F444541

General Info

Members Datasets Scaffolds Average Seq Length
440 333 280 296

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2671180139|2671694750
Length 324
Sequence RDGTASPSGAADRTDLRDVAKAHRPFPLGRLILWAVAILIAADFVWIVAGNENFGWPVVAKYFFDPTVLQGLTVTLGLTVVAMTIGIVLGLLLAIARLSQDGLANTVAGLFIWFFRGTPLLVQLIFWYNLSTLFPELSITIPFGPKLVGWDTNSVISPMTAAIVGLALNEAAYMAEIIRGGLLSVDKGQAETAEAFGMTRVRALWRVIIPQAMRSIVPPTGNQLISMIKATSLVSVIAMADLLYSVQSIYNRTFEVVPMLLVAVIWYLLITSVLNVGQSYIERYYSRGDRRSAPRAARDAATEAPATEAPMGPSPTNVPQEAAR

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
5 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
6 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
7 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
8 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
9 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
10 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
11 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
12 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
13 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
14 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
15 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
16 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
17 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
18 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
19 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
20 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
21 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
22 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
23 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
24 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
25 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
26 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
27 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
28 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
29 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
30 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
31 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
32 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
33 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
34 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
35 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
36 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
37 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
38 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
39 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
40 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
41 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
42 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
43 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
44 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
45 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
46 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
47 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
48 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
49 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
50 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
51 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
52 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
53 2643221568 Rhizobium sp. Root564 Isolate Unclassified
54 2643221736 Bosea sp. Root483D1 Isolate Unclassified
55 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
56 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
57 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
58 2738541293 Rhizobium sp. GV031 Isolate Unclassified
59 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
60 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
61 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
62 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
63 2738543024 Aminobacter sp. AP02 Isolate Unclassified
64 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
65 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
66 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
67 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
68 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
69 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
70 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
71 2791355266 Rhizobium sp. L43 Isolate Nodule
72 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
73 2802429633 Rhizobium anhuiense J3 Isolate Nodule
74 2802429634 Rhizobium anhuiense S10 Isolate Nodule
75 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
76 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
77 2802429637 Rhizobium anhuiense C15 Isolate Nodule
78 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
79 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
80 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
81 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
82 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
83 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
84 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
85 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
86 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
87 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
88 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
89 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
90 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
91 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
92 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
93 2841760612 Bosea sp. Tri-49 Isolate Nodule
94 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
95 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
96 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
97 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
98 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
99 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
100 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
101 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
102 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
103 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
104 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
105 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
106 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
107 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
108 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
109 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
