F444553

General Info

Members Datasets Scaffolds Average Seq Length
440 197 880 243

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2895511927|2895515592
Length 239
Sequence PRLLGPDDPFPPVDQALREPDGLLAIGGDLSPERLLAAYAQGIFPWYSEGQPILWWSPDPRMVFRTDGVRLSTRFRRQLRHSAWQVRADTAFDAVLAACAETPRRGHDGTWILPEMRAAYARLHRLGHAHSIEVVDAGGRLVGGLYGVAVGRMFYGESMFSACSGGSKVALAALAHRLCGWGWPLLDAQVENPHLVSLGGERWPRPRFQAELSRLTALPGMVGSWTTAFGLLPASALAG

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
86 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
125 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
126 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
127 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
128 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
129 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
132 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
189 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
190 2739367700 Dyella sp. YR388 Isolate Unclassified
191 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
192 2884411467 Dyella sp. AD56 Isolate Rhizosphere
193 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
194 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
195 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
196 2928963466 Dyella japonica 1073 Isolate Unclassified
197 2941471342 Luteibacter sp. 621 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.14
Metatranscriptomes 1.82
Isolates 2.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.73
Nodule 0
Rhizoplane 2.73
Rhizosphere 72.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1024647 3300001904 Bacteria 937
2 JGI24741J21665_1000887 3300001915 Bacteria 9016
3 JGI24740J21852_10000673 3300001979 Bacteria 14819
4 JGI24740J21852_10003467 3300001979 Bacteria 6929
5 JGI24739J22299_10000542 3300001989 Bacteria 13462
6 JGI24735J21928_10003069 3300002067 Bacteria 5728
7 JGI25156J39149_1008631 3300002705 Bacteria 2546
8 JGI25162J39368_1000018 3300002737 Bacteria 277875
9 JGI25162J39368_1001950 3300002737 Bacteria 9293
10 JGI25157J39369_1000340 3300002741 Bacteria 33129
11 JGI25157J39369_1000780 3300002741 Bacteria 16346
12 JGI25164J39214_1000007 3300002772 Bacteria 312507
13 JGI25165J46597_1000029 3300003214 Bacteria 312507
14 rootH2_10006354 3300003320 Bacteria 8276
15 rootH2_10177764 3300003320 Bacteria 1365
16 rootL2_10006504 3300003322 Bacteria 2920
17 Ga0055538_1000761 3300003751 Bacteria 9174
18 Ga0055539_1001041 3300003752 Bacteria 5930
19 Ga0055533_1000992 3300003756 Bacteria 8264
20 Ga0055533_1001365 3300003756 Bacteria 6534
21 Ga0055525_1000211 3300003759 Bacteria 65308
22 Ga0055527_1000257 3300003760 Bacteria 32518
23 Ga0055527_1000263 3300003760 Bacteria 31815
24 Ga0055535_1000103 3300003761 Bacteria 91199
25 Ga0055535_1000541 3300003761 Bacteria 32518
26 Ga0055535_1000731 3300003761 Bacteria 24696
27 Ga0055542_1000024 3300003762 Bacteria 277875
28 Ga0055542_1000222 3300003762 Bacteria 68762
29 Ga0055542_1000476 3300003762 Bacteria 37344
30 Ga0055542_1000567 3300003762 Bacteria 32518
31 Ga0055542_1000578 3300003762 Bacteria 31815
32 Ga0055529_1000029 3300003763 Bacteria 277978
33 Ga0055529_1000538 3300003763 Bacteria 32518
34 Ga0055529_1000850 3300003763 Bacteria 17724
35 Ga0065165_1007335 3300005262 Bacteria 5459
36 Ga0065704_10070807 3300005289 Bacteria 15869
37 Ga0070658_10397119 3300005327 Bacteria 1184
38 Ga0070683_100043617 3300005329 Bacteria 4134
39 Ga0070670_100053529 3300005331 Bacteria 3466
40 Ga0070680_100012331 3300005336 Bacteria 6638
41 Ga0070680_100015271 3300005336 Bacteria 6018
42 Ga0070680_100031356 3300005336 Bacteria 4273
43 Ga0070680_100070111 3300005336 Bacteria 2879
44 Ga0070682_100003230 3300005337 Bacteria 9038
45 Ga0070682_100131150 3300005337 Bacteria 1696
46 Ga0070689_100003678 3300005340 Bacteria 10239
47 Ga0070691_10004725 3300005341 Bacteria 6199
48 Ga0070691_10005695 3300005341 Bacteria 5682
49 Ga0070661_100002257 3300005344 Bacteria 13217
50 Ga0070661_100267736 3300005344 Bacteria 1322
51 Ga0070692_10011783 3300005345 Bacteria 4027
52 Ga0070659_100178386 3300005366 Bacteria 1742
53 Ga0070667_100075442 3300005367 Bacteria 2879
54 Ga0070709_10243512 3300005434 Bacteria 1292
55 Ga0070714_100164768 3300005435 Bacteria 2008
56 Ga0070663_100002458 3300005455 Bacteria 10440
