F444553
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 440 | 197 | 880 | 243 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2895511927|2895515592 |
| Length | 239 |
| Sequence | PRLLGPDDPFPPVDQALREPDGLLAIGGDLSPERLLAAYAQGIFPWYSEGQPILWWSPDPRMVFRTDGVRLSTRFRRQLRHSAWQVRADTAFDAVLAACAETPRRGHDGTWILPEMRAAYARLHRLGHAHSIEVVDAGGRLVGGLYGVAVGRMFYGESMFSACSGGSKVALAALAHRLCGWGWPLLDAQVENPHLVSLGGERWPRPRFQAELSRLTALPGMVGSWTTAFGLLPASALAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 57 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 64 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 67 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 72 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 82 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 83 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 86 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 120 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 121 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 122 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 123 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 124 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 125 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 126 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 127 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 128 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 129 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 130 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 131 | 3300044661 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E | Metagenome | Unclassified |
| 132 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 133 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 134 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 135 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 136 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 137 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 138 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 139 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 140 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 141 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 142 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 143 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 144 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 145 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 146 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 157 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 158 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 159 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 160 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 161 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 162 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 163 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 164 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 165 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 166 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 167 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 168 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 169 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 170 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 171 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 189 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 190 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 191 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 192 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 193 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 194 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 195 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 196 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 197 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.14 |
| Metatranscriptomes | 1.82 |
| Isolates | 2.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.73 |
| Nodule | 0 |
| Rhizoplane | 2.73 |
| Rhizosphere | 72.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1024647 | 3300001904 | Bacteria | 937 |
| 2 | JGI24741J21665_1000887 | 3300001915 | Bacteria | 9016 |
| 3 | JGI24740J21852_10000673 | 3300001979 | Bacteria | 14819 |
| 4 | JGI24740J21852_10003467 | 3300001979 | Bacteria | 6929 |
| 5 | JGI24739J22299_10000542 | 3300001989 | Bacteria | 13462 |
| 6 | JGI24735J21928_10003069 | 3300002067 | Bacteria | 5728 |
| 7 | JGI25156J39149_1008631 | 3300002705 | Bacteria | 2546 |
| 8 | JGI25162J39368_1000018 | 3300002737 | Bacteria | 277875 |
| 9 | JGI25162J39368_1001950 | 3300002737 | Bacteria | 9293 |
| 10 | JGI25157J39369_1000340 | 3300002741 | Bacteria | 33129 |
| 11 | JGI25157J39369_1000780 | 3300002741 | Bacteria | 16346 |
| 12 | JGI25164J39214_1000007 | 3300002772 | Bacteria | 312507 |
| 13 | JGI25165J46597_1000029 | 3300003214 | Bacteria | 312507 |
| 14 | rootH2_10006354 | 3300003320 | Bacteria | 8276 |
| 15 | rootH2_10177764 | 3300003320 | Bacteria | 1365 |
| 16 | rootL2_10006504 | 3300003322 | Bacteria | 2920 |
| 17 | Ga0055538_1000761 | 3300003751 | Bacteria | 9174 |
| 18 | Ga0055539_1001041 | 3300003752 | Bacteria | 5930 |
| 19 | Ga0055533_1000992 | 3300003756 | Bacteria | 8264 |
| 20 | Ga0055533_1001365 | 3300003756 | Bacteria | 6534 |
| 21 | Ga0055525_1000211 | 3300003759 | Bacteria | 65308 |
| 22 | Ga0055527_1000257 | 3300003760 | Bacteria | 32518 |
| 23 | Ga0055527_1000263 | 3300003760 | Bacteria | 31815 |
| 24 | Ga0055535_1000103 | 3300003761 | Bacteria | 91199 |
| 25 | Ga0055535_1000541 | 3300003761 | Bacteria | 32518 |
| 26 | Ga0055535_1000731 | 3300003761 | Bacteria | 24696 |
| 27 | Ga0055542_1000024 | 3300003762 | Bacteria | 277875 |
| 28 | Ga0055542_1000222 | 3300003762 | Bacteria | 68762 |
