ga0065712_10100425 3300005290 Bacteria 2062
9 Ga0065715_10005061 3300005293 Bacteria 8559
10 Ga0065707_10116066 3300005295 Bacteria 2249
11 Ga0065707_10887505 3300005295 Bacteria 570
12 Ga0070658_11162231 3300005327 Bacteria 671
13 Ga0070676_10367847 3300005328 Bacteria 992
14 Ga0070676_10861944 3300005328 Bacteria 672
15 Ga0070683_100296698 3300005329 Bacteria 1537
16 Ga0070683_100695017 3300005329 Bacteria 974
17 Ga0070690_100148899 3300005330 Bacteria 1595
18 Ga0070690_101765981 3300005330 Bacteria 504
19 Ga0070670_100004799 3300005331 Bacteria 11351
20 Ga0070670_100073961 3300005331 Bacteria 2927
21 Ga0070670_100152705 3300005331 Unclassified 1999
22 Ga0070670_101389430 3300005331 Bacteria 644
23 Ga0070670_101855091 3300005331 Bacteria 555
24 Ga0070677_10128758 3300005333 Bacteria 1153
25 Ga0070677_10513949 3300005333 Bacteria 651
26 Ga0068869_100003968 3300005334 Bacteria 9142
27 Ga0068869_100133027 3300005334 Bacteria 1914
28 Ga0068869_101680321 3300005334 Bacteria 566
29 Ga0070666_10106091 3300005335 Bacteria 1941
30 Ga0070666_10857546 3300005335 Bacteria 670
31 Ga0068868_100064288 3300005338 Bacteria 2912
32 Ga0068868_100141633 3300005338 Bacteria 1974
33 Ga0070660_100460716 3300005339 Bacteria 1055
34 Ga0070689_100523424 3300005340 Bacteria 1019
35 Ga0070689_100753938 3300005340 Bacteria 853
36 Ga0070689_101105707 3300005340 Bacteria 708
37 Ga0070687_100026348 3300005343 Bacteria 2799
38 Ga0070687_100682935 3300005343 Unclassified 715
39 Ga0070687_100882027 3300005343 Unclassified 640
40 Ga0070661_100152421 3300005344 Bacteria 1748
41 Ga0070669_100123366 3300005353 Bacteria 1979
42 Ga0070669_101452231 3300005353 Unclassified 596
43 Ga0070675_100010657 3300005354 Bacteria 7187
44 Ga0070675_100045702 3300005354 Bacteria 3584
45 Ga0070675_100078826 3300005354 Bacteria 2744
46 Ga0070675_100808483 3300005354 Bacteria 857
47 Ga0070675_101438284 3300005354 Unclassified 636
48 Ga0070675_101888896 3300005354 Unclassified 551
49 Ga0070671_100439477 3300005355 Bacteria 1118
50 Ga0070671_100709994 3300005355 Bacteria 873
51 Ga0070671_100799731 3300005355 Bacteria 821
52 Ga0070674_100508746 3300005356 Bacteria 1004
53 Ga0070674_100593028 3300005356 Bacteria 935
54 Ga0070673_100012919 3300005364 Bacteria 5752
55 Ga0070673_100104786 3300005364 Bacteria 2336
56 Ga0070673_100415144 3300005364 Bacteria 1206
57 Ga0070673_100920169 3300005364 Bacteria 812
58 Ga0070673_101596627 3300005364 Bacteria 616
59 Ga0070688_100016242 3300005365 Bacteria 4252
60 Ga0070688_100035701 3300005365 Unclassified 3021
61 Ga0070688_100746239 3300005365 Bacteria 761
62 Ga0070688_100976983 3300005365 Unclassified 671
63 Ga0070688_101724362 3300005365 Bacteria 513
64 Ga0070667_100072577 3300005367 Bacteria 2933
65 Ga0070667_100076803 3300005367 Bacteria 2852
66 Ga0070667_102021013 3300005367 Unclassified 543
67 Ga0070667_102205914 3300005367 Bacteria 519
68 Ga0070701_10154054 3300005438 Bacteria 1326
69 Ga0070663_100548451 3300005455 Bacteria 966
70 Ga0070663_100758902 3300005455 Bacteria 829
71 Ga0070678_100018792 3300005456 Bacteria 4487
72 Ga0070678_100953124 3300005456 Bacteria 787
73 Ga0070678_101057022 3300005456 Bacteria 748
74 Ga0070662_100327833 3300005457 Unclassified 1250
75 Ga0070662_100661198 3300005457 Bacteria 882
76 Ga0070681_10118321 3300005458 Bacteria 2586
77 Ga0070681_10457754 3300005458 Unclassified 1188
78 Ga0068867_100057936 3300005459 Bacteria 2870
79 Ga0068867_100401413 3300005459 Bacteria 1156
80 Ga0068867_101579752 3300005459 Unclassified 613
81 Ga0068867_102039030 3300005459 Unclassified 543
82 Ga0070685_10008065 3300005466 Bacteria 5398
83 Ga0070685_10068370 3300005466 Bacteria 2098
84 Ga0070685_10251602 3300005466 Bacteria 1171
85 Ga0070698_100004771 3300005471 Bacteria 14879
86 Ga0070698_100018756 3300005471 Bacteria 7282
87 Ga0070698_101181073 3300005471 Bacteria 714
88 Ga0070679_100252316 3300005530 Bacteria 1720
89 Ga0070684_100353362 3300005535 Bacteria 1352
90 Ga0070684_101648982 3300005535 Bacteria 605
91 Ga0068853_100221463 3300005539 Bacteria 1728
92 Ga0068853_100734958 3300005539 Bacteria 943
93 Ga0068853_101196116 3300005539 Bacteria 734