110 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
111 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
112 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
113 2844104063 Bosea sp. Tri-39 Isolate Nodule
114 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
115 2851182111 Bosea sp. Tri-44 Isolate Nodule
116 2851246043 Bosea sp. Tri-54 Isolate Nodule
117 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
118 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
119 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
120 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
121 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
122 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
123 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
124 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
125 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
126 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
127 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
128 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
129 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
130 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
131 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
132 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
133 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
134 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
135 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
136 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
137 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
138 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
139 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
140 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
141 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
142 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
143 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
144 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
145 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
146 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
147 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
148 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
149 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
150 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
151 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
152 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
153 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
154 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
155 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
156 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
157 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
158 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
159 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
160 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
161 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
162 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
163 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
164 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
165 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
166 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
167 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
168 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
169 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
170 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
171 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
172 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
173 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
174 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
175 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
176 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
177 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
178 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
179 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
180 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
181 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
182 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
183 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
184 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
185 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
186 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
187 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
188 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
189 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
190 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
191 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
192 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
193 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
194 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
195 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
196 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
197 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
198 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
199 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
200 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
202 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
203 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
204 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
206 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
207 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
218 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
219 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
220 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
221 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
222 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
223 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
224 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
227 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
228 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
229 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
230 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
231 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
232 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
233 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
234 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
235 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
236 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