| 29 | Ga0055542_1000476 | 3300003762 | Bacteria | 37344 |
| 30 | Ga0055542_1000567 | 3300003762 | Bacteria | 32518 |
| 31 | Ga0055542_1000578 | 3300003762 | Bacteria | 31815 |
| 32 | Ga0055529_1000029 | 3300003763 | Bacteria | 277978 |
| 33 | Ga0055529_1000538 | 3300003763 | Bacteria | 32518 |
| 34 | Ga0055529_1000850 | 3300003763 | Bacteria | 17724 |
| 35 | Ga0065165_1007335 | 3300005262 | Bacteria | 5459 |
| 36 | Ga0065704_10070807 | 3300005289 | Bacteria | 15869 |
| 37 | Ga0070658_10397119 | 3300005327 | Bacteria | 1184 |
| 38 | Ga0070683_100043617 | 3300005329 | Bacteria | 4134 |
| 39 | Ga0070670_100053529 | 3300005331 | Bacteria | 3466 |
| 40 | Ga0070680_100012331 | 3300005336 | Bacteria | 6638 |
| 41 | Ga0070680_100015271 | 3300005336 | Bacteria | 6018 |
| 42 | Ga0070680_100031356 | 3300005336 | Bacteria | 4273 |
| 43 | Ga0070680_100070111 | 3300005336 | Bacteria | 2879 |
| 44 | Ga0070682_100003230 | 3300005337 | Bacteria | 9038 |
| 45 | Ga0070682_100131150 | 3300005337 | Bacteria | 1696 |
| 46 | Ga0070689_100003678 | 3300005340 | Bacteria | 10239 |
| 47 | Ga0070691_10004725 | 3300005341 | Bacteria | 6199 |
| 48 | Ga0070691_10005695 | 3300005341 | Bacteria | 5682 |
| 49 | Ga0070661_100002257 | 3300005344 | Bacteria | 13217 |
| 50 | Ga0070661_100267736 | 3300005344 | Bacteria | 1322 |
| 51 | Ga0070692_10011783 | 3300005345 | Bacteria | 4027 |
| 52 | Ga0070659_100178386 | 3300005366 | Bacteria | 1742 |
| 53 | Ga0070667_100075442 | 3300005367 | Bacteria | 2879 |
| 54 | Ga0070709_10243512 | 3300005434 | Bacteria | 1292 |
| 55 | Ga0070714_100164768 | 3300005435 | Bacteria | 2008 |
| 56 | Ga0070663_100002458 | 3300005455 | Bacteria | 10440 |
| 57 | Ga0070663_100018215 | 3300005455 | Bacteria | 4598 |
| 58 | Ga0070663_100051769 | 3300005455 | Bacteria | 2927 |
| 59 | Ga0070663_100065757 | 3300005455 | Bacteria | 2625 |
| 60 | Ga0070663_100142071 | 3300005455 | Bacteria | 1834 |
| 61 | Ga0070662_100009906 | 3300005457 | Bacteria | 6243 |
| 62 | Ga0070681_10000211 | 3300005458 | Bacteria | 45377 |
| 63 | Ga0070681_10003200 | 3300005458 | Bacteria | 15251 |
| 64 | Ga0070681_10019847 | 3300005458 | Bacteria | 6732 |
| 65 | Ga0070681_10034898 | 3300005458 | Bacteria | 5052 |
| 66 | Ga0070679_100010547 | 3300005530 | Bacteria | 8766 |
| 67 | Ga0070679_100018626 | 3300005530 | Bacteria | 6740 |
| 68 | Ga0070679_100018670 | 3300005530 | Bacteria | 6732 |
| 69 | Ga0068853_100544279 | 3300005539 | Bacteria | 1099 |
| 70 | Ga0070696_100001397 | 3300005546 | Bacteria | 15784 |
| 71 | Ga0070693_100063100 | 3300005547 | Bacteria | 2158 |
| 72 | Ga0070665_100009525 | 3300005548 | Bacteria | 9825 |
| 73 | Ga0068855_100008640 | 3300005563 | Bacteria | 12308 |
| 74 | Ga0068855_100019983 | 3300005563 | Bacteria | 8044 |
| 75 | Ga0068855_100291676 | 3300005563 | Bacteria | 1808 |
| 76 | Ga0070664_100080120 | 3300005564 | Bacteria | 2812 |
| 77 | Ga0068857_100001031 | 3300005577 | Bacteria | 21511 |
| 78 | Ga0068857_100042088 | 3300005577 | Bacteria | 4051 |
| 79 | Ga0068854_100000593 | 3300005578 | Bacteria | 21529 |
| 80 | Ga0068854_100007279 | 3300005578 | Bacteria | 7069 |
| 81 | Ga0068854_100022711 | 3300005578 | Bacteria | 4280 |
| 82 | Ga0068854_100026288 | 3300005578 | Bacteria | 3999 |
| 83 | Ga0068856_100003150 | 3300005614 | Bacteria | 16818 |
| 84 | Ga0068852_100049936 | 3300005616 | Bacteria | 3581 |
| 85 | Ga0068852_100058741 | 3300005616 | Bacteria | 3333 |
| 86 | Ga0068851_10002366 | 3300005834 | Bacteria | 8290 |
| 87 | Ga0068851_10008310 | 3300005834 | Bacteria | 4797 |
| 88 | Ga0068851_10031287 | 3300005834 | Bacteria | 2642 |
| 89 | Ga0068862_100600352 | 3300005844 | Bacteria | 1057 |
| 90 | Ga0105240_10000127 | 3300009093 | Bacteria | 156461 |
| 91 | Ga0105240_10001888 | 3300009093 | Bacteria | 34840 |
| 92 | Ga0105240_10030204 | 3300009093 | Bacteria | 7047 |
| 93 | Ga0105240_10048100 | 3300009093 | Bacteria | 5392 |
| 94 | Ga0105240_10055264 | 3300009093 | Bacteria | 4971 |
| 95 | Ga0105240_10058931 | 3300009093 | Bacteria | 4793 |
| 96 | Ga0105240_10075408 | 3300009093 | Bacteria | 4160 |
| 97 | Ga0105240_10212099 | 3300009093 | Bacteria | 2262 |
| 98 | Ga0105237_10000565 | 3300009545 | Bacteria | 51782 |
| 99 | Ga0105237_10145675 | 3300009545 | Bacteria | 2363 |
| 100 | Ga0105237_10186534 | 3300009545 | Bacteria | 2074 |
| 101 | Ga0105238_10000783 | 3300009551 | Bacteria | 33020 |
| 102 | Ga0105238_10025069 | 3300009551 | Bacteria | 6080 |
| 103 | Ga0105239_10000933 | 3300010375 | Bacteria | 41307 |
| 104 | Ga0157314_1000360 | 3300012500 | Bacteria | 4696 |
| 105 | Ga0157373_10018022 | 3300013100 | Bacteria | 5142 |
| 106 | Ga0157373_10028431 | 3300013100 | Bacteria | 4033 |
| 107 | Ga0157373_10414168 | 3300013100 | Bacteria | 967 |
| 108 | Ga0157371_10058156 | 3300013102 | Bacteria | 2743 |
| 109 | Ga0157371_10159225 | 3300013102 | Bacteria | 1612 |
| 110 | Ga0157371_10343996 | 3300013102 | Bacteria | 1085 |
| 111 | Ga0157370_10004805 | 3300013104 | Bacteria | 15363 |
| 112 | Ga0157370_10009321 | 3300013104 | Bacteria | 10509 |
| 113 | Ga0157370_10116302 | 3300013104 | Bacteria | 2498 |
| 114 | Ga0157369_10002023 | 3300013105 | Bacteria | 24459 |
| 115 | Ga0157369_10037349 | 3300013105 | Bacteria | 5318 |
| 116 | Ga0163162_10000281 | 3300013306 | Bacteria | 46556 |
| 117 | Ga0163162_10119494 | 3300013306 | Bacteria | 2738 |
| 118 | Ga0157372_10005727 | 3300013307 | Bacteria | 13233 |
| 119 | Ga0157372_10014832 | 3300013307 | Bacteria | 8343 |
| 120 | Ga0157372_10076403 | 3300013307 | Bacteria | 3781 |
| 121 | Ga0157372_10144648 | 3300013307 | Bacteria | 2742 |
| 122 | Ga0157372_10373426 | 3300013307 | Bacteria | 1662 |
| 123 | Ga0182008_10087571 | 3300014497 | Bacteria | 1534 |
| 124 | Ga0157376_10153556 | 3300014969 | Bacteria | 2079 |
| 125 | Ga0182007_10035309 | 3300015262 | Bacteria | 1685 |