57 Ga0070663_100018215 3300005455 Bacteria 4598
58 Ga0070663_100051769 3300005455 Bacteria 2927
59 Ga0070663_100065757 3300005455 Bacteria 2625
60 Ga0070663_100142071 3300005455 Bacteria 1834
61 Ga0070662_100009906 3300005457 Bacteria 6243
62 Ga0070681_10000211 3300005458 Bacteria 45377
63 Ga0070681_10003200 3300005458 Bacteria 15251
64 Ga0070681_10019847 3300005458 Bacteria 6732
65 Ga0070681_10034898 3300005458 Bacteria 5052
66 Ga0070679_100010547 3300005530 Bacteria 8766
67 Ga0070679_100018626 3300005530 Bacteria 6740
68 Ga0070679_100018670 3300005530 Bacteria 6732
69 Ga0068853_100544279 3300005539 Bacteria 1099
70 Ga0070696_100001397 3300005546 Bacteria 15784
71 Ga0070693_100063100 3300005547 Bacteria 2158
72 Ga0070665_100009525 3300005548 Bacteria 9825
73 Ga0068855_100008640 3300005563 Bacteria 12308
74 Ga0068855_100019983 3300005563 Bacteria 8044
75 Ga0068855_100291676 3300005563 Bacteria 1808
76 Ga0070664_100080120 3300005564 Bacteria 2812
77 Ga0068857_100001031 3300005577 Bacteria 21511
78 Ga0068857_100042088 3300005577 Bacteria 4051
79 Ga0068854_100000593 3300005578 Bacteria 21529
80 Ga0068854_100007279 3300005578 Bacteria 7069
81 Ga0068854_100022711 3300005578 Bacteria 4280
82 Ga0068854_100026288 3300005578 Bacteria 3999
83 Ga0068856_100003150 3300005614 Bacteria 16818
84 Ga0068852_100049936 3300005616 Bacteria 3581
85 Ga0068852_100058741 3300005616 Bacteria 3333
86 Ga0068851_10002366 3300005834 Bacteria 8290
87 Ga0068851_10008310 3300005834 Bacteria 4797
88 Ga0068851_10031287 3300005834 Bacteria 2642
89 Ga0068862_100600352 3300005844 Bacteria 1057
90 Ga0105240_10000127 3300009093 Bacteria 156461
91 Ga0105240_10001888 3300009093 Bacteria 34840
92 Ga0105240_10030204 3300009093 Bacteria 7047
93 Ga0105240_10048100 3300009093 Bacteria 5392
94 Ga0105240_10055264 3300009093 Bacteria 4971
95 Ga0105240_10058931 3300009093 Bacteria 4793
96 Ga0105240_10075408 3300009093 Bacteria 4160
97 Ga0105240_10212099 3300009093 Bacteria 2262
98 Ga0105237_10000565 3300009545 Bacteria 51782
99 Ga0105237_10145675 3300009545 Bacteria 2363
100 Ga0105237_10186534 3300009545 Bacteria 2074
101 Ga0105238_10000783 3300009551 Bacteria 33020
102 Ga0105238_10025069 3300009551 Bacteria 6080
103 Ga0105239_10000933 3300010375 Bacteria 41307
104 Ga0157314_1000360 3300012500 Bacteria 4696
105 Ga0157373_10018022 3300013100 Bacteria 5142
106 Ga0157373_10028431 3300013100 Bacteria 4033
107 Ga0157373_10414168 3300013100 Bacteria 967
108 Ga0157371_10058156 3300013102 Bacteria 2743
109 Ga0157371_10159225 3300013102 Bacteria 1612
110 Ga0157371_10343996 3300013102 Bacteria 1085
111 Ga0157370_10004805 3300013104 Bacteria 15363
112 Ga0157370_10009321 3300013104 Bacteria 10509
113 Ga0157370_10116302 3300013104 Bacteria 2498
114 Ga0157369_10002023 3300013105 Bacteria 24459
115 Ga0157369_10037349 3300013105 Bacteria 5318
116 Ga0163162_10000281 3300013306 Bacteria 46556
117 Ga0163162_10119494 3300013306 Bacteria 2738
118 Ga0157372_10005727 3300013307 Bacteria 13233
119 Ga0157372_10014832 3300013307 Bacteria 8343
120 Ga0157372_10076403 3300013307 Bacteria 3781
121 Ga0157372_10144648 3300013307 Bacteria 2742
122 Ga0157372_10373426 3300013307 Bacteria 1662
123 Ga0182008_10087571 3300014497 Bacteria 1534
124 Ga0157376_10153556 3300014969 Bacteria 2079
125 Ga0182007_10035309 3300015262 Bacteria 1685
126 Ga0183368_1004 3300015687 Bacteria 1211761
127 Ga0163161_10086827 3300017792 Bacteria 2310
128 Ga0206356_11202932 3300020070 Bacteria 1789
129 Ga0206356_11530043 3300020070 Bacteria 3206
130 Ga0206354_10238400 3300020081 Bacteria 2676
131 Ga0206354_11202544 3300020081 Bacteria 1902
132 Ga0206353_10283238 3300020082 Bacteria 1109
133 Ga0206353_10976575 3300020082 Bacteria 6925
134 Ga0154015_1104391 3300020610 Bacteria 9283
135 Ga0154015_1256927 3300020610 Bacteria 4208
136 Ga0209760_100235 3300025207 Bacteria 23322
137 Ga0209784_100026 3300025224 Bacteria 371540
138 Ga0209566_104425 3300025225 Bacteria 1922
139 Ga0209566_110539 3300025225 Bacteria 930
140 Ga0209674_100016 3300025226 Bacteria 696756
141 Ga0209674_100108 3300025226 Bacteria 150893
142 Ga0209672_100007 3300025228 Bacteria 959482
143 Ga0209672_100009 3300025228 Bacteria 883623
144 Ga0209672_100176 3300025228 Bacteria 53116
145 Ga0209672_100268 3300025228 Bacteria 38409