237 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
238 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
239 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
240 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
241 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
242 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
243 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
244 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
245 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
246 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
247 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
248 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
249 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
250 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
251 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
252 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
253 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
254 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
255 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
256 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
257 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
258 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
259 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
260 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
261 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
262 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
263 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
267 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
268 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
269 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
270 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
273 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
274 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
275 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
276 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
277 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
278 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
287 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
288 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
289 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
290 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
291 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
293 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
294 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
295 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
296 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
297 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
298 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
299 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
300 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
301 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
302 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
303 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
304 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
305 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
306 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
307 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
308 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
309 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
310 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
311 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
312 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
313 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
314 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
315 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
316 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
317 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
318 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
319 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
320 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
321 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
322 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
323 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
324 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
325 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
326 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
327 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
328 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
329 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
330 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
331 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
332 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
333 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 63.64
Metatranscriptomes 0
Isolates 36.36

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 26.14
Nodule 19.55
Rhizoplane 1.59
Rhizosphere 30.45
Stem 0
Stem Tuber 0
Unclassified 22.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10009548 3300001979 Bacteria 3791
2 JGI24739J22299_10019552 3300001989 Bacteria 2423
3 JGI25155J39150_1000003 3300002704 Bacteria 279666
4 JGI25156J39149_1000004 3300002705 Bacteria 273027
5 JGI25162J39368_1000114 3300002737 Bacteria 88296
6 JGI25162J39368_1000222 3300002737 Bacteria 58781
7 JGI25154J39366_1000088 3300002738 Bacteria 84250
8 JGI25157J39369_1000004 3300002741 Bacteria 273009
9 JGI25152J39213_1000209 3300002773 Bacteria 39553
10 JGI25152J39213_1006956 3300002773 Bacteria 2989
11 JGI25152J39213_1006992 3300002773 Bacteria 2974
12 JGI25152J39213_1008966 3300002773 Bacteria 2424
13 JGI25152J39213_1010347 3300002773 Bacteria 2141
14 JGI25150J39212_1000101 3300002774 Bacteria 49081
15 JGI25150J39212_1009197 3300002774 Bacteria 1896
16 JGI25159J45721_1000765 3300002987 Bacteria 13959
17 JGI25151J46595_10000085 3300003187 Bacteria 127212
18 JGI25151J46595_10000383 3300003187 Bacteria 45964
19 JGI25165J46597_1000232 3300003214 Bacteria 77724
20 JGI25165J46597_1000233 3300003214 Bacteria 77242
21 JGI25153J46596_10000553 3300003215 Bacteria 23352
22 JGI25153J46596_10001502 3300003215 Bacteria 13913
23 JGI25153J46596_10014200 3300003215 Bacteria 3325
24 JGI25153J46596_10016268 3300003215 Bacteria 2989
25 JGI25153J46596_10016362 3300003215 Bacteria 2974
26 rootH1_10030109 3300003316 Bacteria 3449
27 rootL2_10009270 3300003322 Bacteria 15122
28 JGI25160J50197_1004068 3300003354 Bacteria 6366
29 JGI25160J50197_1014805 3300003354 Bacteria 2589