| 126 | Ga0183368_1004 | 3300015687 | Bacteria | 1211761 |
| 127 | Ga0163161_10086827 | 3300017792 | Bacteria | 2310 |
| 128 | Ga0206356_11202932 | 3300020070 | Bacteria | 1789 |
| 129 | Ga0206356_11530043 | 3300020070 | Bacteria | 3206 |
| 130 | Ga0206354_10238400 | 3300020081 | Bacteria | 2676 |
| 131 | Ga0206354_11202544 | 3300020081 | Bacteria | 1902 |
| 132 | Ga0206353_10283238 | 3300020082 | Bacteria | 1109 |
| 133 | Ga0206353_10976575 | 3300020082 | Bacteria | 6925 |
| 134 | Ga0154015_1104391 | 3300020610 | Bacteria | 9283 |
| 135 | Ga0154015_1256927 | 3300020610 | Bacteria | 4208 |
| 136 | Ga0209760_100235 | 3300025207 | Bacteria | 23322 |
| 137 | Ga0209784_100026 | 3300025224 | Bacteria | 371540 |
| 138 | Ga0209566_104425 | 3300025225 | Bacteria | 1922 |
| 139 | Ga0209566_110539 | 3300025225 | Bacteria | 930 |
| 140 | Ga0209674_100016 | 3300025226 | Bacteria | 696756 |
| 141 | Ga0209674_100108 | 3300025226 | Bacteria | 150893 |
| 142 | Ga0209672_100007 | 3300025228 | Bacteria | 959482 |
| 143 | Ga0209672_100009 | 3300025228 | Bacteria | 883623 |
| 144 | Ga0209672_100176 | 3300025228 | Bacteria | 53116 |
| 145 | Ga0209672_100268 | 3300025228 | Bacteria | 38409 |
| 146 | Ga0209563_100079 | 3300025230 | Bacteria | 203017 |
| 147 | Ga0207427_100023 | 3300025231 | Bacteria | 439725 |
| 148 | Ga0207427_101563 | 3300025231 | Bacteria | 7926 |
| 149 | Ga0209437_100069 | 3300025233 | Bacteria | 307733 |
| 150 | Ga0209437_100252 | 3300025233 | Bacteria | 84185 |
| 151 | Ga0209258_100011 | 3300025242 | Bacteria | 867542 |
| 152 | Ga0209258_100046 | 3300025242 | Bacteria | 369794 |
| 153 | Ga0209258_100059 | 3300025242 | Bacteria | 324934 |
| 154 | Ga0209258_100511 | 3300025242 | Bacteria | 37397 |
| 155 | Ga0209258_101642 | 3300025242 | Bacteria | 7208 |
| 156 | Ga0209646_1000577 | 3300025246 | Bacteria | 15267 |
| 157 | Ga0209026_1000036 | 3300025250 | Bacteria | 296607 |
| 158 | Ga0209026_1000194 | 3300025250 | Bacteria | 85950 |
| 159 | Ga0209026_1001141 | 3300025250 | Bacteria | 12494 |
| 160 | Ga0209677_103689 | 3300025253 | Bacteria | 4810 |
| 161 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 162 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 163 | Ga0209148_1000013 | 3300025254 | Bacteria | 956684 |
| 164 | Ga0209148_1000084 | 3300025254 | Bacteria | 268147 |
| 165 | Ga0209148_1000533 | 3300025254 | Bacteria | 37397 |
| 166 | Ga0209759_1000300 | 3300025256 | Bacteria | 68198 |
| 167 | Ga0209759_1000901 | 3300025256 | Bacteria | 22183 |
| 168 | Ga0209759_1002666 | 3300025256 | Bacteria | 7642 |
| 169 | Ga0209129_1005749 | 3300025258 | Bacteria | 4257 |
| 170 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 171 | Ga0209455_1000010 | 3300025272 | Bacteria | 959482 |
| 172 | Ga0209455_1000012 | 3300025272 | Bacteria | 867234 |
| 173 | Ga0209455_1000020 | 3300025272 | Bacteria | 702259 |
| 174 | Ga0209758_1000289 | 3300025297 | Bacteria | 98983 |
| 175 | Ga0209051_1002103 | 3300025303 | Bacteria | 14932 |
| 176 | Ga0207656_10001718 | 3300025321 | Bacteria | 7281 |
| 177 | Ga0207656_10020249 | 3300025321 | Bacteria | 2642 |
| 178 | Ga0207656_10043552 | 3300025321 | Bacteria | 1914 |
| 179 | Ga0207680_10000005 | 3300025903 | Bacteria | 660983 |
| 180 | Ga0207647_10000150 | 3300025904 | Bacteria | 55376 |
| 181 | Ga0207647_10002791 | 3300025904 | Bacteria | 13175 |
| 182 | Ga0207647_10005413 | 3300025904 | Bacteria | 9365 |
| 183 | Ga0207647_10006362 | 3300025904 | Bacteria | 8586 |
| 184 | Ga0207705_10000353 | 3300025909 | Bacteria | 41498 |
| 185 | Ga0207705_10000355 | 3300025909 | Bacteria | 41474 |
| 186 | Ga0207705_10004364 | 3300025909 | Bacteria | 10695 |
| 187 | Ga0207705_10016812 | 3300025909 | Bacteria | 5239 |
| 188 | Ga0207705_10034831 | 3300025909 | Bacteria | 3601 |
| 189 | Ga0207654_10121625 | 3300025911 | Bacteria | 1640 |
| 190 | Ga0207707_10000308 | 3300025912 | Bacteria | 51301 |
| 191 | Ga0207707_10000630 | 3300025912 | Bacteria | 34922 |
| 192 | Ga0207707_10000644 | 3300025912 | Bacteria | 34474 |
| 193 | Ga0207707_10000699 | 3300025912 | Bacteria | 33304 |
| 194 | Ga0207707_10007899 | 3300025912 | Bacteria | 9252 |
| 195 | Ga0207707_10009345 | 3300025912 | Bacteria | 8502 |
| 196 | Ga0207707_10031697 | 3300025912 | Bacteria | 4626 |
| 197 | Ga0207695_10000349 | 3300025913 | Bacteria | 106823 |
| 198 | Ga0207695_10000975 | 3300025913 | Bacteria | 50860 |
| 199 | Ga0207695_10006439 | 3300025913 | Bacteria | 15246 |
| 200 | Ga0207695_10019320 | 3300025913 | Bacteria | 7846 |
| 201 | Ga0207695_10021742 | 3300025913 | Bacteria | 7311 |
| 202 | Ga0207695_10032821 | 3300025913 | Bacteria | 5675 |
| 203 | Ga0207695_10232201 | 3300025913 | Bacteria | 1749 |
| 204 | Ga0207695_10427582 | 3300025913 | Bacteria | 1208 |
| 205 | Ga0207671_10000059 | 3300025914 | Bacteria | 179761 |
| 206 | Ga0207671_10055961 | 3300025914 | Bacteria | 2922 |
| 207 | Ga0207660_10000244 | 3300025917 | Bacteria | 35421 |
| 208 | Ga0207660_10000570 | 3300025917 | Bacteria | 24778 |
| 209 | Ga0207660_10005110 | 3300025917 | Bacteria | 8543 |
| 210 | Ga0207660_10005371 | 3300025917 | Bacteria | 8319 |
| 211 | Ga0207660_10021767 | 3300025917 | Bacteria | 4315 |
| 212 | Ga0207660_10057190 | 3300025917 | Bacteria | 2793 |
| 213 | Ga0207657_10003793 | 3300025919 | Bacteria | 16074 |
| 214 | Ga0207657_10005053 | 3300025919 | Bacteria | 13844 |
| 215 | Ga0207649_10006739 | 3300025920 | Bacteria | 6239 |
| 216 | Ga0207649_10010374 | 3300025920 | Bacteria | 5116 |
| 217 | Ga0207649_10021545 | 3300025920 | Bacteria | 3712 |
| 218 | Ga0207652_10000030 | 3300025921 | Bacteria | 144884 |
| 219 | Ga0207652_10000719 | 3300025921 | Bacteria | 32081 |
| 220 | Ga0207652_10000940 | 3300025921 | Bacteria | 27407 |
| 221 | Ga0207652_10001717 | 3300025921 | Bacteria | 19113 |
| 222 | Ga0207652_10012507 | 3300025921 | Bacteria | 6858 |