146 Ga0209563_100079 3300025230 Bacteria 203017
147 Ga0207427_100023 3300025231 Bacteria 439725
148 Ga0207427_101563 3300025231 Bacteria 7926
149 Ga0209437_100069 3300025233 Bacteria 307733
150 Ga0209437_100252 3300025233 Bacteria 84185
151 Ga0209258_100011 3300025242 Bacteria 867542
152 Ga0209258_100046 3300025242 Bacteria 369794
153 Ga0209258_100059 3300025242 Bacteria 324934
154 Ga0209258_100511 3300025242 Bacteria 37397
155 Ga0209258_101642 3300025242 Bacteria 7208
156 Ga0209646_1000577 3300025246 Bacteria 15267
157 Ga0209026_1000036 3300025250 Bacteria 296607
158 Ga0209026_1000194 3300025250 Bacteria 85950
159 Ga0209026_1001141 3300025250 Bacteria 12494
160 Ga0209677_103689 3300025253 Bacteria 4810
161 Ga0209148_1000002 3300025254 Bacteria 2399500
162 Ga0209148_1000010 3300025254 Bacteria 1265567
163 Ga0209148_1000013 3300025254 Bacteria 956684
164 Ga0209148_1000084 3300025254 Bacteria 268147
165 Ga0209148_1000533 3300025254 Bacteria 37397
166 Ga0209759_1000300 3300025256 Bacteria 68198
167 Ga0209759_1000901 3300025256 Bacteria 22183
168 Ga0209759_1002666 3300025256 Bacteria 7642
169 Ga0209129_1005749 3300025258 Bacteria 4257
170 Ga0209233_1000009 3300025261 Bacteria 1265567
171 Ga0209455_1000010 3300025272 Bacteria 959482
172 Ga0209455_1000012 3300025272 Bacteria 867234
173 Ga0209455_1000020 3300025272 Bacteria 702259
174 Ga0209758_1000289 3300025297 Bacteria 98983
175 Ga0209051_1002103 3300025303 Bacteria 14932
176 Ga0207656_10001718 3300025321 Bacteria 7281
177 Ga0207656_10020249 3300025321 Bacteria 2642
178 Ga0207656_10043552 3300025321 Bacteria 1914
179 Ga0207680_10000005 3300025903 Bacteria 660983
180 Ga0207647_10000150 3300025904 Bacteria 55376
181 Ga0207647_10002791 3300025904 Bacteria 13175
182 Ga0207647_10005413 3300025904 Bacteria 9365
183 Ga0207647_10006362 3300025904 Bacteria 8586
184 Ga0207705_10000353 3300025909 Bacteria 41498
185 Ga0207705_10000355 3300025909 Bacteria 41474
186 Ga0207705_10004364 3300025909 Bacteria 10695
187 Ga0207705_10016812 3300025909 Bacteria 5239
188 Ga0207705_10034831 3300025909 Bacteria 3601
189 Ga0207654_10121625 3300025911 Bacteria 1640
190 Ga0207707_10000308 3300025912 Bacteria 51301
191 Ga0207707_10000630 3300025912 Bacteria 34922
192 Ga0207707_10000644 3300025912 Bacteria 34474
193 Ga0207707_10000699 3300025912 Bacteria 33304
194 Ga0207707_10007899 3300025912 Bacteria 9252
195 Ga0207707_10009345 3300025912 Bacteria 8502
196 Ga0207707_10031697 3300025912 Bacteria 4626
197 Ga0207695_10000349 3300025913 Bacteria 106823
198 Ga0207695_10000975 3300025913 Bacteria 50860
199 Ga0207695_10006439 3300025913 Bacteria 15246
200 Ga0207695_10019320 3300025913 Bacteria 7846
201 Ga0207695_10021742 3300025913 Bacteria 7311
202 Ga0207695_10032821 3300025913 Bacteria 5675
203 Ga0207695_10232201 3300025913 Bacteria 1749
204 Ga0207695_10427582 3300025913 Bacteria 1208
205 Ga0207671_10000059 3300025914 Bacteria 179761
206 Ga0207671_10055961 3300025914 Bacteria 2922
207 Ga0207660_10000244 3300025917 Bacteria 35421
208 Ga0207660_10000570 3300025917 Bacteria 24778
209 Ga0207660_10005110 3300025917 Bacteria 8543
210 Ga0207660_10005371 3300025917 Bacteria 8319
211 Ga0207660_10021767 3300025917 Bacteria 4315
212 Ga0207660_10057190 3300025917 Bacteria 2793
213 Ga0207657_10003793 3300025919 Bacteria 16074
214 Ga0207657_10005053 3300025919 Bacteria 13844
215 Ga0207649_10006739 3300025920 Bacteria 6239
216 Ga0207649_10010374 3300025920 Bacteria 5116
217 Ga0207649_10021545 3300025920 Bacteria 3712
218 Ga0207652_10000030 3300025921 Bacteria 144884
219 Ga0207652_10000719 3300025921 Bacteria 32081
220 Ga0207652_10000940 3300025921 Bacteria 27407
221 Ga0207652_10001717 3300025921 Bacteria 19113
222 Ga0207652_10012507 3300025921 Bacteria 6858
223 Ga0207694_10000916 3300025924 Bacteria 26125
224 Ga0207650_10038487 3300025925 Bacteria 3493
225 Ga0207690_10000799 3300025932 Bacteria 20248
226 Ga0207690_10006154 3300025932 Bacteria 7109
227 Ga0207690_10086659 3300025932 Bacteria 2201
228 Ga0207706_10012181 3300025933 Bacteria 7836
229 Ga0207670_10002344 3300025936 Bacteria 9922
230 Ga0207661_10001956 3300025944 Bacteria 14166
231 Ga0207661_10141128 3300025944 Bacteria 2073
232 Ga0207661_10492249 3300025944 Bacteria 1120
233 Ga0207679_10026647 3300025945 Bacteria 3988