94 Ga0068853_102148710 3300005539 Bacteria 541
95 Ga0068853_102407697 3300005539 Bacteria 510
96 Ga0070672_100382742 3300005543 Bacteria 1203
97 Ga0070672_100680538 3300005543 Bacteria 900
98 Ga0070672_100885855 3300005543 Unclassified 788
99 Ga0070672_101783429 3300005543 Bacteria 553
100 Ga0070686_100179572 3300005544 Bacteria 1503
101 Ga0070686_100654616 3300005544 Bacteria 833
102 Ga0070696_101758584 3300005546 Bacteria 535
103 Ga0070665_100182430 3300005548 Bacteria 2100
104 Ga0070704_101438244 3300005549 Unclassified 633
105 Ga0068855_100000795 3300005563 Bacteria 39086
106 Ga0068855_100642024 3300005563 Bacteria 1141
107 Ga0068855_101877112 3300005563 Bacteria 607
108 Ga0070664_100023622 3300005564 Bacteria 5079
109 Ga0070664_100172900 3300005564 Bacteria 1917
110 Ga0070664_100315413 3300005564 Bacteria 1416
111 Ga0068857_100153220 3300005577 Bacteria 2089
112 Ga0068857_100467305 3300005577 Bacteria 1181
113 Ga0068854_100235055 3300005578 Bacteria 1457
114 Ga0068856_102464293 3300005614 Bacteria 527
115 Ga0070702_100191178 3300005615 Bacteria 1347
116 Ga0070702_100235431 3300005615 Bacteria 1233
117 Ga0068852_100000988 3300005616 Bacteria 18746
118 Ga0068852_100059447 3300005616 Bacteria 3315
119 Ga0068852_101357380 3300005616 Bacteria 733
120 Ga0068852_101965724 3300005616 Bacteria 607
121 Ga0068859_100015329 3300005617 Bacteria 7698
122 Ga0068859_100071004 3300005617 Bacteria 3517
123 Ga0068859_100596120 3300005617 Bacteria 1198
124 Ga0068859_100769056 3300005617 Bacteria 1051
125 Ga0068859_101047452 3300005617 Bacteria 897
126 Ga0068859_101566027 3300005617 Unclassified 728
127 Ga0068859_101766223 3300005617 Bacteria 683
128 Ga0068859_102135658 3300005617 Bacteria 618
129 Ga0068864_100108516 3300005618 Bacteria 2470
130 Ga0068864_100226740 3300005618 Bacteria 1726
131 Ga0068864_100256741 3300005618 Bacteria 1624
132 Ga0068864_100339245 3300005618 Bacteria 1416
133 Ga0068864_100770214 3300005618 Bacteria 944
134 Ga0068864_100928426 3300005618 Bacteria 860
135 Ga0068864_100973060 3300005618 Bacteria 841
136 Ga0068864_101866072 3300005618 Bacteria 606
137 Ga0068866_10807256 3300005718 Bacteria 653
138 Ga0068866_11110686 3300005718 Bacteria 567
139 Ga0068861_100002876 3300005719 Bacteria 11343
140 Ga0068861_100236441 3300005719 Bacteria 1552
141 Ga0068861_101245039 3300005719 Bacteria 721
142 Ga0068861_101284639 3300005719 Bacteria 711
143 Ga0068861_101499420 3300005719 Bacteria 662
144 Ga0068870_10009601 3300005840 Bacteria 4408
145 Ga0068870_10146476 3300005840 Bacteria 1387
146 Ga0068870_10436867 3300005840 Bacteria 860
147 Ga0068863_100232569 3300005841 Bacteria 1778
148 Ga0068863_100267154 3300005841 Bacteria 1655
149 Ga0068863_100626896 3300005841 Bacteria 1065
150 Ga0068863_100911582 3300005841 Bacteria 879
151 Ga0068863_101234259 3300005841 Bacteria 754
152 Ga0068863_101378900 3300005841 Unclassified 712
153 Ga0068863_102278854 3300005841 Bacteria 551
154 Ga0068858_100026513 3300005842 Bacteria 5382
155 Ga0068858_100170403 3300005842 Bacteria 2053
156 Ga0068858_101481411 3300005842 Bacteria 669
157 Ga0068858_101856303 3300005842 Bacteria 595
158 Ga0068860_100202122 3300005843 Bacteria 1926
159 Ga0068860_100276871 3300005843 Bacteria 1639
160 Ga0068860_100326048 3300005843 Bacteria 1508
161 Ga0068862_100228406 3300005844 Bacteria 1687
162 Ga0068862_100297178 3300005844 Bacteria 1484
163 Ga0068862_100591977 3300005844 Bacteria 1064
164 Ga0068862_101718184 3300005844 Bacteria 636
165 Ga0068862_101949235 3300005844 Bacteria 598
166 Ga0081539_10004362 3300005985 Bacteria 15767
167 Ga0070715_10076965 3300006163 Bacteria 1505
168 Ga0070716_100765783 3300006173 Bacteria 744
169 Ga0075366_10049967 3300006195 Unclassified 2482
170 Ga0097621_100129671 3300006237 Bacteria 2145
171 Ga0097621_100134171 3300006237 Bacteria 2110
172 Ga0097621_100134671 3300006237 Bacteria 2106
173 Ga0097621_100322063 3300006237 Bacteria 1369
174 Ga0068871_100130772 3300006358 Bacteria 2128
175 Ga0068871_100242467 3300006358 Bacteria 1567
176 Ga0068871_100325847 3300006358 Bacteria 1354
177 Ga0068871_100758976 3300006358 Unclassified 892
178 Ga0075428_100638959 3300006844 Unclassified 1135