| 223 | Ga0207694_10000916 | 3300025924 | Bacteria | 26125 |
| 224 | Ga0207650_10038487 | 3300025925 | Bacteria | 3493 |
| 225 | Ga0207690_10000799 | 3300025932 | Bacteria | 20248 |
| 226 | Ga0207690_10006154 | 3300025932 | Bacteria | 7109 |
| 227 | Ga0207690_10086659 | 3300025932 | Bacteria | 2201 |
| 228 | Ga0207706_10012181 | 3300025933 | Bacteria | 7836 |
| 229 | Ga0207670_10002344 | 3300025936 | Bacteria | 9922 |
| 230 | Ga0207661_10001956 | 3300025944 | Bacteria | 14166 |
| 231 | Ga0207661_10141128 | 3300025944 | Bacteria | 2073 |
| 232 | Ga0207661_10492249 | 3300025944 | Bacteria | 1120 |
| 233 | Ga0207679_10026647 | 3300025945 | Bacteria | 3988 |
| 234 | Ga0207667_10000031 | 3300025949 | Bacteria | 323587 |
| 235 | Ga0207667_10000383 | 3300025949 | Bacteria | 59865 |
| 236 | Ga0207667_10000679 | 3300025949 | Bacteria | 44080 |
| 237 | Ga0207667_10018339 | 3300025949 | Bacteria | 7851 |
| 238 | Ga0207667_10031340 | 3300025949 | Bacteria | 5740 |
| 239 | Ga0207640_10000082 | 3300025981 | Bacteria | 74895 |
| 240 | Ga0207640_10003658 | 3300025981 | Bacteria | 8294 |
| 241 | Ga0207640_10008036 | 3300025981 | Bacteria | 5832 |
| 242 | Ga0207640_10039098 | 3300025981 | Bacteria | 3000 |
| 243 | Ga0207640_10258651 | 3300025981 | Bacteria | 1355 |
| 244 | Ga0207639_10003825 | 3300026041 | Bacteria | 10142 |
| 245 | Ga0207639_10007936 | 3300026041 | Bacteria | 7253 |
| 246 | Ga0207639_10043878 | 3300026041 | Bacteria | 3359 |
| 247 | Ga0207639_10517142 | 3300026041 | Bacteria | 1093 |
| 248 | Ga0207678_10002717 | 3300026067 | Bacteria | 16042 |
| 249 | Ga0207678_10016436 | 3300026067 | Bacteria | 6497 |
| 250 | Ga0207678_10017192 | 3300026067 | Bacteria | 6349 |
| 251 | Ga0207678_10018140 | 3300026067 | Bacteria | 6181 |
| 252 | Ga0207678_10041906 | 3300026067 | Bacteria | 3968 |
| 253 | Ga0207702_10004220 | 3300026078 | Bacteria | 12835 |
| 254 | Ga0207702_10005766 | 3300026078 | Bacteria | 10771 |
| 255 | Ga0207702_10035244 | 3300026078 | Bacteria | 4184 |
| 256 | Ga0207702_10039170 | 3300026078 | Bacteria | 3970 |
| 257 | Ga0207674_10000189 | 3300026116 | Bacteria | 75437 |
| 258 | Ga0207674_10004902 | 3300026116 | Bacteria | 16014 |
| 259 | Ga0207698_10003400 | 3300026142 | Bacteria | 9579 |
| 260 | Ga0207698_10005403 | 3300026142 | Bacteria | 7891 |
| 261 | Ga0207698_10007313 | 3300026142 | Bacteria | 6921 |
| 262 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 263 | Ga0268264_10817659 | 3300028381 | Bacteria | 932 |
| 264 | Ga0395899_0000460 | 3300037312 | Bacteria | 46114 |
| 265 | Ga0395899_0022626 | 3300037312 | Bacteria | 4762 |
| 266 | Ga0395899_0088479 | 3300037312 | Bacteria | 2246 |
| 267 | Ga0395899_0091323 | 3300037312 | Bacteria | 2206 |
| 268 | Ga0395899_0099907 | 3300037312 | Bacteria | 2095 |
| 269 | Ga0395899_0149494 | 3300037312 | Bacteria | 1656 |
| 270 | Ga0395899_0326295 | 3300037312 | Bacteria | 1032 |
| 271 | Ga0395900_0000061 | 3300037418 | Bacteria | 202483 |
| 272 | Ga0395900_0015038 | 3300037418 | Bacteria | 7888 |
| 273 | Ga0395900_0031633 | 3300037418 | Bacteria | 5439 |
| 274 | Ga0395900_0088812 | 3300037418 | Bacteria | 3177 |
| 275 | Ga0395900_0126578 | 3300037418 | Bacteria | 2620 |
| 276 | Ga0395898_0000034 | 3300037466 | Bacteria | 356745 |
| 277 | Ga0395898_0000363 | 3300037466 | Bacteria | 99698 |
| 278 | Ga0395898_0006801 | 3300037466 | Bacteria | 12164 |
| 279 | Ga0395898_0037712 | 3300037466 | Bacteria | 4792 |
| 280 | Ga0395898_0079666 | 3300037466 | Bacteria | 3159 |
| 281 | Ga0395898_0114226 | 3300037466 | Bacteria | 2587 |
| 282 | Ga0395898_0672468 | 3300037466 | Bacteria | 977 |
| 283 | Ga0395905_0059178 | 3300037471 | Bacteria | 3582 |
| 284 | Ga0395901_0004073 | 3300038443 | Bacteria | 14727 |
| 285 | Ga0395901_0037502 | 3300038443 | Bacteria | 5012 |
| 286 | Ga0395901_0078081 | 3300038443 | Bacteria | 3456 |
| 287 | Ga0395901_0104821 | 3300038443 | Bacteria | 2967 |
| 288 | Ga0395901_0128419 | 3300038443 | Bacteria | 2664 |
| 289 | Ga0395901_0191530 | 3300038443 | Bacteria | 2144 |
| 290 | Ga0439465_0021872 | 3300041413 | Bacteria | 2007 |
| 291 | Ga0451806_178404 | 3300041462 | Bacteria | 1134 |
| 292 | Ga0451837_1727708 | 3300041494 | Bacteria | 1028 |
| 293 | Ga0450908_002267 | 3300042184 | Bacteria | 3757 |
| 294 | Ga0439459_0000759 | 3300042438 | Bacteria | 4437 |
| 295 | Ga0466969_0002903 | 3300044656 | Bacteria | 9147 |
| 296 | Ga0466969_0003488 | 3300044656 | Bacteria | 8359 |
| 297 | Ga0466969_0044122 | 3300044656 | Bacteria | 2219 |
| 298 | Ga0466972_0150147 | 3300044658 | Bacteria | 1095 |
| 299 | Ga0466975_0110345 | 3300044661 | Bacteria | 1952 |
| 300 | Ga0466982_0000010 | 3300044672 | Bacteria | 188341 |
| 301 | Ga0466965_0063692 | 3300044683 | Bacteria | 1845 |
| 302 | Ga0466966_0000831 | 3300044684 | Bacteria | 19700 |
| 303 | Ga0466966_0007518 | 3300044684 | Bacteria | 7217 |
| 304 | Ga0466961_0006853 | 3300044693 | Bacteria | 7247 |
| 305 | Ga0466961_0020014 | 3300044693 | Bacteria | 4305 |
| 306 | Ga0466961_0050159 | 3300044693 | Bacteria | 2666 |
| 307 | Ga0466963_0228039 | 3300044694 | Bacteria | 1305 |
| 308 | Ga0466964_0017787 | 3300044706 | Bacteria | 2723 |
| 309 | Ga0466971_0004686 | 3300044719 | Bacteria | 5911 |
| 310 | Ga0466971_0005715 | 3300044719 | Bacteria | 5407 |
| 311 | Ga0466971_0009969 | 3300044719 | Bacteria | 4150 |
| 312 | Ga0466968_0002781 | 3300044735 | Bacteria | 6465 |
| 313 | Ga0466970_0000464 | 3300044765 | Bacteria | 20048 |
| 314 | Ga0466970_0029397 | 3300044765 | Bacteria | 2892 |
| 315 | Ga0466970_0103917 | 3300044765 | Bacteria | 1548 |
| 316 | Ga0466970_0163822 | 3300044765 | Bacteria | 1230 |
| 317 | Ga0466957_0088782 | 3300044842 | Bacteria | 1934 |
| 318 | Ga0466957_0101584 | 3300044842 | Bacteria | 1813 |
| 319 | Ga0466960_0005398 | 3300044901 | Bacteria | 5062 |