30 JGI25161J50226_1000154 3300003374 Bacteria 47801
31 JGI25161J50226_1006167 3300003374 Bacteria 2210
32 Ga0055526_1002237 3300003771 Bacteria 13247
33 Ga0055524_1003101 3300003775 Bacteria 8204
34 Ga0055524_1007531 3300003775 Bacteria 4610
35 Ga0055528_1000745 3300003790 Bacteria 22728
36 Ga0055528_1002344 3300003790 Bacteria 10245
37 Ga0055528_1008833 3300003790 Bacteria 4269
38 Ga0055540_1009320 3300003792 Bacteria 3404
39 Ga0055540_1022141 3300003792 Bacteria 1632
40 Ga0055543_1000365 3300004625 Bacteria 30039
41 Ga0055543_1000513 3300004625 Bacteria 22087
42 Ga0065165_1000139 3300005262 Bacteria 126209
43 Ga0065165_1001369 3300005262 Bacteria 26829
44 Ga0065165_1021168 3300005262 Bacteria 2266
45 Ga0070667_100027677 3300005367 Bacteria 4717
46 Ga0068854_100231120 3300005578 Bacteria 1468
47 Ga0068856_100017286 3300005614 Bacteria 6991
48 Ga0068852_100281967 3300005616 Bacteria 1602
49 Ga0068851_10172764 3300005834 Bacteria 1193
50 Ga0075365_10069128 3300006038 Bacteria 2373
51 Ga0075364_10000058 3300006051 Bacteria 41383
52 Ga0075364_10236449 3300006051 Bacteria 1241
53 Ga0075367_10003902 3300006178 Bacteria 7192
54 Ga0075367_10024048 3300006178 Bacteria 3434
55 Ga0075369_10124746 3300006186 Bacteria 1167
56 Ga0075366_10181117 3300006195 Bacteria 1280
57 Ga0075370_10003432 3300006353 Bacteria 7542
58 Ga0075370_10016298 3300006353 Bacteria 3998
59 Ga0105244_10000006 3300009036 Bacteria 357997
60 Ga0105240_10000012 3300009093 Bacteria 496639
61 Ga0105245_10146584 3300009098 Bacteria 2227
62 Ga0105243_10018245 3300009148 Bacteria 5313
63 Ga0105243_10281725 3300009148 Bacteria 1497
64 Ga0105248_10221627 3300009177 Bacteria 2129
65 Ga0105237_10000941 3300009545 Bacteria 39120
66 Ga0123342_1024778 3300009766 Bacteria 3708
67 Ga0105239_10181064 3300010375 Bacteria 2358
68 Ga0105246_10073991 3300011119 Bacteria 2407
69 Ga0157370_10000320 3300013104 Bacteria 60398
70 Ga0157370_10002378 3300013104 Bacteria 22683
71 Ga0157369_10200614 3300013105 Bacteria 2094
72 Ga0182008_10054396 3300014497 Bacteria 1980
73 Ga0157377_10106091 3300014745 Bacteria 1682
74 Ga0182007_10006059 3300015262 Bacteria 5228
75 Ga0182005_1014839 3300015265 Bacteria 2178
76 Ga0209435_100006 3300025206 Bacteria 542459
77 Ga0209436_100021 3300025208 Bacteria 102115
78 Ga0209437_100022 3300025233 Bacteria 625694
79 Ga0209437_100040 3300025233 Bacteria 448096
80 Ga0207425_1000065 3300025245 Bacteria 127264
81 Ga0207425_1000753 3300025245 Bacteria 16834
82 Ga0207425_1006263 3300025245 Bacteria 3274
83 Ga0209646_1000015 3300025246 Bacteria 542459
84 Ga0209026_1000039 3300025250 Bacteria 280608
85 Ga0209759_1000005 3300025256 Bacteria 542459
86 Ga0209129_1000132 3300025258 Bacteria 127262
87 Ga0209129_1000548 3300025258 Bacteria 26009
88 Ga0209129_1000962 3300025258 Bacteria 17318
89 Ga0209129_1001002 3300025258 Bacteria 16842
90 Ga0209233_1000031 3300025261 Bacteria 624646
91 Ga0209233_1000051 3300025261 Bacteria 447617
92 Ga0209233_1000146 3300025261 Bacteria 187269
93 Ga0209673_1000005 3300025273 Bacteria 692788
94 Ga0209673_1003429 3300025273 Bacteria 9368
95 Ga0209673_1004631 3300025273 Bacteria 7280
96 Ga0209673_1008106 3300025273 Bacteria 4723
97 Ga0209130_1000019 3300025284 Bacteria 381993
98 Ga0209130_1000148 3300025284 Bacteria 109763
99 Ga0209676_1000026 3300025292 Bacteria 574599
100 Ga0209676_1030582 3300025292 Bacteria 1644
101 Ga0209025_1000247 3300025294 Bacteria 127264
102 Ga0209025_1000397 3300025294 Bacteria 89703
103 Ga0209025_1002744 3300025294 Bacteria 17833
104 Ga0209025_1017245 3300025294 Bacteria 4185
105 Ga0209564_1000511 3300025295 Bacteria 63773
106 Ga0209564_1001757 3300025295 Bacteria 20239
107 Ga0209564_1022190 3300025295 Bacteria 2252
108 Ga0209758_1000212 3300025297 Bacteria 127597
109 Ga0209758_1001264 3300025297 Bacteria 31314
110 Ga0209758_1001362 3300025297 Bacteria 29278
111 Ga0209758_1002029 3300025297 Bacteria 21765
112 Ga0209758_1002190 3300025297 Bacteria 20464
113 Ga0209050_1004960 3300025298 Bacteria 8671
114 Ga0209256_1005014 3300025299 Bacteria 7909
115 Ga0209256_1013939 3300025299 Bacteria 2938
116 Ga0207426_1000005 3300025302 Bacteria 1037188
117 Ga0207426_1000355 3300025302 Bacteria 83450
118 Ga0207426_1008169 3300025302 Bacteria 4265
119 Ga0209051_1006630 3300025303 Bacteria 6486
120 Ga0209051_1014963 3300025303 Bacteria 3595
121 Ga0209051_1026433 3300025303 Bacteria 2339
122 Ga0207656_10127439 3300025321 Bacteria 1190
123 Ga0207688_10061986 3300025901 Bacteria 2108
124 Ga0207695_10000120 3300025913 Bacteria 234247
125 Ga0207671_10000023 3300025914 Bacteria 274756
126 Ga0207681_10424617 3300025923 Bacteria 1078
127 Ga0207687_10090745 3300025927 Bacteria 2227
128 Ga0207658_10019123 3300025986 Bacteria 4737
129 Ga0207702_10049088 3300026078 Bacteria 3561
130 Ga0209371_1003015 3300027312 Bacteria 8704
131 Ga0209813_10023730 3300027866 Bacteria 1746
132 Ga0307515_10000997 3300028794 Bacteria 64733
133 Ga0307515_10005985 3300028794 Bacteria 24500
134 Ga0268256_1002669 3300030500 Bacteria 8796
135 Ga0307513_10007297 3300031456 Bacteria 14354
136 Ga0307514_10003051 3300031649 Bacteria 16527
137 Ga0307405_10133754 3300031731 Bacteria 1718
138 Ga0307410_10245028 3300031852 Bacteria 1391
139 Ga0307414_10103542 3300032004 Bacteria 2148
140 Ga0395898_0091647 3300037466 Bacteria 2924
141 Ga0439465_0009229 3300041413 Bacteria 3108
142 Ga0451798_0595955 3300041458 Bacteria 1614
143 Ga0451837_0009909 3300041494 Bacteria 4142
144 Ga0451839_0091602 3300041496 Bacteria 2869
145 Ga0451845_0737045 3300041501 Bacteria 1670
146 Ga0451847_0223037 3300041503 Bacteria 2171
147 Ga0451851_0840181 3300041507 Bacteria 2719
148 Ga0451843_0023281 3300041509 Bacteria 3311
149 Ga0451855_0238634 3300041511 Bacteria 1179
150 Ga0451855_1137795 3300041511 Bacteria 1476
151 Ga0466970_0001826 3300044765 Bacteria 10276
152 Ga0495617_071138 3300046452 Bacteria 1144
153 Ga0495629_0003787 3300046459 Bacteria 11393
154 Ga0495638_0000035 3300046460 Bacteria 276385
155 Ga0495650_0014044 3300046471 Bacteria 4195
156 Ga0495605_0003391 3300046474 Bacteria 9504
157 Ga0495605_0042644 3300046474 Bacteria 2254
158 Ga0495607_0029547 3300046501 Bacteria 3372
159 Ga0495607_0050193 3300046501 Bacteria 2430
160 Ga0495583_0000972 3300046506 Bacteria 32958
161 Ga0495583_0023877 3300046506 Bacteria 3084
162 Ga0495583_0083101 3300046506 Bacteria 1389
163 Ga0495610_0008975 3300046512 Bacteria 6392
164 Ga0495610_0009697 3300046512 Bacteria 6060
165 Ga0495620_0001324 3300046515 Bacteria 15023
166 Ga0495620_0007409 3300046515 Bacteria 5961