179 Ga0075428_100882099 3300006844 Bacteria 949
180 Ga0075428_101962305 3300006844 Bacteria 607
181 Ga0075430_100009094 3300006846 Bacteria 8392
182 Ga0075430_100996180 3300006846 Bacteria 690
183 Ga0075431_100069180 3300006847 Bacteria 3642
184 Ga0075431_100081316 3300006847 Bacteria 3345
185 Ga0075434_102494435 3300006871 Bacteria 518
186 Ga0075429_100195571 3300006880 Bacteria 1771
187 Ga0075429_100492762 3300006880 Bacteria 1074
188 Ga0068865_100273598 3300006881 Bacteria 1342
189 Ga0068865_100448586 3300006881 Bacteria 1066
190 Ga0068865_100772291 3300006881 Bacteria 827
191 Ga0097620_100015329 3300006931 Bacteria 7698
192 Ga0097620_100071007 3300006931 Bacteria 3517
193 Ga0097620_100596160 3300006931 Bacteria 1198
194 Ga0097620_100769055 3300006931 Bacteria 1051
195 Ga0097620_101047528 3300006931 Bacteria 897
196 Ga0097620_101565949 3300006931 Unclassified 728
197 Ga0097620_101766282 3300006931 Bacteria 683
198 Ga0097620_102136554 3300006931 Bacteria 618
199 Ga0075435_100345449 3300007076 Bacteria 1275
200 Ga0105251_10052792 3300009011 Bacteria 1934
201 Ga0111539_10053545 3300009094 Bacteria 4803
202 Ga0111539_10116690 3300009094 Bacteria 3130
203 Ga0111539_10131961 3300009094 Bacteria 2925
204 Ga0111539_10208408 3300009094 Bacteria 2278
205 Ga0105247_10142464 3300009101 Bacteria 1572
206 Ga0114129_10549081 3300009147 Bacteria 1503
207 Ga0105243_10434953 3300009148 Bacteria 1227
208 Ga0105242_10006996 3300009176 Bacteria 8710
209 Ga0105242_10050644 3300009176 Bacteria 3382
210 Ga0105242_10095137 3300009176 Bacteria 2514
211 Ga0105242_10301095 3300009176 Bacteria 1464
212 Ga0105242_12653792 3300009176 Unclassified 550
213 Ga0105248_10370334 3300009177 Bacteria 1613
214 Ga0105248_11299181 3300009177 Bacteria 823
215 Ga0105248_11640113 3300009177 Bacteria 729
216 Ga0105238_11648853 3300009551 Bacteria 672
217 Ga0105249_10000623 3300009553 Bacteria 32238
218 Ga0105249_10014291 3300009553 Bacteria 7020
219 Ga0105249_10015124 3300009553 Bacteria 6828
220 Ga0105249_10054783 3300009553 Unclassified 3647
221 Ga0105249_10112864 3300009553 Unclassified 2571
222 Ga0105249_10142165 3300009553 Unclassified 2302
223 Ga0105249_10453576 3300009553 Bacteria 1321
224 Ga0105239_10104732 3300010375 Bacteria 3132
225 Ga0105246_10353938 3300011119 Bacteria 1204
226 Ga0105246_10631410 3300011119 Unclassified 930
227 Ga0157373_10002675 3300013100 Bacteria 13513
228 Ga0157373_10276773 3300013100 Bacteria 1189
229 Ga0157371_10001264 3300013102 Bacteria 26671
230 Ga0157371_10096476 3300013102 Bacteria 2095
231 Ga0157371_10398884 3300013102 Unclassified 1006
232 Ga0157371_10620968 3300013102 Unclassified 805
233 Ga0157371_10661376 3300013102 Bacteria 780
234 Ga0157371_11419431 3300013102 Bacteria 540
235 Ga0157371_11437152 3300013102 Unclassified 536
236 Ga0157370_10003185 3300013104 Bacteria 19409
237 Ga0157370_10710215 3300013104 Bacteria 917
238 Ga0157374_10213999 3300013296 Bacteria 1890
239 Ga0157374_10524543 3300013296 Bacteria 1190
240 Ga0157374_10573387 3300013296 Bacteria 1137
241 Ga0157374_11195994 3300013296 Bacteria 781
242 Ga0157374_11376713 3300013296 Bacteria 728
243 Ga0157378_11122159 3300013297 Bacteria 824
244 Ga0157378_11129651 3300013297 Bacteria 821
245 Ga0157378_13096668 3300013297 Unclassified 516
246 Ga0163162_10074502 3300013306 Bacteria 3453
247 Ga0163162_10084964 3300013306 Bacteria 3241
248 Ga0163162_10213534 3300013306 Unclassified 2059
249 Ga0163162_10515715 3300013306 Bacteria 1325
250 Ga0163162_11072770 3300013306 Bacteria 912
251 Ga0163162_11502356 3300013306 Bacteria 767
252 Ga0157372_10008122 3300013307 Bacteria 11163
253 Ga0157372_10015836 3300013307 Bacteria 8090
254 Ga0157372_10227846 3300013307 Bacteria 2160
255 Ga0157372_10254382 3300013307 Bacteria 2039
256 Ga0157372_10317141 3300013307 Bacteria 1815
257 Ga0157372_10368096 3300013307 Bacteria 1675
258 Ga0157372_10665785 3300013307 Bacteria 1212
259 Ga0157372_10758332 3300013307 Unclassified 1128
260 Ga0157372_10860411 3300013307 Bacteria 1052
261 Ga0157372_11303140 3300013307 Bacteria 838
262 Ga0157372_11308603 3300013307 Unclassified 836
263 Ga0157372_11588069 3300013307 Bacteria 753