| 320 | Ga0466959_0001544 | 3300045049 | Bacteria | 14164 |
| 321 | Ga0466959_0010715 | 3300045049 | Bacteria | 6565 |
| 322 | Ga0466959_0032733 | 3300045049 | Bacteria | 3848 |
| 323 | Ga0466959_0098826 | 3300045049 | Bacteria | 2090 |
| 324 | Ga0466958_0008413 | 3300045836 | Bacteria | 5722 |
| 325 | Ga0466958_0019881 | 3300045836 | Bacteria | 3912 |
| 326 | Ga0466958_0037164 | 3300045836 | Bacteria | 2917 |
| 327 | Ga0466958_0068072 | 3300045836 | Bacteria | 2176 |
| 328 | Ga0466958_0092955 | 3300045836 | Bacteria | 1868 |
| 329 | Ga0466967_0087903 | 3300045976 | Bacteria | 2819 |
| 330 | Ga0466967_0398751 | 3300045976 | Bacteria | 1338 |
| 331 | Ga0495638_0000069 | 3300046460 | Bacteria | 167503 |
| 332 | Ga0495638_0000166 | 3300046460 | Bacteria | 102926 |
| 333 | Ga0495638_0000516 | 3300046460 | Bacteria | 45213 |
| 334 | Ga0495650_0000220 | 3300046471 | Bacteria | 119197 |
| 335 | Ga0495650_0000247 | 3300046471 | Bacteria | 106616 |
| 336 | Ga0495606_0000050 | 3300046507 | Bacteria | 203375 |
| 337 | Ga0495632_0000167 | 3300046519 | Bacteria | 68027 |
| 338 | Ga0495640_0223762 | 3300046533 | Bacteria | 1186 |
| 339 | Ga0495622_0004330 | 3300046557 | Bacteria | 6608 |
| 340 | Ga0495625_0040879 | 3300046660 | Bacteria | 3379 |
| 341 | Ga0495649_0000374 | 3300046694 | Bacteria | 38763 |
| 342 | Ga0496100_0014179 | 3300048903 | Bacteria | 4620 |
| 343 | Ga0496100_0098708 | 3300048903 | Bacteria | 2008 |
| 344 | Ga0496101_0068747 | 3300048904 | Bacteria | 2590 |
| 345 | Ga0496101_0141435 | 3300048904 | Bacteria | 1834 |
| 346 | Ga0496102_0870839 | 3300048905 | Bacteria | 823 |
| 347 | Ga0496104_0448381 | 3300048907 | Bacteria | 1202 |
| 348 | Ga0496113_0271119 | 3300048916 | Bacteria | 1356 |
| 349 | Ga0496115_0000039 | 3300048918 | Bacteria | 124044 |
| 350 | Ga0496115_0000180 | 3300048918 | Bacteria | 59336 |
| 351 | Ga0496115_0017146 | 3300048918 | Bacteria | 5528 |
| 352 | Ga0496115_0066540 | 3300048918 | Bacteria | 2912 |
| 353 | Ga0496116_0121498 | 3300048919 | Bacteria | 1510 |
| 354 | Ga0496117_0000728 | 3300048920 | Bacteria | 51699 |
| 355 | Ga0496117_0003376 | 3300048920 | Bacteria | 18603 |
| 356 | Ga0496117_0085563 | 3300048920 | Bacteria | 2052 |
| 357 | Ga0496117_0231639 | 3300048920 | Bacteria | 1020 |
| 358 | Ga0496118_0027444 | 3300048921 | Bacteria | 4817 |
| 359 | Ga0496118_0045586 | 3300048921 | Bacteria | 3420 |
| 360 | Ga0496118_0057559 | 3300048921 | Bacteria | 2912 |
| 361 | Ga0496119_0006350 | 3300048922 | Bacteria | 10995 |
| 362 | Ga0496119_0013713 | 3300048922 | Bacteria | 6424 |
| 363 | Ga0496119_0026499 | 3300048922 | Bacteria | 4017 |
| 364 | Ga0496120_0001056 | 3300048923 | Bacteria | 36468 |
| 365 | Ga0496120_0001816 | 3300048923 | Bacteria | 23877 |
| 366 | Ga0496120_0006314 | 3300048923 | Bacteria | 9126 |
| 367 | Ga0496121_0000044 | 3300048924 | Bacteria | 337672 |
| 368 | Ga0496121_0001970 | 3300048924 | Bacteria | 32682 |
| 369 | Ga0496121_0043422 | 3300048924 | Bacteria | 3893 |
| 370 | Ga0496121_0065227 | 3300048924 | Bacteria | 2964 |
| 371 | Ga0496121_0226483 | 3300048924 | Bacteria | 1312 |
| 372 | Ga0496121_0269408 | 3300048924 | Bacteria | 1171 |
| 373 | Ga0496122_0037231 | 3300048925 | Bacteria | 3920 |
| 374 | Ga0496122_0187418 | 3300048925 | Bacteria | 1225 |
| 375 | Ga0496123_0002456 | 3300048926 | Bacteria | 22971 |
| 376 | Ga0496123_0044691 | 3300048926 | Bacteria | 3026 |
| 377 | Ga0496123_0156720 | 3300048926 | Bacteria | 1220 |
| 378 | Ga0496124_0000565 | 3300048927 | Bacteria | 62666 |
| 379 | Ga0496125_0005731 | 3300048928 | Bacteria | 13670 |
| 380 | Ga0496126_0002266 | 3300048929 | Bacteria | 26518 |
| 381 | Ga0496126_0016675 | 3300048929 | Bacteria | 7341 |
| 382 | Ga0496126_0017383 | 3300048929 | Bacteria | 7166 |
| 383 | Ga0496126_0021541 | 3300048929 | Bacteria | 6294 |
| 384 | Ga0496126_0038069 | 3300048929 | Bacteria | 4478 |
| 385 | Ga0496126_0044389 | 3300048929 | Bacteria | 4093 |
| 386 | Ga0495678_108329 | 3300049459 | Bacteria | 951 |
| 387 | Ga0501033_0006904 | 3300049570 | Bacteria | 8864 |
| 388 | Ga0501033_0052081 | 3300049570 | Bacteria | 3033 |
| 389 | Ga0501037_0019629 | 3300049573 | Bacteria | 4987 |
| 390 | Ga0501037_0184016 | 3300049573 | Bacteria | 1481 |
| 391 | Ga0501038_0016996 | 3300049574 | Bacteria | 6583 |
| 392 | Ga0501038_0089587 | 3300049574 | Bacteria | 2580 |
| 393 | Ga0501042_0258788 | 3300049578 | Bacteria | 1256 |
| 394 | Ga0501043_0023963 | 3300049579 | Bacteria | 4788 |
| 395 | Ga0501047_0114059 | 3300049581 | Bacteria | 2584 |
| 396 | Ga0501048_0104950 | 3300049582 | Bacteria | 1994 |
| 397 | Ga0501069_0000978 | 3300049585 | Bacteria | 13605 |
| 398 | Ga0501069_0015541 | 3300049585 | Bacteria | 4081 |
| 399 | Ga0501069_0030889 | 3300049585 | Bacteria | 2944 |
| 400 | Ga0501069_0077952 | 3300049585 | Bacteria | 1863 |
| 401 | Ga0501070_0000105 | 3300049586 | Bacteria | 73931 |
| 402 | Ga0501070_0006054 | 3300049586 | Bacteria | 10303 |
| 403 | Ga0501070_0028894 | 3300049586 | Bacteria | 4648 |
| 404 | Ga0501070_0034619 | 3300049586 | Bacteria | 4221 |
| 405 | Ga0501070_0058783 | 3300049586 | Bacteria | 3187 |
| 406 | Ga0501070_0133092 | 3300049586 | Bacteria | 2053 |
| 407 | Ga0501070_0257252 | 3300049586 | Bacteria | 1427 |
| 408 | Ga0501070_0375231 | 3300049586 | Bacteria | 1152 |
| 409 | Ga0501071_0002675 | 3300049587 | Bacteria | 10908 |
| 410 | Ga0501073_0004459 | 3300049589 | Bacteria | 10517 |
| 411 | Ga0501073_0281103 | 3300049589 | Bacteria | 1148 |
| 412 | Ga0501074_0026207 | 3300049590 | Bacteria | 4227 |
| 413 | Ga0501074_0031600 | 3300049590 | Bacteria | 3835 |
| 414 | Ga0501074_0035294 | 3300049590 | Bacteria | 3622 |
| 415 | Ga0501077_0017076 | 3300049593 | Bacteria | 4578 |
| 416 | Ga0501080_0010712 | 3300049742 | Bacteria | 8388 |
| 417 | Ga0501080_0039710 | 3300049742 | Bacteria | 4392 |