234 Ga0207667_10000031 3300025949 Bacteria 323587
235 Ga0207667_10000383 3300025949 Bacteria 59865
236 Ga0207667_10000679 3300025949 Bacteria 44080
237 Ga0207667_10018339 3300025949 Bacteria 7851
238 Ga0207667_10031340 3300025949 Bacteria 5740
239 Ga0207640_10000082 3300025981 Bacteria 74895
240 Ga0207640_10003658 3300025981 Bacteria 8294
241 Ga0207640_10008036 3300025981 Bacteria 5832
242 Ga0207640_10039098 3300025981 Bacteria 3000
243 Ga0207640_10258651 3300025981 Bacteria 1355
244 Ga0207639_10003825 3300026041 Bacteria 10142
245 Ga0207639_10007936 3300026041 Bacteria 7253
246 Ga0207639_10043878 3300026041 Bacteria 3359
247 Ga0207639_10517142 3300026041 Bacteria 1093
248 Ga0207678_10002717 3300026067 Bacteria 16042
249 Ga0207678_10016436 3300026067 Bacteria 6497
250 Ga0207678_10017192 3300026067 Bacteria 6349
251 Ga0207678_10018140 3300026067 Bacteria 6181
252 Ga0207678_10041906 3300026067 Bacteria 3968
253 Ga0207702_10004220 3300026078 Bacteria 12835
254 Ga0207702_10005766 3300026078 Bacteria 10771
255 Ga0207702_10035244 3300026078 Bacteria 4184
256 Ga0207702_10039170 3300026078 Bacteria 3970
257 Ga0207674_10000189 3300026116 Bacteria 75437
258 Ga0207674_10004902 3300026116 Bacteria 16014
259 Ga0207698_10003400 3300026142 Bacteria 9579
260 Ga0207698_10005403 3300026142 Bacteria 7891
261 Ga0207698_10007313 3300026142 Bacteria 6921
262 Ga0268266_10000004 3300028379 Bacteria 1495817
263 Ga0268264_10817659 3300028381 Bacteria 932
264 Ga0395899_0000460 3300037312 Bacteria 46114
265 Ga0395899_0022626 3300037312 Bacteria 4762
266 Ga0395899_0088479 3300037312 Bacteria 2246
267 Ga0395899_0091323 3300037312 Bacteria 2206
268 Ga0395899_0099907 3300037312 Bacteria 2095
269 Ga0395899_0149494 3300037312 Bacteria 1656
270 Ga0395899_0326295 3300037312 Bacteria 1032
271 Ga0395900_0000061 3300037418 Bacteria 202483
272 Ga0395900_0015038 3300037418 Bacteria 7888
273 Ga0395900_0031633 3300037418 Bacteria 5439
274 Ga0395900_0088812 3300037418 Bacteria 3177
275 Ga0395900_0126578 3300037418 Bacteria 2620
276 Ga0395898_0000034 3300037466 Bacteria 356745
277 Ga0395898_0000363 3300037466 Bacteria 99698
278 Ga0395898_0006801 3300037466 Bacteria 12164
279 Ga0395898_0037712 3300037466 Bacteria 4792
280 Ga0395898_0079666 3300037466 Bacteria 3159
281 Ga0395898_0114226 3300037466 Bacteria 2587
282 Ga0395898_0672468 3300037466 Bacteria 977
283 Ga0395905_0059178 3300037471 Bacteria 3582
284 Ga0395901_0004073 3300038443 Bacteria 14727
285 Ga0395901_0037502 3300038443 Bacteria 5012
286 Ga0395901_0078081 3300038443 Bacteria 3456
287 Ga0395901_0104821 3300038443 Bacteria 2967
288 Ga0395901_0128419 3300038443 Bacteria 2664
289 Ga0395901_0191530 3300038443 Bacteria 2144
290 Ga0439465_0021872 3300041413 Bacteria 2007
291 Ga0451806_178404 3300041462 Bacteria 1134
292 Ga0451837_1727708 3300041494 Bacteria 1028
293 Ga0450908_002267 3300042184 Bacteria 3757
294 Ga0439459_0000759 3300042438 Bacteria 4437
295 Ga0466969_0002903 3300044656 Bacteria 9147
296 Ga0466969_0003488 3300044656 Bacteria 8359
297 Ga0466969_0044122 3300044656 Bacteria 2219
298 Ga0466972_0150147 3300044658 Bacteria 1095
299 Ga0466975_0110345 3300044661 Bacteria 1952
300 Ga0466982_0000010 3300044672 Bacteria 188341
301 Ga0466965_0063692 3300044683 Bacteria 1845
302 Ga0466966_0000831 3300044684 Bacteria 19700
303 Ga0466966_0007518 3300044684 Bacteria 7217
304 Ga0466961_0006853 3300044693 Bacteria 7247
305 Ga0466961_0020014 3300044693 Bacteria 4305
306 Ga0466961_0050159 3300044693 Bacteria 2666
307 Ga0466963_0228039 3300044694 Bacteria 1305
308 Ga0466964_0017787 3300044706 Bacteria 2723
309 Ga0466971_0004686 3300044719 Bacteria 5911
310 Ga0466971_0005715 3300044719 Bacteria 5407
311 Ga0466971_0009969 3300044719 Bacteria 4150
312 Ga0466968_0002781 3300044735 Bacteria 6465
313 Ga0466970_0000464 3300044765 Bacteria 20048
314 Ga0466970_0029397 3300044765 Bacteria 2892
315 Ga0466970_0103917 3300044765 Bacteria 1548
316 Ga0466970_0163822 3300044765 Bacteria 1230
317 Ga0466957_0088782 3300044842 Bacteria 1934
318 Ga0466957_0101584 3300044842 Bacteria 1813
319 Ga0466960_0005398 3300044901 Bacteria 5062
320 Ga0466959_0001544 3300045049 Bacteria 14164
321 Ga0466959_0010715 3300045049 Bacteria 6565
322 Ga0466959_0032733 3300045049 Bacteria 3848
323 Ga0466959_0098826 3300045049 Bacteria 2090