264 Ga0157372_11882552 3300013307 Unclassified 688
265 Ga0157372_11900809 3300013307 Unclassified 684
266 Ga0157372_12876875 3300013307 Bacteria 551
267 Ga0157375_10392130 3300013308 Bacteria 1555
268 Ga0157375_11437684 3300013308 Bacteria 813
269 Ga0157375_11851549 3300013308 Unclassified 716
270 Ga0157375_11864258 3300013308 Bacteria 713
271 Ga0157375_12741396 3300013308 Unclassified 589
272 Ga0157375_13648013 3300013308 Unclassified 512
273 Ga0163163_10050570 3300014325 Bacteria 4093
274 Ga0163163_10123358 3300014325 Bacteria 2626
275 Ga0163163_10273186 3300014325 Bacteria 1741
276 Ga0163163_10560237 3300014325 Bacteria 1205
277 Ga0163163_10888660 3300014325 Bacteria 954
278 Ga0163163_12498974 3300014325 Bacteria 575
279 Ga0163163_13140272 3300014325 Bacteria 515
280 Ga0157380_10023958 3300014326 Bacteria 4612
281 Ga0157380_10615326 3300014326 Bacteria 1077
282 Ga0157380_10649127 3300014326 Bacteria 1052
283 Ga0157380_11174941 3300014326 Bacteria 810
284 Ga0157380_11677999 3300014326 Bacteria 692
285 Ga0157380_11771540 3300014326 Bacteria 676
286 Ga0157380_12118191 3300014326 Bacteria 625
287 Ga0157377_10033504 3300014745 Bacteria 2804
288 Ga0157377_10072069 3300014745 Bacteria 1999
289 Ga0157377_10353833 3300014745 Bacteria 986
290 Ga0157377_11721243 3300014745 Unclassified 506
291 Ga0157379_10055279 3300014968 Bacteria 3547
292 Ga0157379_10101683 3300014968 Bacteria 2580
293 Ga0157379_10182232 3300014968 Bacteria 1897
294 Ga0157376_10005642 3300014969 Bacteria 8758
295 Ga0157376_10138590 3300014969 Bacteria 2180
296 Ga0157376_10193068 3300014969 Unclassified 1868
297 Ga0157376_10949476 3300014969 Bacteria 880
298 Ga0163161_10184250 3300017792 Bacteria 1602
299 Ga0163161_10209093 3300017792 Bacteria 1507
300 Ga0163161_10463008 3300017792 Bacteria 1027
301 Ga0163161_11924461 3300017792 Unclassified 526
302 Ga0207666_1012809 3300025271 Bacteria 1172
303 Ga0207710_10005820 3300025900 Bacteria 5287
304 Ga0207685_10139931 3300025905 Bacteria 1084
305 Ga0207643_10008472 3300025908 Bacteria 5516
306 Ga0207707_10157648 3300025912 Bacteria 1985
307 Ga0207662_10030012 3300025918 Bacteria 3153
308 Ga0207662_10036237 3300025918 Bacteria 2883
309 Ga0207662_10218412 3300025918 Bacteria 1240
310 Ga0207681_10165392 3300025923 Bacteria 1672
311 Ga0207681_10436094 3300025923 Unclassified 1064
312 Ga0207681_11048775 3300025923 Bacteria 684
313 Ga0207650_10008046 3300025925 Bacteria 7183
314 Ga0207650_11022841 3300025925 Bacteria 703
315 Ga0207650_11087072 3300025925 Unclassified 681
316 Ga0207650_11303617 3300025925 Bacteria 618
317 Ga0207659_10036795 3300025926 Bacteria 3394
318 Ga0207659_10262339 3300025926 Bacteria 1406
319 Ga0207659_10554318 3300025926 Bacteria 977
320 Ga0207659_11649772 3300025926 Bacteria 547
321 Ga0207644_10345237 3300025931 Bacteria 1208
322 Ga0207686_10001595 3300025934 Bacteria 12714
323 Ga0207686_10034173 3300025934 Bacteria 3041
324 Ga0207686_10205454 3300025934 Bacteria 1413
325 Ga0207670_10044541 3300025936 Bacteria 2935
326 Ga0207670_10332031 3300025936 Bacteria 1199
327 Ga0207669_10017292 3300025937 Bacteria 3694
328 Ga0207704_10356207 3300025938 Bacteria 1141
329 Ga0207704_10712925 3300025938 Bacteria 832
330 Ga0207691_10013189 3300025940 Bacteria 7912
331 Ga0207691_10689210 3300025940 Bacteria 862
332 Ga0207711_10291857 3300025941 Bacteria 1503
333 Ga0207689_10237135 3300025942 Bacteria 1508
334 Ga0207661_11283694 3300025944 Bacteria 673
335 Ga0207651_10068154 3300025960 Bacteria 2507
336 Ga0207651_10203729 3300025960 Bacteria 1587
337 Ga0207651_11383094 3300025960 Bacteria 633
338 Ga0207712_10002336 3300025961 Bacteria 12303
339 Ga0207712_10048507 3300025961 Bacteria 2955
340 Ga0207712_10164564 3300025961 Bacteria 1727
341 Ga0207712_10575481 3300025961 Bacteria 971
342 Ga0207668_10275696 3300025972 Bacteria 1377
343 Ga0207640_10571808 3300025981 Bacteria 953
344 Ga0207640_10684712 3300025981 Unclassified 877
345 Ga0207677_10781616 3300026023 Unclassified 853
346 Ga0207703_10153196 3300026035 Unclassified 2012
347 Ga0207703_11601647 3300026035 Unclassified 626
348 Ga0207639_10640147 3300026041 Bacteria 983
349 Ga0207678_10167871 3300026067 Bacteria 1874