| 418 | Ga0501080_0049109 | 3300049742 | Bacteria | 3927 |
| 419 | Ga0501035_0001421 | 3300049822 | Bacteria | 24513 |
| 420 | Ga0501035_0074613 | 3300049822 | Bacteria | 3000 |
| 421 | Ga0501035_0224630 | 3300049822 | Bacteria | 1602 |
| 422 | Ga0501035_0259342 | 3300049822 | Bacteria | 1474 |
| 423 | Ga0501035_0320458 | 3300049822 | Bacteria | 1302 |
| 424 | Ga0501044_0018697 | 3300049823 | Bacteria | 7422 |
| 425 | Ga0501044_0049400 | 3300049823 | Bacteria | 4343 |
| 426 | Ga0501044_0081795 | 3300049823 | Bacteria | 3268 |
| 427 | Ga0501044_0214245 | 3300049823 | Bacteria | 1879 |
| 428 | Ga0501044_0268699 | 3300049823 | Bacteria | 1642 |
| 429 | Ga0466962_0007332 | 3300061719 | Bacteria | 5293 |
| 430 | Ga0466962_0026492 | 3300061719 | Bacteria | 2783 |
| 431 | Ga0466962_0038214 | 3300061719 | Bacteria | 2298 |
| 432 | 2895515592 | 2895511927 | Bacteria | 6802080 |
| 433 | 2739730942 | 2739367700 | Bacteria | 4747630 |
| 434 | 2842917514 | 2842914999 | Bacteria | 4419378 |
| 435 | 2884412391 | 2884411467 | Bacteria | 5246714 |
| 436 | 2895503748 | 2895498888 | Bacteria | 5283788 |
| 437 | 2895524785 | 2895522137 | Bacteria | 3284416 |
| 438 | 2895528349 | 2895525241 | Bacteria | 3388457 |
| 439 | 2928963992 | 2928963466 | Bacteria | 5165703 |
| 440 | 2941471808 | 2941471342 | Bacteria | 5018624 |
| 441 | JGI24736J21556_1024647 | |||
| 442 | JGI24741J21665_1000887 | |||
| 443 | JGI24740J21852_10000673 | |||
| 444 | JGI24740J21852_10003467 | |||
| 445 | JGI24739J22299_10000542 | |||
| 446 | JGI24735J21928_10003069 | |||
| 447 | JGI25156J39149_1008631 | |||
| 448 | JGI25162J39368_1000018 | |||
| 449 | JGI25162J39368_1001950 | |||
| 450 | JGI25157J39369_1000340 | |||
| 451 | JGI25157J39369_1000780 | |||
| 452 | JGI25164J39214_1000007 | |||
| 453 | JGI25165J46597_1000029 | |||
| 454 | rootH2_10006354 | |||
| 455 | rootH2_10177764 | |||
| 456 | rootL2_10006504 | |||
| 457 | Ga0055538_1000761 | |||
| 458 | Ga0055539_1001041 | |||
| 459 | Ga0055533_1000992 | |||
| 460 | Ga0055533_1001365 | |||
| 461 | Ga0055525_1000211 | |||
| 462 | Ga0055527_1000257 | |||
| 463 | Ga0055527_1000263 | |||
| 464 | Ga0055535_1000103 | |||
| 465 | Ga0055535_1000541 | |||
| 466 | Ga0055535_1000731 | |||
| 467 | Ga0055542_1000024 | |||
| 468 | Ga0055542_1000222 | |||
| 469 | Ga0055542_1000476 | |||
| 470 | Ga0055542_1000567 | |||
| 471 | Ga0055542_1000578 | |||
| 472 | Ga0055529_1000029 | |||
| 473 | Ga0055529_1000538 | |||
| 474 | Ga0055529_1000850 | |||
| 475 | Ga0065165_1007335 | |||
| 476 | Ga0065704_10070807 | |||
| 477 | Ga0070658_10397119 | |||
| 478 | Ga0070683_100043617 | |||
| 479 | Ga0070670_100053529 | |||
| 480 | Ga0070680_100012331 | |||
| 481 | Ga0070680_100015271 | |||
| 482 | Ga0070680_100031356 | |||
| 483 | Ga0070680_100070111 | |||
| 484 | Ga0070682_100003230 | |||
| 485 | Ga0070682_100131150 | |||
| 486 | Ga0070689_100003678 | |||
| 487 | Ga0070691_10004725 | |||
| 488 | Ga0070691_10005695 | |||
| 489 | Ga0070661_100002257 | |||
| 490 | Ga0070661_100267736 | |||
| 491 | Ga0070692_10011783 | |||
| 492 | Ga0070659_100178386 | |||
| 493 | Ga0070667_100075442 | |||
| 494 | Ga0070709_10243512 | |||
| 495 | Ga0070714_100164768 | |||
| 496 | Ga0070663_100002458 | |||
| 497 | Ga0070663_100018215 | |||
| 498 | Ga0070663_100051769 | |||
| 499 | Ga0070663_100065757 | |||
| 500 | Ga0070663_100142071 | |||
| 501 | Ga0070662_100009906 | |||
| 502 | Ga0070681_10000211 | |||
| 503 | Ga0070681_10003200 | |||
| 504 | Ga0070681_10019847 | |||
| 505 | Ga0070681_10034898 | |||
| 506 | Ga0070679_100010547 | |||
| 507 | Ga0070679_100018626 | |||
| 508 | Ga0070679_100018670 | |||
| 509 | Ga0068853_100544279 | |||
| 510 | Ga0070696_100001397 | |||
| 511 | Ga0070693_100063100 | |||
| 512 | Ga0070665_100009525 | |||
| 513 | Ga0068855_100008640 | |||
| 514 | Ga0068855_100019983 | |||
| 515 | Ga0068855_100291676 | |||
| 516 | Ga0070664_100080120 | |||
| 517 | Ga0068857_100001031 | |||
| 518 | Ga0068857_100042088 | |||
| 519 | Ga0068854_100000593 | |||
| 520 | Ga0068854_100007279 | |||
| 521 | Ga0068854_100022711 | |||
| 522 | Ga0068854_100026288 | |||
| 523 | Ga0068856_100003150 | |||
| 524 | Ga0068852_100049936 | |||
| 525 | Ga0068852_100058741 | |||
| 526 | Ga0068851_10002366 | |||
| 527 | Ga0068851_10008310 | |||
| 528 | Ga0068851_10031287 | |||
| 529 | Ga0068862_100600352 | |||
| 530 | Ga0105240_10000127 | |||
| 531 | Ga0105240_10001888 | |||
| 532 | Ga0105240_10030204 | |||
| 533 | Ga0105240_10048100 | |||
| 534 | Ga0105240_10055264 | |||
| 535 | Ga0105240_10058931 | |||
| 536 | Ga0105240_10075408 | |||
| 537 | Ga0105240_10212099 | |||
| 538 | Ga0105237_10000565 | |||
| 539 | Ga0105237_10145675 | |||
| 540 | Ga0105237_10186534 | |||
| 541 | Ga0105238_10000783 | |||
| 542 | Ga0105238_10025069 | |||
| 543 | Ga0105239_10000933 | |||
| 544 | Ga0157314_1000360 | |||
| 545 | Ga0157373_10018022 | |||
| 546 | Ga0157373_10028431 | |||
| 547 | Ga0157373_10414168 | |||
| 548 | Ga0157371_10058156 | |||
| 549 | Ga0157371_10159225 | |||
| 550 | Ga0157371_10343996 | |||
| 551 | Ga0157370_10004805 | |||
| 552 | Ga0157370_10009321 | |||
| 553 | Ga0157370_10116302 | |||
| 554 | Ga0157369_10002023 | |||
| 555 | Ga0157369_10037349 | |||
| 556 | Ga0163162_10000281 | |||
| 557 | Ga0163162_10119494 | |||
| 558 | Ga0157372_10005727 | |||
| 559 | Ga0157372_10014832 | |||
| 560 | Ga0157372_10076403 | |||
| 561 | Ga0157372_10144648 | |||
| 562 | Ga0157372_10373426 | |||
| 563 | Ga0182008_10087571 | |||
| 564 | Ga0157376_10153556 | |||
| 565 | Ga0182007_10035309 | |||
| 566 | Ga0183368_1004 | |||
| 567 | Ga0163161_10086827 | |||
| 568 | Ga0206356_11202932 | |||
| 569 | Ga0206356_11530043 | |||
| 570 | Ga0206354_10238400 | |||
| 571 | Ga0206354_11202544 | |||
| 572 | Ga0206353_10283238 | |||
| 573 | Ga0206353_10976575 | |||