324 Ga0466958_0008413 3300045836 Bacteria 5722
325 Ga0466958_0019881 3300045836 Bacteria 3912
326 Ga0466958_0037164 3300045836 Bacteria 2917
327 Ga0466958_0068072 3300045836 Bacteria 2176
328 Ga0466958_0092955 3300045836 Bacteria 1868
329 Ga0466967_0087903 3300045976 Bacteria 2819
330 Ga0466967_0398751 3300045976 Bacteria 1338
331 Ga0495638_0000069 3300046460 Bacteria 167503
332 Ga0495638_0000166 3300046460 Bacteria 102926
333 Ga0495638_0000516 3300046460 Bacteria 45213
334 Ga0495650_0000220 3300046471 Bacteria 119197
335 Ga0495650_0000247 3300046471 Bacteria 106616
336 Ga0495606_0000050 3300046507 Bacteria 203375
337 Ga0495632_0000167 3300046519 Bacteria 68027
338 Ga0495640_0223762 3300046533 Bacteria 1186
339 Ga0495622_0004330 3300046557 Bacteria 6608
340 Ga0495625_0040879 3300046660 Bacteria 3379
341 Ga0495649_0000374 3300046694 Bacteria 38763
342 Ga0496100_0014179 3300048903 Bacteria 4620
343 Ga0496100_0098708 3300048903 Bacteria 2008
344 Ga0496101_0068747 3300048904 Bacteria 2590
345 Ga0496101_0141435 3300048904 Bacteria 1834
346 Ga0496102_0870839 3300048905 Bacteria 823
347 Ga0496104_0448381 3300048907 Bacteria 1202
348 Ga0496113_0271119 3300048916 Bacteria 1356
349 Ga0496115_0000039 3300048918 Bacteria 124044
350 Ga0496115_0000180 3300048918 Bacteria 59336
351 Ga0496115_0017146 3300048918 Bacteria 5528
352 Ga0496115_0066540 3300048918 Bacteria 2912
353 Ga0496116_0121498 3300048919 Bacteria 1510
354 Ga0496117_0000728 3300048920 Bacteria 51699
355 Ga0496117_0003376 3300048920 Bacteria 18603
356 Ga0496117_0085563 3300048920 Bacteria 2052
357 Ga0496117_0231639 3300048920 Bacteria 1020
358 Ga0496118_0027444 3300048921 Bacteria 4817
359 Ga0496118_0045586 3300048921 Bacteria 3420
360 Ga0496118_0057559 3300048921 Bacteria 2912
361 Ga0496119_0006350 3300048922 Bacteria 10995
362 Ga0496119_0013713 3300048922 Bacteria 6424
363 Ga0496119_0026499 3300048922 Bacteria 4017
364 Ga0496120_0001056 3300048923 Bacteria 36468
365 Ga0496120_0001816 3300048923 Bacteria 23877
366 Ga0496120_0006314 3300048923 Bacteria 9126
367 Ga0496121_0000044 3300048924 Bacteria 337672
368 Ga0496121_0001970 3300048924 Bacteria 32682
369 Ga0496121_0043422 3300048924 Bacteria 3893
370 Ga0496121_0065227 3300048924 Bacteria 2964
371 Ga0496121_0226483 3300048924 Bacteria 1312
372 Ga0496121_0269408 3300048924 Bacteria 1171
373 Ga0496122_0037231 3300048925 Bacteria 3920
374 Ga0496122_0187418 3300048925 Bacteria 1225
375 Ga0496123_0002456 3300048926 Bacteria 22971
376 Ga0496123_0044691 3300048926 Bacteria 3026
377 Ga0496123_0156720 3300048926 Bacteria 1220
378 Ga0496124_0000565 3300048927 Bacteria 62666
379 Ga0496125_0005731 3300048928 Bacteria 13670
380 Ga0496126_0002266 3300048929 Bacteria 26518
381 Ga0496126_0016675 3300048929 Bacteria 7341
382 Ga0496126_0017383 3300048929 Bacteria 7166
383 Ga0496126_0021541 3300048929 Bacteria 6294
384 Ga0496126_0038069 3300048929 Bacteria 4478
385 Ga0496126_0044389 3300048929 Bacteria 4093
386 Ga0495678_108329 3300049459 Bacteria 951
387 Ga0501033_0006904 3300049570 Bacteria 8864
388 Ga0501033_0052081 3300049570 Bacteria 3033
389 Ga0501037_0019629 3300049573 Bacteria 4987
390 Ga0501037_0184016 3300049573 Bacteria 1481
391 Ga0501038_0016996 3300049574 Bacteria 6583
392 Ga0501038_0089587 3300049574 Bacteria 2580
393 Ga0501042_0258788 3300049578 Bacteria 1256
394 Ga0501043_0023963 3300049579 Bacteria 4788
395 Ga0501047_0114059 3300049581 Bacteria 2584
396 Ga0501048_0104950 3300049582 Bacteria 1994
397 Ga0501069_0000978 3300049585 Bacteria 13605
398 Ga0501069_0015541 3300049585 Bacteria 4081
399 Ga0501069_0030889 3300049585 Bacteria 2944
400 Ga0501069_0077952 3300049585 Bacteria 1863
401 Ga0501070_0000105 3300049586 Bacteria 73931
402 Ga0501070_0006054 3300049586 Bacteria 10303
403 Ga0501070_0028894 3300049586 Bacteria 4648
404 Ga0501070_0034619 3300049586 Bacteria 4221
405 Ga0501070_0058783 3300049586 Bacteria 3187
406 Ga0501070_0133092 3300049586 Bacteria 2053
407 Ga0501070_0257252 3300049586 Bacteria 1427
408 Ga0501070_0375231 3300049586 Bacteria 1152
409 Ga0501071_0002675 3300049587 Bacteria 10908
410 Ga0501073_0004459 3300049589 Bacteria 10517
411 Ga0501073_0281103 3300049589 Bacteria 1148
412 Ga0501074_0026207 3300049590 Bacteria 4227
413 Ga0501074_0031600 3300049590 Bacteria 3835