350 Ga0207708_10037130 3300026075 Bacteria 3711
351 Ga0207708_10234874 3300026075 Bacteria 1473
352 Ga0207641_10030859 3300026088 Bacteria 4441
353 Ga0207641_10213922 3300026088 Bacteria 1784
354 Ga0207641_10437763 3300026088 Bacteria 1261
355 Ga0207641_10874778 3300026088 Bacteria 891
356 Ga0207648_10110645 3300026089 Bacteria 2411
357 Ga0207648_10160080 3300026089 Unclassified 1988
358 Ga0207648_10886616 3300026089 Bacteria 833
359 Ga0207676_10172512 3300026095 Bacteria 1886
360 Ga0207676_11485211 3300026095 Bacteria 674
361 Ga0207675_100117673 3300026118 Unclassified 2513
362 Ga0207675_100209528 3300026118 Bacteria 1874
363 Ga0207675_100515104 3300026118 Bacteria 1192
364 Ga0207675_100905748 3300026118 Bacteria 898
365 Ga0207683_10376887 3300026121 Bacteria 1304
366 Ga0207698_10876784 3300026142 Bacteria 904
367 Ga0209969_1044499 3300027360 Bacteria 692
368 Ga0209971_1105651 3300027682 Bacteria 690
369 Ga0207428_10189549 3300027907 Bacteria 1550
370 Ga0207428_10255207 3300027907 Unclassified 1307
371 Ga0207428_11094502 3300027907 Unclassified 557
372 Ga0268265_10366191 3300028380 Bacteria 1321
373 Ga0268265_11061828 3300028380 Bacteria 802
374 Ga0268265_11361648 3300028380 Bacteria 711
375 Ga0268265_11404201 3300028380 Bacteria 700
376 Ga0268265_12286312 3300028380 Unclassified 547
377 Ga0268264_10091618 3300028381 Bacteria 2623
378 Ga0268264_10441493 3300028381 Bacteria 1259
379 Ga0316182_1185711 3300030745 Unclassified 536
380 Ga0307410_10052725 3300031852 Bacteria 2749
381 Ga0307406_11242981 3300031901 Unclassified 648
382 Ga0307416_101275114 3300032002 Unclassified 841
383 Ga0307411_10091318 3300032005 Bacteria 2127
384 Ga0307415_100038889 3300032126 Bacteria 3139
385 Ga0373945_0118156 3300035116 Bacteria 1052
386 Ga0373943_0764149 3300035170 Unclassified 574
387 Ga0373935_0453901 3300035692 Bacteria 926
388 Ga0439436_0214746 3300041404 Unclassified 553
389 Ga0451795_1248667 3300041456 Bacteria 907
390 Ga0451807_0902907 3300041486 Unclassified 511
391 Ga0451853_0022762 3300041512 Bacteria 889
392 Ga0439445_0221694 3300042004 Unclassified 561
393 Ga0439449_0027637 3300042007 Bacteria 2117
394 Ga0439462_0064906 3300042015 Unclassified 989
395 Ga0439434_0305386 3300042435 Unclassified 551
396 Ga0466967_0207718 3300045976 Bacteria 1856
397 Ga0495642_0269159 3300046528 Bacteria 746
398 Ga0495598_0010098 3300046537 Bacteria 2253
399 Ga0495598_0026001 3300046537 Bacteria 1601
400 Ga0495621_0037310 3300046539 Bacteria 1690
401 Ga0495621_0037567 3300046539 Bacteria 1685
402 Ga0495633_0484705 3300046558 Bacteria 558
403 Ga0495635_0731295 3300046663 Bacteria 640
404 Ga0495658_0901518 3300046683 Unclassified 565
405 Ga0495669_0427250 3300046684 Bacteria 643
406 Ga0495581_0363525 3300047315 Bacteria 845
407 Ga0495674_1131431 3300047319 Bacteria 595
408 Ga0501292_038924 3300049515 Bacteria 817
409 Ga0501214_079511 3300049659 Bacteria 549
410 Ga0501223_070509 3300049663 Bacteria 690
411 Ga0501230_053606 3300049667 Bacteria 805
412 Ga0501233_069616 3300049668 Bacteria 889
413 Ga0501235_010338 3300049669 Bacteria 2041
414 Ga0501242_020069 3300049674 Bacteria 857
415 Ga0501243_008786 3300049675 Bacteria 1563
416 Ga0501246_012200 3300049676 Bacteria 804
417 Ga0501249_136514 3300049679 Bacteria 608
418 Ga0501251_022485 3300049681 Bacteria 847
419 Ga0501221_001645 3300049704 Bacteria 3715
420 Ga0501204_039670 3300049850 Bacteria 685
421 Ga0501212_029053 3300049851 Bacteria 885
422 nmdc:mga0k408_53037_c1 3300050493 Unclassified 2350
423 nmdc:mga0k408_711341_c1 3300050493 Unclassified 588
424 nmdc:mga05p37_32082_c1 3300050507 Bacteria 6422
425 nmdc:mga05p37_343050_c1 3300050507 Bacteria 1761
426 nmdc:mga05p37_380122_c1 3300050507 Bacteria 1655
427 nmdc:mga09592_140617_c1 3300050508 Bacteria 2081
428 nmdc:mga09592_23534_c1 3300050508 Bacteria 5088
429 nmdc:mga0qj67_1113302_c1 3300050509 Unclassified 617
430 nmdc:mga06r32_1021299_c1 3300050510 Unclassified 779
431 nmdc:mga06r32_148129_c1 3300050510 Bacteria 2325
432 nmdc:mga08y16_1016061_c1 3300050511 Bacteria 808
433 nmdc:mga08y16_235112_c1 3300050511 Bacteria 1895
434 nmdc:mga08y16_354019_c1 3300050511 Bacteria 1508