| 574 | Ga0154015_1104391 | |||
| 575 | Ga0154015_1256927 | |||
| 576 | Ga0209760_100235 | |||
| 577 | Ga0209784_100026 | |||
| 578 | Ga0209566_104425 | |||
| 579 | Ga0209566_110539 | |||
| 580 | Ga0209674_100016 | |||
| 581 | Ga0209674_100108 | |||
| 582 | Ga0209672_100007 | |||
| 583 | Ga0209672_100009 | |||
| 584 | Ga0209672_100176 | |||
| 585 | Ga0209672_100268 | |||
| 586 | Ga0209563_100079 | |||
| 587 | Ga0207427_100023 | |||
| 588 | Ga0207427_101563 | |||
| 589 | Ga0209437_100069 | |||
| 590 | Ga0209437_100252 | |||
| 591 | Ga0209258_100011 | |||
| 592 | Ga0209258_100046 | |||
| 593 | Ga0209258_100059 | |||
| 594 | Ga0209258_100511 | |||
| 595 | Ga0209258_101642 | |||
| 596 | Ga0209646_1000577 | |||
| 597 | Ga0209026_1000036 | |||
| 598 | Ga0209026_1000194 | |||
| 599 | Ga0209026_1001141 | |||
| 600 | Ga0209677_103689 | |||
| 601 | Ga0209148_1000002 | |||
| 602 | Ga0209148_1000010 | |||
| 603 | Ga0209148_1000013 | |||
| 604 | Ga0209148_1000084 | |||
| 605 | Ga0209148_1000533 | |||
| 606 | Ga0209759_1000300 | |||
| 607 | Ga0209759_1000901 | |||
| 608 | Ga0209759_1002666 | |||
| 609 | Ga0209129_1005749 | |||
| 610 | Ga0209233_1000009 | |||
| 611 | Ga0209455_1000010 | |||
| 612 | Ga0209455_1000012 | |||
| 613 | Ga0209455_1000020 | |||
| 614 | Ga0209758_1000289 | |||
| 615 | Ga0209051_1002103 | |||
| 616 | Ga0207656_10001718 | |||
| 617 | Ga0207656_10020249 | |||
| 618 | Ga0207656_10043552 | |||
| 619 | Ga0207680_10000005 | |||
| 620 | Ga0207647_10000150 | |||
| 621 | Ga0207647_10002791 | |||
| 622 | Ga0207647_10005413 | |||
| 623 | Ga0207647_10006362 | |||
| 624 | Ga0207705_10000353 | |||
| 625 | Ga0207705_10000355 | |||
| 626 | Ga0207705_10004364 | |||
| 627 | Ga0207705_10016812 | |||
| 628 | Ga0207705_10034831 | |||
| 629 | Ga0207654_10121625 | |||
| 630 | Ga0207707_10000308 | |||
| 631 | Ga0207707_10000630 | |||
| 632 | Ga0207707_10000644 | |||
| 633 | Ga0207707_10000699 | |||
| 634 | Ga0207707_10007899 | |||
| 635 | Ga0207707_10009345 | |||
| 636 | Ga0207707_10031697 | |||
| 637 | Ga0207695_10000349 | |||
| 638 | Ga0207695_10000975 | |||
| 639 | Ga0207695_10006439 | |||
| 640 | Ga0207695_10019320 | |||
| 641 | Ga0207695_10021742 | |||
| 642 | Ga0207695_10032821 | |||
| 643 | Ga0207695_10232201 | |||
| 644 | Ga0207695_10427582 | |||
| 645 | Ga0207671_10000059 | |||
| 646 | Ga0207671_10055961 | |||
| 647 | Ga0207660_10000244 | |||
| 648 | Ga0207660_10000570 | |||
| 649 | Ga0207660_10005110 | |||
| 650 | Ga0207660_10005371 | |||
| 651 | Ga0207660_10021767 | |||
| 652 | Ga0207660_10057190 | |||
| 653 | Ga0207657_10003793 | |||
| 654 | Ga0207657_10005053 | |||
| 655 | Ga0207649_10006739 | |||
| 656 | Ga0207649_10010374 | |||
| 657 | Ga0207649_10021545 | |||
| 658 | Ga0207652_10000030 | |||
| 659 | Ga0207652_10000719 | |||
| 660 | Ga0207652_10000940 | |||
| 661 | Ga0207652_10001717 | |||
| 662 | Ga0207652_10012507 | |||
| 663 | Ga0207694_10000916 | |||
| 664 | Ga0207650_10038487 | |||
| 665 | Ga0207690_10000799 | |||
| 666 | Ga0207690_10006154 | |||
| 667 | Ga0207690_10086659 | |||
| 668 | Ga0207706_10012181 | |||
| 669 | Ga0207670_10002344 | |||
| 670 | Ga0207661_10001956 | |||
| 671 | Ga0207661_10141128 | |||
| 672 | Ga0207661_10492249 | |||
| 673 | Ga0207679_10026647 | |||
| 674 | Ga0207667_10000031 | |||
| 675 | Ga0207667_10000383 | |||
| 676 | Ga0207667_10000679 | |||
| 677 | Ga0207667_10018339 | |||
| 678 | Ga0207667_10031340 | |||
| 679 | Ga0207640_10000082 | |||
| 680 | Ga0207640_10003658 | |||
| 681 | Ga0207640_10008036 | |||
| 682 | Ga0207640_10039098 | |||
| 683 | Ga0207640_10258651 | |||
| 684 | Ga0207639_10003825 | |||
| 685 | Ga0207639_10007936 | |||
| 686 | Ga0207639_10043878 | |||
| 687 | Ga0207639_10517142 | |||
| 688 | Ga0207678_10002717 | |||
| 689 | Ga0207678_10016436 | |||
| 690 | Ga0207678_10017192 | |||
| 691 | Ga0207678_10018140 | |||
| 692 | Ga0207678_10041906 | |||
| 693 | Ga0207702_10004220 | |||
| 694 | Ga0207702_10005766 | |||
| 695 | Ga0207702_10035244 | |||
| 696 | Ga0207702_10039170 | |||
| 697 | Ga0207674_10000189 | |||
| 698 | Ga0207674_10004902 | |||
| 699 | Ga0207698_10003400 | |||
| 700 | Ga0207698_10005403 | |||
| 701 | Ga0207698_10007313 | |||
| 702 | Ga0268266_10000004 | |||
| 703 | Ga0268264_10817659 | |||
| 704 | Ga0395899_0000460 | |||
| 705 | Ga0395899_0022626 | |||
| 706 | Ga0395899_0088479 | |||
| 707 | Ga0395899_0091323 | |||
| 708 | Ga0395899_0099907 | |||
| 709 | Ga0395899_0149494 | |||
| 710 | Ga0395899_0326295 | |||
| 711 | Ga0395900_0000061 | |||
| 712 | Ga0395900_0015038 | |||
| 713 | Ga0395900_0031633 | |||
| 714 | Ga0395900_0088812 | |||
| 715 | Ga0395900_0126578 | |||
| 716 | Ga0395898_0000034 | |||
| 717 | Ga0395898_0000363 | |||
| 718 | Ga0395898_0006801 | |||
| 719 | Ga0395898_0037712 | |||
| 720 | Ga0395898_0079666 | |||
| 721 | Ga0395898_0114226 | |||
| 722 | Ga0395898_0672468 | |||
| 723 | Ga0395905_0059178 | |||
| 724 | Ga0395901_0004073 | |||
| 725 | Ga0395901_0037502 | |||
| 726 | Ga0395901_0078081 | |||
| 727 | Ga0395901_0104821 | |||
| 728 | Ga0395901_0128419 | |||
| 729 | Ga0395901_0191530 | |||
| 730 | Ga0439465_0021872 | |||
| 731 | Ga0451806_178404 | |||
| 732 | Ga0451837_1727708 | |||
| 733 | Ga0450908_002267 | |||
| 734 | Ga0439459_0000759 | |||
| 735 | Ga0466969_0002903 | |||
| 736 | Ga0466969_0003488 | |||
| 737 | Ga0466969_0044122 | |||
| 738 | Ga0466972_0150147 | |||
| 739 | Ga0466975_0110345 | |||
| 740 | Ga0466982_0000010 | |||
| 741 | Ga0466965_0063692 | |||
| 742 | Ga0466966_0000831 | |||
| 743 | Ga0466966_0007518 | |||
| 744 | Ga0466961_0006853 | |||
| 745 | Ga0466961_0020014 | |||
| 746 | Ga0466961_0050159 | |||
| 747 | Ga0466963_0228039 | |||
| 748 | Ga0466964_0017787 | |||
| 749 | Ga0466971_0004686 | |||
| 750 | Ga0466971_0005715 | |||
| 751 | Ga0466971_0009969 | |||
| 752 | Ga0466968_0002781 | |||