414 Ga0501074_0035294 3300049590 Bacteria 3622
415 Ga0501077_0017076 3300049593 Bacteria 4578
416 Ga0501080_0010712 3300049742 Bacteria 8388
417 Ga0501080_0039710 3300049742 Bacteria 4392
418 Ga0501080_0049109 3300049742 Bacteria 3927
419 Ga0501035_0001421 3300049822 Bacteria 24513
420 Ga0501035_0074613 3300049822 Bacteria 3000
421 Ga0501035_0224630 3300049822 Bacteria 1602
422 Ga0501035_0259342 3300049822 Bacteria 1474
423 Ga0501035_0320458 3300049822 Bacteria 1302
424 Ga0501044_0018697 3300049823 Bacteria 7422
425 Ga0501044_0049400 3300049823 Bacteria 4343
426 Ga0501044_0081795 3300049823 Bacteria 3268
427 Ga0501044_0214245 3300049823 Bacteria 1879
428 Ga0501044_0268699 3300049823 Bacteria 1642
429 Ga0466962_0007332 3300061719 Bacteria 5293
430 Ga0466962_0026492 3300061719 Bacteria 2783
431 Ga0466962_0038214 3300061719 Bacteria 2298
432 2895515592 2895511927 Bacteria 6802080
433 2739730942 2739367700 Bacteria 4747630
434 2842917514 2842914999 Bacteria 4419378
435 2884412391 2884411467 Bacteria 5246714
436 2895503748 2895498888 Bacteria 5283788
437 2895524785 2895522137 Bacteria 3284416
438 2895528349 2895525241 Bacteria 3388457
439 2928963992 2928963466 Bacteria 5165703
440 2941471808 2941471342 Bacteria 5018624
441 JGI24736J21556_1024647
442 JGI24741J21665_1000887
443 JGI24740J21852_10000673
444 JGI24740J21852_10003467
445 JGI24739J22299_10000542
446 JGI24735J21928_10003069
447 JGI25156J39149_1008631
448 JGI25162J39368_1000018
449 JGI25162J39368_1001950
450 JGI25157J39369_1000340
451 JGI25157J39369_1000780
452 JGI25164J39214_1000007
453 JGI25165J46597_1000029
454 rootH2_10006354
455 rootH2_10177764
456 rootL2_10006504
457 Ga0055538_1000761
458 Ga0055539_1001041
459 Ga0055533_1000992
460 Ga0055533_1001365
461 Ga0055525_1000211
462 Ga0055527_1000257
463 Ga0055527_1000263
464 Ga0055535_1000103
465 Ga0055535_1000541
466 Ga0055535_1000731
467 Ga0055542_1000024
468 Ga0055542_1000222
469 Ga0055542_1000476
470 Ga0055542_1000567
471 Ga0055542_1000578
472 Ga0055529_1000029
473 Ga0055529_1000538
474 Ga0055529_1000850
475 Ga0065165_1007335
476 Ga0065704_10070807
477 Ga0070658_10397119
478 Ga0070683_100043617
479 Ga0070670_100053529
480 Ga0070680_100012331
481 Ga0070680_100015271
482 Ga0070680_100031356
483 Ga0070680_100070111
484 Ga0070682_100003230
485 Ga0070682_100131150
486 Ga0070689_100003678
487 Ga0070691_10004725
488 Ga0070691_10005695
489 Ga0070661_100002257
490 Ga0070661_100267736
491 Ga0070692_10011783
492 Ga0070659_100178386
493 Ga0070667_100075442
494 Ga0070709_10243512
495 Ga0070714_100164768
496 Ga0070663_100002458
497 Ga0070663_100018215
498 Ga0070663_100051769
499 Ga0070663_100065757
500 Ga0070663_100142071
501 Ga0070662_100009906
502 Ga0070681_10000211
503 Ga0070681_10003200
504 Ga0070681_10019847
505 Ga0070681_10034898
506 Ga0070679_100010547
507 Ga0070679_100018626
508 Ga0070679_100018670
509 Ga0068853_100544279
510 Ga0070696_100001397
511 Ga0070693_100063100
512 Ga0070665_100009525
513 Ga0068855_100008640
514 Ga0068855_100019983
515 Ga0068855_100291676
516 Ga0070664_100080120
517 Ga0068857_100001031
518 Ga0068857_100042088
519 Ga0068854_100000593
520 Ga0068854_100007279
521 Ga0068854_100022711
522 Ga0068854_100026288
523 Ga0068856_100003150
524 Ga0068852_100049936
525 Ga0068852_100058741
526 Ga0068851_10002366
527 Ga0068851_10008310
528 Ga0068851_10031287
529 Ga0068862_100600352
530 Ga0105240_10000127
531 Ga0105240_10001888
532 Ga0105240_10030204
533 Ga0105240_10048100
534 Ga0105240_10055264
535 Ga0105240_10058931
536 Ga0105240_10075408
537 Ga0105240_10212099
538 Ga0105237_10000565
539 Ga0105237_10145675
540 Ga0105237_10186534
541 Ga0105238_10000783
542 Ga0105238_10025069
543 Ga0105239_10000933
544 Ga0157314_1000360
545 Ga0157373_10018022
546 Ga0157373_10028431
547 Ga0157373_10414168
548 Ga0157371_10058156
549 Ga0157371_10159225
550 Ga0157371_10343996
551 Ga0157370_10004805
552 Ga0157370_10009321
553 Ga0157370_10116302
554 Ga0157369_10002023
555 Ga0157369_10037349
556 Ga0163162_10000281
557 Ga0163162_10119494
558 Ga0157372_10005727
559 Ga0157372_10014832
560 Ga0157372_10076403
561 Ga0157372_10144648
562 Ga0157372_10373426
563 Ga0182008_10087571
564 Ga0157376_10153556
565 Ga0182007_10035309
566 Ga0183368_1004
567 Ga0163161_10086827
568 Ga0206356_11202932
569 Ga0206356_11530043