435 nmdc:mga08y16_561759_c1 3300050511 Bacteria 1154
436 nmdc:mga08y16_75755_c1 3300050511 Bacteria 3507
437 nmdc:mga0n895_289102_c1 3300050512 Bacteria 1662
438 nmdc:mga0rr50_1165805_c1 3300050513 Bacteria 655
439 Ga0500651_0616315 3300053093 Bacteria 587
440 Ga0500622_0257721 3300053156 Bacteria 762
441 Ga0587109_068510 3300059624 Bacteria 762
442 Ga0070700_100596706
443 JGI24751J29686_10016050
444 Ga0065714_10093375
445 Ga0065712_10002383
446 Ga0065712_10010497
447 Ga0065712_10014311
448 Ga0065712_10017165
449 Ga0065712_10100425
450 Ga0065715_10005061
451 Ga0065707_10116066
452 Ga0065707_10887505
453 Ga0070658_11162231
454 Ga0070676_10367847
455 Ga0070676_10861944
456 Ga0070683_100296698
457 Ga0070683_100695017
458 Ga0070690_100148899
459 Ga0070690_101765981
460 Ga0070670_100004799
461 Ga0070670_100073961
462 Ga0070670_100152705
463 Ga0070670_101389430
464 Ga0070670_101855091
465 Ga0070677_10128758
466 Ga0070677_10513949
467 Ga0068869_100003968
468 Ga0068869_100133027
469 Ga0068869_101680321
470 Ga0070666_10106091
471 Ga0070666_10857546
472 Ga0068868_100064288
473 Ga0068868_100141633
474 Ga0070660_100460716
475 Ga0070689_100523424
476 Ga0070689_100753938
477 Ga0070689_101105707
478 Ga0070687_100026348
479 Ga0070687_100682935
480 Ga0070687_100882027
481 Ga0070661_100152421
482 Ga0070669_100123366
483 Ga0070669_101452231
484 Ga0070675_100010657
485 Ga0070675_100045702
486 Ga0070675_100078826
487 Ga0070675_100808483
488 Ga0070675_101438284
489 Ga0070675_101888896
490 Ga0070671_100439477
491 Ga0070671_100709994
492 Ga0070671_100799731
493 Ga0070674_100508746
494 Ga0070674_100593028
495 Ga0070673_100012919
496 Ga0070673_100104786
497 Ga0070673_100415144
498 Ga0070673_100920169
499 Ga0070673_101596627
500 Ga0070688_100016242
501 Ga0070688_100035701
502 Ga0070688_100746239
503 Ga0070688_100976983
504 Ga0070688_101724362
505 Ga0070667_100072577
506 Ga0070667_100076803
507 Ga0070667_102021013
508 Ga0070667_102205914
509 Ga0070701_10154054
510 Ga0070663_100548451
511 Ga0070663_100758902
512 Ga0070678_100018792
513 Ga0070678_100953124
514 Ga0070678_101057022
515 Ga0070662_100327833
516 Ga0070662_100661198
517 Ga0070681_10118321
518 Ga0070681_10457754
519 Ga0068867_100057936
520 Ga0068867_100401413
521 Ga0068867_101579752
522 Ga0068867_102039030
523 Ga0070685_10008065
524 Ga0070685_10068370
525 Ga0070685_10251602
526 Ga0070698_100004771
527 Ga0070698_100018756
528 Ga0070698_101181073
529 Ga0070679_100252316
530 Ga0070684_100353362
531 Ga0070684_101648982
532 Ga0068853_100221463
533 Ga0068853_100734958
534 Ga0068853_101196116
535 Ga0068853_102148710
536 Ga0068853_102407697
537 Ga0070672_100382742
538 Ga0070672_100680538
539 Ga0070672_100885855
540 Ga0070672_101783429
541 Ga0070686_100179572
542 Ga0070686_100654616
543 Ga0070696_101758584
544 Ga0070665_100182430
545 Ga0070704_101438244
546 Ga0068855_100000795
547 Ga0068855_100642024
548 Ga0068855_101877112
549 Ga0070664_100023622
550 Ga0070664_100172900
551 Ga0070664_100315413
552 Ga0068857_100153220
553 Ga0068857_100467305
554 Ga0068854_100235055
555 Ga0068856_102464293
556 Ga0070702_100191178
557 Ga0070702_100235431
558 Ga0068852_100000988
559 Ga0068852_100059447
560 Ga0068852_101357380
561 Ga0068852_101965724
562 Ga0068859_100015329
563 Ga0068859_100071004
564 Ga0068859_100596120
565 Ga0068859_100769056
566 Ga0068859_101047452
567 Ga0068859_101566027
568 Ga0068859_101766223
569 Ga0068859_102135658
570 Ga0068864_100108516
571 Ga0068864_100226740
572 Ga0068864_100256741
573 Ga0068864_100339245
574 Ga0068864_100770214
575 Ga0068864_100928426
576 Ga0068864_100973060
577 Ga0068864_101866072
578 Ga0068866_10807256
579 Ga0068866_11110686
580 Ga0068861_100002876
581 Ga0068861_100236441
582 Ga0068861_101245039
583 Ga0068861_101284639
584 Ga0068861_101499420
585 Ga0068870_10009601
586 Ga0068870_10146476
587 Ga0068870_10436867
588 Ga0068863_100232569
589 Ga0068863_100267154
590 Ga0068863_100626896
591 Ga0068863_100911582
592 Ga0068863_101234259
593 Ga0068863_101378900
594 Ga0068863_102278854
595 Ga0068858_100026513
596 Ga0068858_100170403
597 Ga0068858_101481411
598 Ga0068858_101856303
599 Ga0068860_100202122
600 Ga0068860_100276871