| 753 | Ga0466970_0000464 | |||
| 754 | Ga0466970_0029397 | |||
| 755 | Ga0466970_0103917 | |||
| 756 | Ga0466970_0163822 | |||
| 757 | Ga0466957_0088782 | |||
| 758 | Ga0466957_0101584 | |||
| 759 | Ga0466960_0005398 | |||
| 760 | Ga0466959_0001544 | |||
| 761 | Ga0466959_0010715 | |||
| 762 | Ga0466959_0032733 | |||
| 763 | Ga0466959_0098826 | |||
| 764 | Ga0466958_0008413 | |||
| 765 | Ga0466958_0019881 | |||
| 766 | Ga0466958_0037164 | |||
| 767 | Ga0466958_0068072 | |||
| 768 | Ga0466958_0092955 | |||
| 769 | Ga0466967_0087903 | |||
| 770 | Ga0466967_0398751 | |||
| 771 | Ga0495638_0000069 | |||
| 772 | Ga0495638_0000166 | |||
| 773 | Ga0495638_0000516 | |||
| 774 | Ga0495650_0000220 | |||
| 775 | Ga0495650_0000247 | |||
| 776 | Ga0495606_0000050 | |||
| 777 | Ga0495632_0000167 | |||
| 778 | Ga0495640_0223762 | |||
| 779 | Ga0495622_0004330 | |||
| 780 | Ga0495625_0040879 | |||
| 781 | Ga0495649_0000374 | |||
| 782 | Ga0496100_0014179 | |||
| 783 | Ga0496100_0098708 | |||
| 784 | Ga0496101_0068747 | |||
| 785 | Ga0496101_0141435 | |||
| 786 | Ga0496102_0870839 | |||
| 787 | Ga0496104_0448381 | |||
| 788 | Ga0496113_0271119 | |||
| 789 | Ga0496115_0000039 | |||
| 790 | Ga0496115_0000180 | |||
| 791 | Ga0496115_0017146 | |||
| 792 | Ga0496115_0066540 | |||
| 793 | Ga0496116_0121498 | |||
| 794 | Ga0496117_0000728 | |||
| 795 | Ga0496117_0003376 | |||
| 796 | Ga0496117_0085563 | |||
| 797 | Ga0496117_0231639 | |||
| 798 | Ga0496118_0027444 | |||
| 799 | Ga0496118_0045586 | |||
| 800 | Ga0496118_0057559 | |||
| 801 | Ga0496119_0006350 | |||
| 802 | Ga0496119_0013713 | |||
| 803 | Ga0496119_0026499 | |||
| 804 | Ga0496120_0001056 | |||
| 805 | Ga0496120_0001816 | |||
| 806 | Ga0496120_0006314 | |||
| 807 | Ga0496121_0000044 | |||
| 808 | Ga0496121_0001970 | |||
| 809 | Ga0496121_0043422 | |||
| 810 | Ga0496121_0065227 | |||
| 811 | Ga0496121_0226483 | |||
| 812 | Ga0496121_0269408 | |||
| 813 | Ga0496122_0037231 | |||
| 814 | Ga0496122_0187418 | |||
| 815 | Ga0496123_0002456 | |||
| 816 | Ga0496123_0044691 | |||
| 817 | Ga0496123_0156720 | |||
| 818 | Ga0496124_0000565 | |||
| 819 | Ga0496125_0005731 | |||
| 820 | Ga0496126_0002266 | |||
| 821 | Ga0496126_0016675 | |||
| 822 | Ga0496126_0017383 | |||
| 823 | Ga0496126_0021541 | |||
| 824 | Ga0496126_0038069 | |||
| 825 | Ga0496126_0044389 | |||
| 826 | Ga0495678_108329 | |||
| 827 | Ga0501033_0006904 | |||
| 828 | Ga0501033_0052081 | |||
| 829 | Ga0501037_0019629 | |||
| 830 | Ga0501037_0184016 | |||
| 831 | Ga0501038_0016996 | |||
| 832 | Ga0501038_0089587 | |||
| 833 | Ga0501042_0258788 | |||
| 834 | Ga0501043_0023963 | |||
| 835 | Ga0501047_0114059 | |||
| 836 | Ga0501048_0104950 | |||
| 837 | Ga0501069_0000978 | |||
| 838 | Ga0501069_0015541 | |||
| 839 | Ga0501069_0030889 | |||
| 840 | Ga0501069_0077952 | |||
| 841 | Ga0501070_0000105 | |||
| 842 | Ga0501070_0006054 | |||
| 843 | Ga0501070_0028894 | |||
| 844 | Ga0501070_0034619 | |||
| 845 | Ga0501070_0058783 | |||
| 846 | Ga0501070_0133092 | |||
| 847 | Ga0501070_0257252 | |||
| 848 | Ga0501070_0375231 | |||
| 849 | Ga0501071_0002675 | |||
| 850 | Ga0501073_0004459 | |||
| 851 | Ga0501073_0281103 | |||
| 852 | Ga0501074_0026207 | |||
| 853 | Ga0501074_0031600 | |||
| 854 | Ga0501074_0035294 | |||
| 855 | Ga0501077_0017076 | |||
| 856 | Ga0501080_0010712 | |||
| 857 | Ga0501080_0039710 | |||
| 858 | Ga0501080_0049109 | |||
| 859 | Ga0501035_0001421 | |||
| 860 | Ga0501035_0074613 | |||
| 861 | Ga0501035_0224630 | |||
| 862 | Ga0501035_0259342 | |||
| 863 | Ga0501035_0320458 | |||
| 864 | Ga0501044_0018697 | |||
| 865 | Ga0501044_0049400 | |||
| 866 | Ga0501044_0081795 | |||
| 867 | Ga0501044_0214245 | |||
| 868 | Ga0501044_0268699 | |||
| 869 | Ga0466962_0007332 | |||
| 870 | Ga0466962_0026492 | |||
| 871 | Ga0466962_0038214 | |||
| 872 | 2895515592 | |||
| 873 | 2739730942 | |||
| 874 | 2842917514 | |||
| 875 | 2884412391 | |||
| 876 | 2895503748 | |||
| 877 | 2895524785 | |||
| 878 | 2895528349 | |||
| 879 | 2928963992 | |||
| 880 | 2941471808 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dps-assembly1.cif.gz_A | structure of leucyl/phenylalanyl-trna-protein transferase | 0.9565 | 4 | 224 |
| 2z3o-assembly1.cif.gz_A | complex structure of lf-transferase and phenylalanine | 0.9507 | 3 | 223 |
| 2z3l-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.949 | 3 | 224 |
| 2cxa-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9475 | 2 | 224 |
| 2z3n-assembly1.cif.gz_B | complex structure of lf-transferase and peptide b | 0.938 | 3 | 223 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2z3kA02 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Leucyl/phenylalanyl-tRNA-protein transferase, C-terminal domain | 0.9336 | 64 | 224 | 3.40.630.70 |
| 2z3lB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain | 0.9174 | 3 | 63 | 3.30.70.3550 |
| 2dpsB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain | 0.9065 | 2 | 63 | 3.30.70.3550 |
| 2z3lB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain | 0.9034 | 3 | 63 | 3.30.70.3550 |
| 2dpsB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain | 0.8929 | 2 | 63 | 3.30.70.3550 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S0SCE4-F1-model_v4 | Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) | 0.9823 | 1 | 224 |
GO:0005737
GO:0008914 GO:0030163 |
| AF-A0A1V3QIX5-F1-model_v4 | Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) | 0.9819 | 1 | 236 |
GO:0005737
GO:0008914 GO:0030163 |
| AF-A0A1Q3V815-F1-model_v4 | deleted | 0.98 | 1 | 236 |
|
| AF-A0A1E4HA83-F1-model_v4 | Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) | 0.98 | 1 | 236 |
GO:0005737
GO:0008914 GO:0030163 |
| AF-A0A317GY25-F1-model_v4 | Leucyl/phenylalanyl-tRNA--protein transferase | 0.9793 | 100 | 228 |
GO:0005737
GO:0008914 GO:0030163 |