167 Ga0495631_0007668 3300046518 Bacteria 5481
168 Ga0495632_0002480 3300046519 Bacteria 14013
169 Ga0495632_0006181 3300046519 Bacteria 7751
170 Ga0495643_0008302 3300046522 Bacteria 6587
171 Ga0495597_0067924 3300046542 Bacteria 1541
172 Ga0495622_0000783 3300046557 Bacteria 17693
173 Ga0495633_0013750 3300046558 Bacteria 4253
174 Ga0495668_0015155 3300046616 Bacteria 4507
175 Ga0495668_0030011 3300046616 Bacteria 3071
176 Ga0495611_0003083 3300046648 Bacteria 7404
177 Ga0495625_0022215 3300046660 Bacteria 4868
178 Ga0495625_0032066 3300046660 Bacteria 3901
179 Ga0495625_0139342 3300046660 Bacteria 1637
180 Ga0495661_0044992 3300046665 Bacteria 2702
181 Ga0495670_0022316 3300046691 Bacteria 3125
182 Ga0495670_0069628 3300046691 Bacteria 1779
183 Ga0495649_0015950 3300046694 Bacteria 4265
184 Ga0495600_0027551 3300046809 Bacteria 3672
185 Ga0495660_0016696 3300046810 Bacteria 4231
186 Ga0495604_0037412 3300047317 Bacteria 3822
187 Ga0495672_0029724 3300047320 Bacteria 3437
188 Ga0495677_0068923 3300047445 Bacteria 1317
189 Ga0495686_0014914 3300047472 Bacteria 5332
190 Ga0495686_0078572 3300047472 Bacteria 2019
191 Ga0495615_0032948 3300048090 Bacteria 1252
192 Ga0496102_0019790 3300048905 Bacteria 5933
193 Ga0496103_0058955 3300048906 Bacteria 2385
194 Ga0496116_0000380 3300048919 Bacteria 65998
195 Ga0496116_0000579 3300048919 Bacteria 48897
196 Ga0496116_0003445 3300048919 Bacteria 15617
197 Ga0496116_0003583 3300048919 Bacteria 15267
198 Ga0496116_0005245 3300048919 Bacteria 12113
199 Ga0496116_0005670 3300048919 Bacteria 11496
200 Ga0496116_0015307 3300048919 Bacteria 6067
201 Ga0496117_0001510 3300048920 Bacteria 33334
202 Ga0496117_0010083 3300048920 Bacteria 8675
203 Ga0496117_0089778 3300048920 Bacteria 1983
204 Ga0496118_0001956 3300048921 Bacteria 29198
205 Ga0496118_0002702 3300048921 Bacteria 23375
206 Ga0496118_0012005 3300048921 Bacteria 8371
207 Ga0496119_0001482 3300048922 Bacteria 28129
208 Ga0496119_0007327 3300048922 Bacteria 9980
209 Ga0496119_0108299 3300048922 Bacteria 1547
210 Ga0496120_0000043 3300048923 Bacteria 195584
211 Ga0496120_0017475 3300048923 Bacteria 4650
212 Ga0496121_0001176 3300048924 Bacteria 45820
213 Ga0496121_0001683 3300048924 Bacteria 36357
214 Ga0496121_0002903 3300048924 Bacteria 25156
215 Ga0496121_0026786 3300048924 Bacteria 5417
216 Ga0496121_0065194 3300048924 Bacteria 2965
217 Ga0496121_0127267 3300048924 Bacteria 1913
218 Ga0496122_0005369 3300048925 Bacteria 15305
219 Ga0496122_0007429 3300048925 Bacteria 12184
220 Ga0496122_0071309 3300048925 Bacteria 2477
221 Ga0496123_0020066 3300048926 Bacteria 5243
222 Ga0496123_0053082 3300048926 Bacteria 2682
223 Ga0496123_0063759 3300048926 Bacteria 2352
224 Ga0496124_0000091 3300048927 Bacteria 189706
225 Ga0496124_0001332 3300048927 Bacteria 37075
226 Ga0496124_0001996 3300048927 Bacteria 27794
227 Ga0496124_0017770 3300048927 Bacteria 6688
228 Ga0496124_0022867 3300048927 Bacteria 5723
229 Ga0496124_0041790 3300048927 Bacteria 3953
230 Ga0496124_0394760 3300048927 Bacteria 962
231 Ga0496125_0103671 3300048928 Bacteria 2086
232 Ga0496125_0193810 3300048928 Bacteria 1339
233 Ga0496126_0000293 3300048929 Bacteria 106340
234 Ga0496126_0318585 3300048929 Bacteria 1279
235 Ga0495678_038053 3300049459 Bacteria 1950
236 Ga0501034_0134067 3300049571 Bacteria 2458
237 Ga0501034_0148713 3300049571 Bacteria 2318
238 Ga0501036_0071616 3300049572 Bacteria 2930
239 Ga0501036_0158197 3300049572 Bacteria 1911
240 Ga0501038_0250934 3300049574 Bacteria 1402
241 Ga0501039_0017184 3300049575 Bacteria 5547
242 Ga0501039_0137225 3300049575 Bacteria 1921
243 Ga0501040_0118584 3300049576 Bacteria 1856
244 Ga0501043_0034868 3300049579 Bacteria 3957
245 Ga0501046_0065788 3300049580 Bacteria 2827
246 Ga0501048_0014876 3300049582 Bacteria 5753
247 Ga0501067_0083388 3300049583 Bacteria 1773
248 Ga0501068_0029933 3300049584 Bacteria 3228
249 Ga0501069_0102999 3300049585 Bacteria 1621
250 Ga0501070_0055322 3300049586 Bacteria 3288
251 Ga0501071_0139779 3300049587 Bacteria 1803
252 Ga0501044_0367818 3300049823 Bacteria 1355
253 Ga0501045_0033920 3300049824 Bacteria 3703
254 nmdc:mga03n38_26178_c1 3300050490 Bacteria 2406
255 nmdc:mga00v17_42_c1 3300050491 Bacteria 79984
256 nmdc:mga00v17_77683_c1 3300050491 Bacteria 2067
257 nmdc:mga0yw44_88073_c1 3300050492 Bacteria 1957
258 nmdc:mga0k408_37975_c1 3300050493 Bacteria 2765
259 nmdc:mga06z11_2203_c1 3300050494 Bacteria 7401
260 nmdc:mga06z11_23285_c1 3300050494 Bacteria 2907
261 nmdc:mga07m45_20871_c1 3300050496 Bacteria 3561
262 Ga0500578_0114580 3300053086 Bacteria 1697
263 Ga0500650_0077277 3300053098 Bacteria 1556
264 Ga0500569_001346 3300053109 Bacteria 4603
265 Ga0500572_000942 3300053111 Bacteria 8854
266 Ga0500594_0002548 3300053118 Bacteria 3965
267 Ga0500618_000908 3300053125 Bacteria 15486
268 Ga0500618_007661 3300053125 Bacteria 3063
269 Ga0500618_023287 3300053125 Bacteria 1500
270 Ga0500559_0037883 3300053136 Bacteria 2092
271 Ga0500568_0001264 3300053139 Bacteria 16716
272 Ga0500590_000091 3300053148 Bacteria 23692
273 Ga0500616_0010238 3300053153 Bacteria 5622
274 Ga0500616_0015043 3300053153 Bacteria 4433
275 Ga0500622_0099493 3300053156 Bacteria 1434
276 Ga0500633_0074437 3300053160 Bacteria 1219
277 Ga0500634_0008432 3300053161 Bacteria 5153
278 Ga0500636_0000012 3300053177 Bacteria 132207
279 Ga0500636_0000639 3300053177 Bacteria 18889
280 Ga0500599_011952 3300053736 Bacteria 1162

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049585 Ga0501069_0102999 Ga0501069_0102999_26_910 225
2 3300046660 Ga0495625_0139342 Ga0495625_0139342_785_1609 231
3 3300050492 nmdc:mga0yw44_88073_c1 nmdc:mga0yw44_88073_c1_44_868 231
4 3300050496 nmdc:mga07m45_20871_c1 nmdc:mga07m45_20871_c1_1154_1978 231
5 3300053156 Ga0500622_0099493 Ga0500622_0099493_590_1423 234
6 3300046501 Ga0495607_0050193 Ga0495607_0050193_1558_2412 238
7 3300053736 Ga0500599_011952 Ga0500599_011952_279_1133 238
8 3300005262 Ga0065165_1000139 Ga0065165_10001393 241
9 3300009098 Ga0105245_10146584 Ga0105245_101465842 241
10 3300009148 Ga0105243_10018245 Ga0105243_100182454 241
11 3300014745 Ga0157377_10106091 Ga0157377_101060912 241
12 3300025284 Ga0209130_1000148 Ga0209130_100014891 241
13 3300025302 Ga0207426_1008169 Ga0207426_10081693 241
14 3300049575 Ga0501039_0137225 Ga0501039_0137225_996_1871 247
15 3300028794 Ga0307515_10000997 Ga0307515_1000099712 249
16 3300031649 Ga0307514_10003051 Ga0307514_100030518 249
17 3300048927 Ga0496124_0394760 Ga0496124_0394760_26_904 252
18 3300031852 Ga0307410_10245028 Ga0307410_102450282 253