601 Ga0068860_100326048
602 Ga0068862_100228406
603 Ga0068862_100297178
604 Ga0068862_100591977
605 Ga0068862_101718184
606 Ga0068862_101949235
607 Ga0081539_10004362
608 Ga0070715_10076965
609 Ga0070716_100765783
610 Ga0075366_10049967
611 Ga0097621_100129671
612 Ga0097621_100134171
613 Ga0097621_100134671
614 Ga0097621_100322063
615 Ga0068871_100130772
616 Ga0068871_100242467
617 Ga0068871_100325847
618 Ga0068871_100758976
619 Ga0075428_100638959
620 Ga0075428_100882099
621 Ga0075428_101962305
622 Ga0075430_100009094
623 Ga0075430_100996180
624 Ga0075431_100069180
625 Ga0075431_100081316
626 Ga0075434_102494435
627 Ga0075429_100195571
628 Ga0075429_100492762
629 Ga0068865_100273598
630 Ga0068865_100448586
631 Ga0068865_100772291
632 Ga0097620_100015329
633 Ga0097620_100071007
634 Ga0097620_100596160
635 Ga0097620_100769055
636 Ga0097620_101047528
637 Ga0097620_101565949
638 Ga0097620_101766282
639 Ga0097620_102136554
640 Ga0075435_100345449
641 Ga0105251_10052792
642 Ga0111539_10053545
643 Ga0111539_10116690
644 Ga0111539_10131961
645 Ga0111539_10208408
646 Ga0105247_10142464
647 Ga0114129_10549081
648 Ga0105243_10434953
649 Ga0105242_10006996
650 Ga0105242_10050644
651 Ga0105242_10095137
652 Ga0105242_10301095
653 Ga0105242_12653792
654 Ga0105248_10370334
655 Ga0105248_11299181
656 Ga0105248_11640113
657 Ga0105238_11648853
658 Ga0105249_10000623
659 Ga0105249_10014291
660 Ga0105249_10015124
661 Ga0105249_10054783
662 Ga0105249_10112864
663 Ga0105249_10142165
664 Ga0105249_10453576
665 Ga0105239_10104732
666 Ga0105246_10353938
667 Ga0105246_10631410
668 Ga0157373_10002675
669 Ga0157373_10276773
670 Ga0157371_10001264
671 Ga0157371_10096476
672 Ga0157371_10398884
673 Ga0157371_10620968
674 Ga0157371_10661376
675 Ga0157371_11419431
676 Ga0157371_11437152
677 Ga0157370_10003185
678 Ga0157370_10710215
679 Ga0157374_10213999
680 Ga0157374_10524543
681 Ga0157374_10573387
682 Ga0157374_11195994
683 Ga0157374_11376713
684 Ga0157378_11122159
685 Ga0157378_11129651
686 Ga0157378_13096668
687 Ga0163162_10074502
688 Ga0163162_10084964
689 Ga0163162_10213534
690 Ga0163162_10515715
691 Ga0163162_11072770
692 Ga0163162_11502356
693 Ga0157372_10008122
694 Ga0157372_10015836
695 Ga0157372_10227846
696 Ga0157372_10254382
697 Ga0157372_10317141
698 Ga0157372_10368096
699 Ga0157372_10665785
700 Ga0157372_10758332
701 Ga0157372_10860411
702 Ga0157372_11303140
703 Ga0157372_11308603
704 Ga0157372_11588069
705 Ga0157372_11882552
706 Ga0157372_11900809
707 Ga0157372_12876875
708 Ga0157375_10392130
709 Ga0157375_11437684
710 Ga0157375_11851549
711 Ga0157375_11864258
712 Ga0157375_12741396
713 Ga0157375_13648013
714 Ga0163163_10050570
715 Ga0163163_10123358
716 Ga0163163_10273186
717 Ga0163163_10560237
718 Ga0163163_10888660
719 Ga0163163_12498974
720 Ga0163163_13140272
721 Ga0157380_10023958
722 Ga0157380_10615326
723 Ga0157380_10649127
724 Ga0157380_11174941
725 Ga0157380_11677999
726 Ga0157380_11771540
727 Ga0157380_12118191
728 Ga0157377_10033504
729 Ga0157377_10072069
730 Ga0157377_10353833
731 Ga0157377_11721243
732 Ga0157379_10055279
733 Ga0157379_10101683
734 Ga0157379_10182232
735 Ga0157376_10005642
736 Ga0157376_10138590
737 Ga0157376_10193068
738 Ga0157376_10949476
739 Ga0163161_10184250
740 Ga0163161_10209093
741 Ga0163161_10463008
742 Ga0163161_11924461
743 Ga0207666_1012809
744 Ga0207710_10005820
745 Ga0207685_10139931
746 Ga0207643_10008472
747 Ga0207707_10157648
748 Ga0207662_10030012
749 Ga0207662_10036237
750 Ga0207662_10218412
751 Ga0207681_10165392
752 Ga0207681_10436094
753 Ga0207681_11048775
754 Ga0207650_10008046
755 Ga0207650_11022841
756 Ga0207650_11087072
757 Ga0207650_11303617
758 Ga0207659_10036795
759 Ga0207659_10262339
760 Ga0207659_10554318
761 Ga0207659_11649772
762 Ga0207644_10345237
763 Ga0207686_10001595
764 Ga0207686_10034173
765 Ga0207686_10205454
766 Ga0207670_10044541
767 Ga0207670_10332031
768 Ga0207669_10017292
769 Ga0207704_10356207
770 Ga0207704_10712925
771 Ga0207691_10013189
772 Ga0207691_10689210
773 Ga0207711_10291857
774 Ga0207689_10237135
775 Ga0207661_11283694
776 Ga0207651_10068154
777 Ga0207651_10203729
778 Ga0207651_11383094
779 Ga0207712_10002336