570 Ga0206354_10238400
571 Ga0206354_11202544
572 Ga0206353_10283238
573 Ga0206353_10976575
574 Ga0154015_1104391
575 Ga0154015_1256927
576 Ga0209760_100235
577 Ga0209784_100026
578 Ga0209566_104425
579 Ga0209566_110539
580 Ga0209674_100016
581 Ga0209674_100108
582 Ga0209672_100007
583 Ga0209672_100009
584 Ga0209672_100176
585 Ga0209672_100268
586 Ga0209563_100079
587 Ga0207427_100023
588 Ga0207427_101563
589 Ga0209437_100069
590 Ga0209437_100252
591 Ga0209258_100011
592 Ga0209258_100046
593 Ga0209258_100059
594 Ga0209258_100511
595 Ga0209258_101642
596 Ga0209646_1000577
597 Ga0209026_1000036
598 Ga0209026_1000194
599 Ga0209026_1001141
600 Ga0209677_103689
601 Ga0209148_1000002
602 Ga0209148_1000010
603 Ga0209148_1000013
604 Ga0209148_1000084
605 Ga0209148_1000533
606 Ga0209759_1000300
607 Ga0209759_1000901
608 Ga0209759_1002666
609 Ga0209129_1005749
610 Ga0209233_1000009
611 Ga0209455_1000010
612 Ga0209455_1000012
613 Ga0209455_1000020
614 Ga0209758_1000289
615 Ga0209051_1002103
616 Ga0207656_10001718
617 Ga0207656_10020249
618 Ga0207656_10043552
619 Ga0207680_10000005
620 Ga0207647_10000150
621 Ga0207647_10002791
622 Ga0207647_10005413
623 Ga0207647_10006362
624 Ga0207705_10000353
625 Ga0207705_10000355
626 Ga0207705_10004364
627 Ga0207705_10016812
628 Ga0207705_10034831
629 Ga0207654_10121625
630 Ga0207707_10000308
631 Ga0207707_10000630
632 Ga0207707_10000644
633 Ga0207707_10000699
634 Ga0207707_10007899
635 Ga0207707_10009345
636 Ga0207707_10031697
637 Ga0207695_10000349
638 Ga0207695_10000975
639 Ga0207695_10006439
640 Ga0207695_10019320
641 Ga0207695_10021742
642 Ga0207695_10032821
643 Ga0207695_10232201
644 Ga0207695_10427582
645 Ga0207671_10000059
646 Ga0207671_10055961
647 Ga0207660_10000244
648 Ga0207660_10000570
649 Ga0207660_10005110
650 Ga0207660_10005371
651 Ga0207660_10021767
652 Ga0207660_10057190
653 Ga0207657_10003793
654 Ga0207657_10005053
655 Ga0207649_10006739
656 Ga0207649_10010374
657 Ga0207649_10021545
658 Ga0207652_10000030
659 Ga0207652_10000719
660 Ga0207652_10000940
661 Ga0207652_10001717
662 Ga0207652_10012507
663 Ga0207694_10000916
664 Ga0207650_10038487
665 Ga0207690_10000799
666 Ga0207690_10006154
667 Ga0207690_10086659
668 Ga0207706_10012181
669 Ga0207670_10002344
670 Ga0207661_10001956
671 Ga0207661_10141128
672 Ga0207661_10492249
673 Ga0207679_10026647
674 Ga0207667_10000031
675 Ga0207667_10000383
676 Ga0207667_10000679
677 Ga0207667_10018339
678 Ga0207667_10031340
679 Ga0207640_10000082
680 Ga0207640_10003658
681 Ga0207640_10008036
682 Ga0207640_10039098
683 Ga0207640_10258651
684 Ga0207639_10003825
685 Ga0207639_10007936
686 Ga0207639_10043878
687 Ga0207639_10517142
688 Ga0207678_10002717
689 Ga0207678_10016436
690 Ga0207678_10017192
691 Ga0207678_10018140
692 Ga0207678_10041906
693 Ga0207702_10004220
694 Ga0207702_10005766
695 Ga0207702_10035244
696 Ga0207702_10039170
697 Ga0207674_10000189
698 Ga0207674_10004902
699 Ga0207698_10003400
700 Ga0207698_10005403
701 Ga0207698_10007313
702 Ga0268266_10000004
703 Ga0268264_10817659
704 Ga0395899_0000460
705 Ga0395899_0022626
706 Ga0395899_0088479
707 Ga0395899_0091323
708 Ga0395899_0099907
709 Ga0395899_0149494
710 Ga0395899_0326295
711 Ga0395900_0000061
712 Ga0395900_0015038
713 Ga0395900_0031633
714 Ga0395900_0088812
715 Ga0395900_0126578
716 Ga0395898_0000034
717 Ga0395898_0000363
718 Ga0395898_0006801
719 Ga0395898_0037712
720 Ga0395898_0079666
721 Ga0395898_0114226
722 Ga0395898_0672468
723 Ga0395905_0059178
724 Ga0395901_0004073
725 Ga0395901_0037502
726 Ga0395901_0078081
727 Ga0395901_0104821
728 Ga0395901_0128419
729 Ga0395901_0191530
730 Ga0439465_0021872
731 Ga0451806_178404
732 Ga0451837_1727708
733 Ga0450908_002267
734 Ga0439459_0000759
735 Ga0466969_0002903
736 Ga0466969_0003488
737 Ga0466969_0044122
738 Ga0466972_0150147
739 Ga0466975_0110345
740 Ga0466982_0000010
741 Ga0466965_0063692
742 Ga0466966_0000831
743 Ga0466966_0007518
744 Ga0466961_0006853
745 Ga0466961_0020014
746 Ga0466961_0050159
747 Ga0466963_0228039
748 Ga0466964_0017787
749 Ga0466971_0004686
750 Ga0466971_0005715
751 Ga0466971_0009969
752 Ga0466968_0002781
753 Ga0466970_0000464
754 Ga0466970_0029397
755 Ga0466970_0103917
756 Ga0466970_0163822
757 Ga0466957_0088782
758 Ga0466957_0101584
759 Ga0466960_0005398
760 Ga0466959_0001544