19 3300049823 Ga0501044_0367818 Ga0501044_0367818_387_1316 256
20 3300001989 JGI24739J22299_10019552 JGI24739J22299_100195523 258
21 3300006186 Ga0075369_10124746 Ga0075369_101247462 259
22 iso_pu_bacteria 2811994878 2812348002 259
23 iso_pu_bacteria 2802429296 2804844058 261
24 iso_pu_bacteria 8025413630 8025419453 261
25 iso_pu_bacteria 2919408235 2919412629 262
26 3300003215 JGI25153J46596_10000553 JGI25153J46596_100005538 264
27 3300003790 Ga0055528_1008833 Ga0055528_10088334 264
28 3300003792 Ga0055540_1022141 Ga0055540_10221412 264
29 3300013104 Ga0157370_10000320 Ga0157370_1000032016 264
30 3300025273 Ga0209673_1004631 Ga0209673_10046314 264
31 3300025297 Ga0209758_1001264 Ga0209758_100126415 264
32 3300025303 Ga0209051_1026433 Ga0209051_10264332 264
33 3300028794 Ga0307515_10005985 Ga0307515_1000598518 264
34 3300031456 Ga0307513_10007297 Ga0307513_1000729710 264
35 3300041458 Ga0451798_0595955 Ga0451798_0595955_291_1220 264
36 3300041494 Ga0451837_0009909 Ga0451837_0009909_2477_3406 264
37 3300041496 Ga0451839_0091602 Ga0451839_0091602_613_1542 264
38 3300041503 Ga0451847_0223037 Ga0451847_0223037_1189_2118 264
39 3300041509 Ga0451843_0023281 Ga0451843_0023281_1197_2126 264
40 3300041511 Ga0451855_0238634 Ga0451855_0238634_134_1063 264
41 3300046452 Ga0495617_071138 Ga0495617_071138_156_1085 264
42 3300046474 Ga0495605_0042644 Ga0495605_0042644_1180_2109 264
43 3300046506 Ga0495583_0083101 Ga0495583_0083101_230_1159 264
44 3300046512 Ga0495610_0008975 Ga0495610_0008975_3503_4432 264
45 3300046515 Ga0495620_0001324 Ga0495620_0001324_10672_11601 264
46 3300046522 Ga0495643_0008302 Ga0495643_0008302_518_1447 264
47 3300046542 Ga0495597_0067924 Ga0495597_0067924_330_1259 264
48 3300046558 Ga0495633_0013750 Ga0495633_0013750_155_1084 264
49 3300046616 Ga0495668_0030011 Ga0495668_0030011_479_1408 264
50 3300046660 Ga0495625_0032066 Ga0495625_0032066_1968_2897 264
51 3300046665 Ga0495661_0044992 Ga0495661_0044992_415_1344 264
52 3300046691 Ga0495670_0069628 Ga0495670_0069628_391_1320 264
53 3300046694 Ga0495649_0015950 Ga0495649_0015950_913_1842 264
54 3300047472 Ga0495686_0014914 Ga0495686_0014914_1908_2837 264
55 3300048090 Ga0495615_0032948 Ga0495615_0032948_168_1097 264
56 3300049459 Ga0495678_038053 Ga0495678_038053_439_1368 264
57 3300049571 Ga0501034_0134067 Ga0501034_0134067_647_1573 264
58 3300049572 Ga0501036_0071616 Ga0501036_0071616_913_1839 264
59 3300049575 Ga0501039_0017184 Ga0501039_0017184_2339_3265 264
60 3300049576 Ga0501040_0118584 Ga0501040_0118584_90_1016 264
61 3300049579 Ga0501043_0034868 Ga0501043_0034868_1940_2866 264
62 3300049580 Ga0501046_0065788 Ga0501046_0065788_1255_2181 264
63 3300049582 Ga0501048_0014876 Ga0501048_0014876_2543_3469 264
64 3300049583 Ga0501067_0083388 Ga0501067_0083388_39_965 264
65 3300049584 Ga0501068_0029933 Ga0501068_0029933_662_1588 264
66 3300049586 Ga0501070_0055322 Ga0501070_0055322_808_1734 264
67 3300049587 Ga0501071_0139779 Ga0501071_0139779_359_1285 264
68 3300049824 Ga0501045_0033920 Ga0501045_0033920_2259_3185 264
69 3300053086 Ga0500578_0114580 Ga0500578_0114580_203_1132 264
70 3300053109 Ga0500569_001346 Ga0500569_001346_3237_4166 264
71 3300053153 Ga0500616_0010238 Ga0500616_0010238_4176_5105 264
72 3300046459 Ga0495629_0003787 Ga0495629_0003787_8448_9371 265
73 3300046557 Ga0495622_0000783 Ga0495622_0000783_6765_7688 265
74 3300046809 Ga0495600_0027551 Ga0495600_0027551_2656_3579 265
75 3300053148 Ga0500590_000091 Ga0500590_000091_3699_4622 265
76 iso_pu_bacteria 2738543024 2739310896 265
77 3300002773 JGI25152J39213_1010347 JGI25152J39213_10103472 266
78 3300003187 JGI25151J46595_10000383 JGI25151J46595_1000038330 266
79 3300003215 JGI25153J46596_10001502 JGI25153J46596_100015027 266
80 3300003354 JGI25160J50197_1004068 JGI25160J50197_10040684 266
81 3300003374 JGI25161J50226_1006167 JGI25161J50226_10061672 266
82 3300004625 Ga0055543_1000365 Ga0055543_10003656 266
83 3300006178 Ga0075367_10024048 Ga0075367_100240483 266
84 3300006353 Ga0075370_10003432 Ga0075370_100034324 266
85 3300025245 Ga0207425_1006263 Ga0207425_10062632 266
86 3300025258 Ga0209129_1000548 Ga0209129_10005486 266
87 3300025294 Ga0209025_1000397 Ga0209025_100039720 266
88 3300025295 Ga0209564_1000511 Ga0209564_100051161 266
89 3300025297 Ga0209758_1001362 Ga0209758_10013628 266
90 3300025299 Ga0209256_1013939 Ga0209256_10139391 266
91 3300025302 Ga0207426_1000355 Ga0207426_100035511 266
92 3300025303 Ga0209051_1006630 Ga0209051_10066304 266
93 3300025303 Ga0209051_1014963 Ga0209051_10149633 266
94 3300027866 Ga0209813_10023730 Ga0209813_100237302 266
95 3300041511 Ga0451855_1137795 Ga0451855_1137795_431_1360 266
96 3300046471 Ga0495650_0014044 Ga0495650_0014044_361_1290 266
97 3300048919 Ga0496116_0000380 Ga0496116_0000380_49489_50412 266
98 3300048924 Ga0496121_0026786 Ga0496121_0026786_3758_4684 266
99 3300048925 Ga0496122_0071309 Ga0496122_0071309_1464_2387 266
100 3300048927 Ga0496124_0041790 Ga0496124_0041790_1447_2373 266
101 3300048929 Ga0496126_0000293 Ga0496126_0000293_37396_38319 266
102 3300050490 nmdc:mga03n38_26178_c1 nmdc:mga03n38_26178_c1_1309_2238 266
103 3300050493 nmdc:mga0k408_37975_c1 nmdc:mga0k408_37975_c1_71_1000 266
104 3300050494 nmdc:mga06z11_23285_c1 nmdc:mga06z11_23285_c1_840_1769 266
105 iso_pu_bacteria 2765235802 2765467410 266
106 iso_pu_bacteria 2904578770 2904581763 266
107 iso_pu_bacteria 2919119836 2919123430 266
108 3300037466 Ga0395898_0091647 Ga0395898_0091647_1383_2318 267
109 3300050491 nmdc:mga00v17_77683_c1 nmdc:mga00v17_77683_c1_623_1555 267
110 3300009766 Ga0123342_1024778 Ga0123342_10247784 268
111 3300041501 Ga0451845_0737045 Ga0451845_0737045_131_1084 268
112 3300047317 Ga0495604_0037412 Ga0495604_0037412_189_1082 268
113 3300048924 Ga0496121_0127267 Ga0496121_0127267_753_1679 268
114 3300048927 Ga0496124_0000091 Ga0496124_0000091_119686_120618 268
115 iso_pu_bacteria 2643221736 2644744662 268
116 iso_pu_bacteria 2841760612 2841763122 268
117 iso_pu_bacteria 2844104063 2844109008 268
118 iso_pu_bacteria 2851182111 2851182363 268
119 iso_pu_bacteria 2851246043 2851251115 268
120 iso_pu_bacteria 2917699015 2917702658 268
121 iso_pu_bacteria 8057529695 8057534958 268
122 3300048919 Ga0496116_0000579 Ga0496116_0000579_13845_14798 269
123 3300048922 Ga0496119_0001482 Ga0496119_0001482_26026_26979 269
124 3300048923 Ga0496120_0000043 Ga0496120_0000043_75272_76225 269
125 3300053125 Ga0500618_000908 Ga0500618_000908_9474_10409 269
126 iso_pu_bacteria 2884298095 2884301283 270