780 Ga0207712_10048507
781 Ga0207712_10164564
782 Ga0207712_10575481
783 Ga0207668_10275696
784 Ga0207640_10571808
785 Ga0207640_10684712
786 Ga0207677_10781616
787 Ga0207703_10153196
788 Ga0207703_11601647
789 Ga0207639_10640147
790 Ga0207678_10167871
791 Ga0207708_10037130
792 Ga0207708_10234874
793 Ga0207641_10030859
794 Ga0207641_10213922
795 Ga0207641_10437763
796 Ga0207641_10874778
797 Ga0207648_10110645
798 Ga0207648_10160080
799 Ga0207648_10886616
800 Ga0207676_10172512
801 Ga0207676_11485211
802 Ga0207675_100117673
803 Ga0207675_100209528
804 Ga0207675_100515104
805 Ga0207675_100905748
806 Ga0207683_10376887
807 Ga0207698_10876784
808 Ga0209969_1044499
809 Ga0209971_1105651
810 Ga0207428_10189549
811 Ga0207428_10255207
812 Ga0207428_11094502
813 Ga0268265_10366191
814 Ga0268265_11061828
815 Ga0268265_11361648
816 Ga0268265_11404201
817 Ga0268265_12286312
818 Ga0268264_10091618
819 Ga0268264_10441493
820 Ga0316182_1185711
821 Ga0307410_10052725
822 Ga0307406_11242981
823 Ga0307416_101275114
824 Ga0307411_10091318
825 Ga0307415_100038889
826 Ga0373945_0118156
827 Ga0373943_0764149
828 Ga0373935_0453901
829 Ga0439436_0214746
830 Ga0451795_1248667
831 Ga0451807_0902907
832 Ga0451853_0022762
833 Ga0439445_0221694
834 Ga0439449_0027637
835 Ga0439462_0064906
836 Ga0439434_0305386
837 Ga0466967_0207718
838 Ga0495642_0269159
839 Ga0495598_0010098
840 Ga0495598_0026001
841 Ga0495621_0037310
842 Ga0495621_0037567
843 Ga0495633_0484705
844 Ga0495635_0731295
845 Ga0495658_0901518
846 Ga0495669_0427250
847 Ga0495581_0363525
848 Ga0495674_1131431
849 Ga0501292_038924
850 Ga0501214_079511
851 Ga0501223_070509
852 Ga0501230_053606
853 Ga0501233_069616
854 Ga0501235_010338
855 Ga0501242_020069
856 Ga0501243_008786
857 Ga0501246_012200
858 Ga0501249_136514
859 Ga0501251_022485
860 Ga0501221_001645
861 Ga0501204_039670
862 Ga0501212_029053
863 nmdc:mga0k408_53037_c1
864 nmdc:mga0k408_711341_c1
865 nmdc:mga05p37_32082_c1
866 nmdc:mga05p37_343050_c1
867 nmdc:mga05p37_380122_c1
868 nmdc:mga09592_140617_c1
869 nmdc:mga09592_23534_c1
870 nmdc:mga0qj67_1113302_c1
871 nmdc:mga06r32_1021299_c1
872 nmdc:mga06r32_148129_c1
873 nmdc:mga08y16_1016061_c1
874 nmdc:mga08y16_235112_c1
875 nmdc:mga08y16_354019_c1
876 nmdc:mga08y16_561759_c1
877 nmdc:mga08y16_75755_c1
878 nmdc:mga0n895_289102_c1
879 nmdc:mga0rr50_1165805_c1
880 Ga0500651_0616315
881 Ga0500622_0257721
882 Ga0587109_068510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wvo-assembly1.cif.gz_B an engineered pyr1 mandipropamid receptor in complex with mandipropamid and hab1 0.5875 34 87
7zf2-assembly1.cif.gz_E protomeric substructure from an octameric assembly of m. tuberculosis rna polymerase in complex with sigma-b initiation factor 0.5227 28 78
6fbv-assembly1.cif.gz_E single particle cryo em structure of mycobacterium tuberculosis rna polymerase in complex with fidaxomicin 0.5129 28 78
2gbb-assembly2.cif.gz_D crystal structure of secreted chorismate mutase from yersinia pestis 0.4385 12 93
6cpv-assembly2.cif.gz_B microed structure of nak ion channel reveals a process of na+ partition into the selectivity filter 0.4255 4 92
ID Description Score Start End Superfamily
4m70B00 Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1;WPP domain 0.6147 25 86 1.10.246.200
af_Q4DA26_40_234_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5294 4 93 1.20.1250.20
af_Q0IYC5_29_129_1.10.246.200 Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1;WPP domain 0.4976 1 92 1.10.246.200
af_Q7K3R0_326_620_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.4955 12 95 3.40.50.720
af_O17204_36_299_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4884 31 93 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A0H4T335-F1-model_v4 Transglycosylase-associated protein 0.933 1 95 GO:0005886
AF-A9B282-F1-model_v4 Transglycosylase-associated protein 0.9171 1 94 GO:0005886
AF-A0A0H4T335-F1-model_v4 Transglycosylase-associated protein 0.8962 1 95 GO:0005886
AF-A0A7V4CUI9-F1-model_v4 GlsB/YeaQ/YmgE family stress response membrane protein 0.8946 1 95 GO:0016020
AF-A0A534XJ90-F1-model_v4 Uncharacterized protein 0.8918 5 95 GO:0016020

Map