761 Ga0466959_0010715
762 Ga0466959_0032733
763 Ga0466959_0098826
764 Ga0466958_0008413
765 Ga0466958_0019881
766 Ga0466958_0037164
767 Ga0466958_0068072
768 Ga0466958_0092955
769 Ga0466967_0087903
770 Ga0466967_0398751
771 Ga0495638_0000069
772 Ga0495638_0000166
773 Ga0495638_0000516
774 Ga0495650_0000220
775 Ga0495650_0000247
776 Ga0495606_0000050
777 Ga0495632_0000167
778 Ga0495640_0223762
779 Ga0495622_0004330
780 Ga0495625_0040879
781 Ga0495649_0000374
782 Ga0496100_0014179
783 Ga0496100_0098708
784 Ga0496101_0068747
785 Ga0496101_0141435
786 Ga0496102_0870839
787 Ga0496104_0448381
788 Ga0496113_0271119
789 Ga0496115_0000039
790 Ga0496115_0000180
791 Ga0496115_0017146
792 Ga0496115_0066540
793 Ga0496116_0121498
794 Ga0496117_0000728
795 Ga0496117_0003376
796 Ga0496117_0085563
797 Ga0496117_0231639
798 Ga0496118_0027444
799 Ga0496118_0045586
800 Ga0496118_0057559
801 Ga0496119_0006350
802 Ga0496119_0013713
803 Ga0496119_0026499
804 Ga0496120_0001056
805 Ga0496120_0001816
806 Ga0496120_0006314
807 Ga0496121_0000044
808 Ga0496121_0001970
809 Ga0496121_0043422
810 Ga0496121_0065227
811 Ga0496121_0226483
812 Ga0496121_0269408
813 Ga0496122_0037231
814 Ga0496122_0187418
815 Ga0496123_0002456
816 Ga0496123_0044691
817 Ga0496123_0156720
818 Ga0496124_0000565
819 Ga0496125_0005731
820 Ga0496126_0002266
821 Ga0496126_0016675
822 Ga0496126_0017383
823 Ga0496126_0021541
824 Ga0496126_0038069
825 Ga0496126_0044389
826 Ga0495678_108329
827 Ga0501033_0006904
828 Ga0501033_0052081
829 Ga0501037_0019629
830 Ga0501037_0184016
831 Ga0501038_0016996
832 Ga0501038_0089587
833 Ga0501042_0258788
834 Ga0501043_0023963
835 Ga0501047_0114059
836 Ga0501048_0104950
837 Ga0501069_0000978
838 Ga0501069_0015541
839 Ga0501069_0030889
840 Ga0501069_0077952
841 Ga0501070_0000105
842 Ga0501070_0006054
843 Ga0501070_0028894
844 Ga0501070_0034619
845 Ga0501070_0058783
846 Ga0501070_0133092
847 Ga0501070_0257252
848 Ga0501070_0375231
849 Ga0501071_0002675
850 Ga0501073_0004459
851 Ga0501073_0281103
852 Ga0501074_0026207
853 Ga0501074_0031600
854 Ga0501074_0035294
855 Ga0501077_0017076
856 Ga0501080_0010712
857 Ga0501080_0039710
858 Ga0501080_0049109
859 Ga0501035_0001421
860 Ga0501035_0074613
861 Ga0501035_0224630
862 Ga0501035_0259342
863 Ga0501035_0320458
864 Ga0501044_0018697
865 Ga0501044_0049400
866 Ga0501044_0081795
867 Ga0501044_0214245
868 Ga0501044_0268699
869 Ga0466962_0007332
870 Ga0466962_0026492
871 Ga0466962_0038214
872 2895515592
873 2739730942
874 2842917514
875 2884412391
876 2895503748
877 2895524785
878 2895528349
879 2928963992
880 2941471808

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03588

Leu_Phe_trans

Leucyl/phenylalanyl-tRNA protein transferase

32

204

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dps-assembly1.cif.gz_A structure of leucyl/phenylalanyl-trna-protein transferase 0.9565 4 224
2z3o-assembly1.cif.gz_A complex structure of lf-transferase and phenylalanine 0.9507 3 223
2z3l-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.949 3 224
2cxa-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9475 2 224
2z3n-assembly1.cif.gz_B complex structure of lf-transferase and peptide b 0.938 3 223
ID Description Score Start End Superfamily
2z3kA02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Leucyl/phenylalanyl-tRNA-protein transferase, C-terminal domain 0.9336 64 224 3.40.630.70
2z3lB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain 0.9174 3 63 3.30.70.3550
2dpsB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain 0.9065 2 63 3.30.70.3550
2z3lB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain 0.9034 3 63 3.30.70.3550
2dpsB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain 0.8929 2 63 3.30.70.3550
ID Description Score Start End GO Terms
AF-A0A3S0SCE4-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) 0.9823 1 224 GO:0005737
GO:0008914
GO:0030163
AF-A0A1V3QIX5-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) 0.9819 1 236 GO:0005737
GO:0008914
GO:0030163
AF-A0A1Q3V815-F1-model_v4 deleted 0.98 1 236
AF-A0A1E4HA83-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) 0.98 1 236 GO:0005737
GO:0008914
GO:0030163
AF-A0A317GY25-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase 0.9793 100 228 GO:0005737
GO:0008914
GO:0030163

Map