127 3300013105 Ga0157369_10200614 Ga0157369_102006142 271
128 3300046512 Ga0495610_0009697 Ga0495610_0009697_2901_3836 271
129 3300047472 Ga0495686_0078572 Ga0495686_0078572_964_1899 271
130 3300002773 JGI25152J39213_1006956 JGI25152J39213_10069561 272
131 3300002774 JGI25150J39212_1009197 JGI25150J39212_10091972 272
132 3300003215 JGI25153J46596_10016268 JGI25153J46596_100162683 272
133 3300005262 Ga0065165_1001369 Ga0065165_100136915 272
134 3300006038 Ga0075365_10069128 Ga0075365_100691283 272
135 3300006178 Ga0075367_10003902 Ga0075367_100039026 272
136 3300025245 Ga0207425_1000753 Ga0207425_100075317 272
137 3300025258 Ga0209129_1000962 Ga0209129_100096217 272
138 3300025297 Ga0209758_1002029 Ga0209758_10020295 272
139 3300025927 Ga0207687_10090745 Ga0207687_100907452 272
140 3300050494 nmdc:mga06z11_2203_c1 nmdc:mga06z11_2203_c1_1684_2610 272
141 3300053177 Ga0500636_0000012 Ga0500636_0000012_74201_75133 272
142 iso_pu_bacteria 2738541294 2738811900 272
143 iso_pu_bacteria 2738541309 2738899260 272
144 iso_pu_bacteria 2874123672 2874127847 272
145 iso_pu_bacteria 2508501114 2509076017 273
146 3300003775 Ga0055524_1007531 Ga0055524_10075312 274
147 3300003790 Ga0055528_1000745 Ga0055528_10007459 274
148 3300025273 Ga0209673_1000005 Ga0209673_1000005643 274
149 3300025292 Ga0209676_1030582 Ga0209676_10305822 274
150 3300025294 Ga0209025_1017245 Ga0209025_10172452 274
151 3300025295 Ga0209564_1022190 Ga0209564_10221902 274
152 3300025299 Ga0209256_1005014 Ga0209256_10050144 274
153 iso_pu_bacteria 2585427634 2586004346 274
154 iso_pu_bacteria 2643221568 2643854968 274
155 iso_pu_bacteria 2919166419 2919170697 274
156 iso_pu_bacteria 2978969890 2978970158 274
157 iso_pu_bacteria 2984587000 2984587185 274
158 iso_pu_bacteria 8054460903 8054464373 274
159 3300049571 Ga0501034_0148713 Ga0501034_0148713_845_1804 275
160 3300049572 Ga0501036_0158197 Ga0501036_0158197_197_1156 275
161 3300049574 Ga0501038_0250934 Ga0501038_0250934_126_1085 275
162 iso_pu_bacteria 2510917028 2511186273 275
163 iso_pu_bacteria 2582581866 2585397391 275
164 iso_pu_bacteria 2585427633 2585993561 275
165 iso_pu_bacteria 2818991461 2819686863 275
166 iso_pu_bacteria 2821123053 2821129642 275
167 iso_pu_bacteria 2857531043 2857535994 275
168 iso_pu_bacteria 8018150411 8018155195 275
169 3300046474 Ga0495605_0003391 Ga0495605_0003391_3779_4747 276
170 3300046506 Ga0495583_0023877 Ga0495583_0023877_212_1180 276
171 3300046518 Ga0495631_0007668 Ga0495631_0007668_2776_3744 276
172 3300046519 Ga0495632_0006181 Ga0495632_0006181_3666_4634 276
173 3300046616 Ga0495668_0015155 Ga0495668_0015155_831_1799 276
174 3300046648 Ga0495611_0003083 Ga0495611_0003083_3753_4721 276
175 3300046660 Ga0495625_0022215 Ga0495625_0022215_3748_4716 276
176 3300046691 Ga0495670_0022316 Ga0495670_0022316_2085_3053 276
177 3300046810 Ga0495660_0016696 Ga0495660_0016696_1599_2567 276
178 3300047445 Ga0495677_0068923 Ga0495677_0068923_22_990 276
179 3300053118 Ga0500594_0002548 Ga0500594_0002548_2155_3123 276
180 3300053160 Ga0500633_0074437 Ga0500633_0074437_156_1124 276
181 iso_pu_bacteria 2513237084 2513568124 276
182 iso_pu_bacteria 2513237093 2513631075 276
183 iso_pu_bacteria 2513237103 2513711020 276
184 iso_pu_bacteria 2513237162 2514021175 276
185 iso_pu_bacteria 2515075009 2515108542 276
186 iso_pu_bacteria 2515154113 2515632289 276
187 iso_pu_bacteria 2515154114 2515643455 276
188 iso_pu_bacteria 2515154116 2515658278 276
189 iso_pu_bacteria 2515154134 2515738051 276
190 iso_pu_bacteria 2516653077 2517041265 276
191 iso_pu_bacteria 2516653085 2517080112 276
192 iso_pu_bacteria 2517093000 2517098103 276
193 iso_pu_bacteria 2517287029 2517410123 276
194 iso_pu_bacteria 2529292951 2530644655 276
195 iso_pu_bacteria 2582581304 2585255652 276
196 iso_pu_bacteria 2585427526 2585525643 276
197 iso_pu_bacteria 2585427528 2585538744 276
198 iso_pu_bacteria 2585427593 2585836695 276
199 iso_pu_bacteria 2724679232 2725947902 276
200 iso_pu_bacteria 2738541333 2739034166 276
201 iso_pu_bacteria 2765235942 2766069381 276
202 iso_pu_bacteria 2791355266 2793358202 276
203 iso_pu_bacteria 2802429633 2806042964 276
204 iso_pu_bacteria 2802429634 2806050917 276
205 iso_pu_bacteria 2802429635 2806057915 276
206 iso_pu_bacteria 2802429636 2806065371 276
207 iso_pu_bacteria 2802429637 2806076855 276
208 iso_pu_bacteria 2838686498 2838687534 276
209 iso_pu_bacteria 2838729681 2838734054 276
210 iso_pu_bacteria 2838742623 2838746506 276
211 iso_pu_bacteria 2841851746 2841854083 276
212 iso_pu_bacteria 2842110456 2842111250 276
213 iso_pu_bacteria 2842156927 2842159550 276
214 iso_pu_bacteria 2842163707 2842163995 276
215 iso_pu_bacteria 2842180545 2842182880 276
216 iso_pu_bacteria 2842217011 2842221523 276
217 iso_pu_bacteria 2842229732 2842232591 276
218 iso_pu_bacteria 2842243621 2842247165 276
219 iso_pu_bacteria 2842257432 2842259148 276
220 iso_pu_bacteria 2842271015 2842272433 276
221 iso_pu_bacteria 2842304105 2842309777 276
222 iso_pu_bacteria 2844454524 2844460529 276
223 iso_pu_bacteria 2857516855 2857518104 276
224 iso_pu_bacteria 2933570622 2933576219 276
225 iso_pu_bacteria 2933586486 2933587803 276
226 iso_pu_bacteria 2935901341 2935903097 276
227 iso_pu_bacteria 2936367885 2936374337 276
228 iso_pu_bacteria 2936375103 2936375155 276
229 iso_pu_bacteria 8005307578 8005307866 276
230 iso_pu_bacteria 8005376324 8005379861 276
231 iso_pu_bacteria 8005460587 8005467284 276
232 iso_pu_bacteria 8005556819 8005559418 276
233 iso_pu_bacteria 8005563573 8005565448 276
234 iso_pu_bacteria 8005570704 8005575817 276
235 iso_pu_bacteria 8018163183 8018165583 276
236 iso_pu_bacteria 8023680758 8023688031 276
237 iso_pu_bacteria 8024479707 8024484961 276
238 iso_pu_bacteria 8057874678 8057877942 276
239 3300041507 Ga0451851_0840181 Ga0451851_0840181_323_1276 277
240 3300046460 Ga0495638_0000035 Ga0495638_0000035_256555_257523 277
241 3300047320 Ga0495672_0029724 Ga0495672_0029724_1530_2498 277
242 3300053098 Ga0500650_0077277 Ga0500650_0077277_147_1115 277
243 3300053139 Ga0500568_0001264 Ga0500568_0001264_6465_7433 277
244 3300053153 Ga0500616_0015043 Ga0500616_0015043_2011_2979 277
245 iso_pu_bacteria 2585427594 2585842399 277
246 iso_pu_bacteria 2738541293 2738802617 277
247 iso_pu_bacteria 3005416602 3005421201 277
248 iso_pu_bacteria 8005314921 8005319064 277
249 3300006051 Ga0075364_10236449 Ga0075364_102364492 278
250 3300006195 Ga0075366_10181117 Ga0075366_101811171 278
251 3300048920 Ga0496117_0089778 Ga0496117_0089778_717_1640 278
252 3300048926 Ga0496123_0063759 Ga0496123_0063759_583_1506 278
253 3300053111 Ga0500572_000942 Ga0500572_000942_864_1787 278
254 3300053177 Ga0500636_0000639 Ga0500636_0000639_10360_11283 278
255 iso_pu_bacteria 2508501050 2508728287 278
256 iso_pu_bacteria 2508501114 2509075778 278
257 iso_pu_bacteria 2510917030 2511195069 278
258 iso_pu_bacteria 2513237138 2513868283 278
259 iso_pu_bacteria 2582581298 2585221948 278
260 iso_pu_bacteria 2582581867 2585404283 278
261 iso_pu_bacteria 2585427529 2585543882 278
262 iso_pu_bacteria 2585427590 2585823213 278
263 iso_pu_bacteria 2585427592 2585831181 278
264 iso_pu_bacteria 2599185156 2599334150 278
265 iso_pu_bacteria 2738541317 2738944818 278
266 iso_pu_bacteria 2775506901 2776259865 278
267 iso_pu_bacteria 2835312727 2835317019 278
268 iso_pu_bacteria 2842922631 2842925569 278
269 iso_pu_bacteria 2852103415 2852103730 278
270 iso_pu_bacteria 2913308742 2913309439 278
271 iso_pu_bacteria 2919100787 2919103099 278
272 iso_pu_bacteria 2933016740 2933022907 278
273 iso_pu_bacteria 3005445848 3005451712 278
274 3300006051 Ga0075364_10000058 Ga0075364_1000005836 279
275 3300032004 Ga0307414_10103542 Ga0307414_101035422 279
276 3300046515 Ga0495620_0007409 Ga0495620_0007409_3154_4080 279
277 3300048919 Ga0496116_0003583 Ga0496116_0003583_5083_6024 279
278 3300048919 Ga0496116_0005670 Ga0496116_0005670_9793_10734 279
279 3300048924 Ga0496121_0001176 Ga0496121_0001176_29345_30286 279
280 3300048924 Ga0496121_0001683 Ga0496121_0001683_19318_20247 279
281 3300048927 Ga0496124_0017770 Ga0496124_0017770_5545_6486 279
282 3300048927 Ga0496124_0022867 Ga0496124_0022867_1681_2622 279
283 3300048929 Ga0496126_0318585 Ga0496126_0318585_300_1241 279
284 3300050491 nmdc:mga00v17_42_c1 nmdc:mga00v17_42_c1_40859_41788 279
285 iso_pu_bacteria 2511231027 2511388762 279
286 iso_pu_bacteria 2838029111 2838032795 279
287 iso_pu_bacteria 2842475841 2842479527 279
288 iso_pu_bacteria 2842502639 2842506807 279
289 3300046501 Ga0495607_0029547 Ga0495607_0029547_2104_3033 280
290 3300046519 Ga0495632_0002480 Ga0495632_0002480_4923_5852 280
291 3300053125 Ga0500618_023287 Ga0500618_023287_492_1421 280
292 iso_pu_bacteria 2513237144 2513911914 280
293 iso_pu_bacteria 2513237146 2513929209 280
294 iso_pu_bacteria 2582581299 2585229429 280
295 iso_pu_bacteria 2599185170 2599415562 280
296 iso_pu_bacteria 2671180139 2671694750 280
297 iso_pu_bacteria 2838035591 2838035680 280
298 iso_pu_bacteria 2838661181 2838665263 280
299 3300002773 JGI25152J39213_1000209 JGI25152J39213_100020911 281
300 3300002774 JGI25150J39212_1000101 JGI25150J39212_100010115 281
301 3300003187 JGI25151J46595_10000085 JGI25151J46595_1000008532 281
302 3300003215 JGI25153J46596_10014200 JGI25153J46596_100142001 281
303 3300009036 Ga0105244_10000006 Ga0105244_10000006208 281
304 3300025245 Ga0207425_1000065 Ga0207425_100006530 281
305 3300025258 Ga0209129_1000132 Ga0209129_100013230 281
306 3300025294 Ga0209025_1000247 Ga0209025_100024730 281
307 3300025297 Ga0209758_1000212 Ga0209758_100021230 281
308 3300031731 Ga0307405_10133754 Ga0307405_101337542 281
309 3300048919 Ga0496116_0003445 Ga0496116_0003445_8179_9111 281
310 3300048919 Ga0496116_0015307 Ga0496116_0015307_2122_3054 281
311 3300048920 Ga0496117_0010083 Ga0496117_0010083_5106_6038 281
312 3300048921 Ga0496118_0002702 Ga0496118_0002702_16160_17092 281
313 3300048921 Ga0496118_0012005 Ga0496118_0012005_6654_7586 281
314 3300048922 Ga0496119_0108299 Ga0496119_0108299_462_1394 281
315 3300048924 Ga0496121_0065194 Ga0496121_0065194_1980_2912 281
316 3300048925 Ga0496122_0007429 Ga0496122_0007429_6016_6948 281
317 3300048926 Ga0496123_0020066 Ga0496123_0020066_3092_4024 281
318 3300048926 Ga0496123_0053082 Ga0496123_0053082_1200_2132 281
319 3300048927 Ga0496124_0001332 Ga0496124_0001332_8924_9856 281
320 3300048928 Ga0496125_0103671 Ga0496125_0103671_635_1567 281
321 iso_pu_bacteria 2509276021 2509390440 281
322 iso_pu_bacteria 2510917022 2511132652 281
323 iso_pu_bacteria 2582581307 2585275536 281
324 iso_pu_bacteria 2582581308 2585278302 281
325 iso_pu_bacteria 2582581315 2585324856 281
326 iso_pu_bacteria 2585427527 2585532041 281
327 iso_pu_bacteria 2585427530 2585552401 281
328 iso_pu_bacteria 2585427531 2585562608 281
329 iso_pu_bacteria 2585427608 2585899277 281
330 iso_pu_bacteria 2585427609 2585906224 281
331 iso_pu_bacteria 2585428125 2587981646 281
332 iso_pu_bacteria 2615840626 2616307820 281
333 iso_pu_bacteria 2615840698 2616552407 281
334 iso_pu_bacteria 2617270742 2617381855 281
335 iso_pu_bacteria 2667528174 2671112843 281
336 iso_pu_bacteria 2767802442 2770196688 281
337 iso_pu_bacteria 2775507266 2778178326 281
338 iso_pu_bacteria 2818991448 2819607948 281
339 iso_pu_bacteria 2818991453 2819640286 281
340 iso_pu_bacteria 2838022645 2838029035 281
341 iso_pu_bacteria 2841864319 2841866238 281
342 iso_pu_bacteria 2842198810 2842205190 281
343 iso_pu_bacteria 2842341865 2842342135 281
344 iso_pu_bacteria 2842363717 2842365888 281
345 iso_pu_bacteria 2842482326 2842486939 281
346 iso_pu_bacteria 2852387548 2852394186 281
347 iso_pu_bacteria 8005484373 8005489615 281
348 iso_pu_bacteria 8005645114 8005650476 281
349 iso_pu_bacteria 8005682033 8005684132 281
350 iso_pu_bacteria 8046767195 8046772904 281
351 iso_pu_bacteria 8057575449 8057576358 281
352 3300002773 JGI25152J39213_1006992 JGI25152J39213_10069921 282
353 3300002773 JGI25152J39213_1008966 JGI25152J39213_10089664 282
354 3300002987 JGI25159J45721_1000765 JGI25159J45721_100076511 282
355 3300003215 JGI25153J46596_10016362 JGI25153J46596_100163623 282
356 3300003354 JGI25160J50197_1014805 JGI25160J50197_10148053 282
357 3300003374 JGI25161J50226_1000154 JGI25161J50226_10001545 282
358 3300003771 Ga0055526_1002237 Ga0055526_10022374 282
359 3300003775 Ga0055524_1003101 Ga0055524_10031015 282
360 3300003790 Ga0055528_1002344 Ga0055528_100234412 282
361 3300003792 Ga0055540_1009320 Ga0055540_10093203 282
362 3300004625 Ga0055543_1000513 Ga0055543_10005135 282
363 3300005262 Ga0065165_1021168 Ga0065165_10211681 282
364 3300009148 Ga0105243_10281725 Ga0105243_102817252 282
365 3300011119 Ga0105246_10073991 Ga0105246_100739912 282
366 3300025208 Ga0209436_100021 Ga0209436_1000215 282
367 3300025258 Ga0209129_1001002 Ga0209129_10010023 282
368 3300025273 Ga0209673_1003429 Ga0209673_100342910 282
369 3300025273 Ga0209673_1008106 Ga0209673_10081062 282
370 3300025284 Ga0209130_1000019 Ga0209130_100001975 282
371 3300025294 Ga0209025_1002744 Ga0209025_10027443 282
372 3300025295 Ga0209564_1001757 Ga0209564_10017575 282
373 3300025297 Ga0209758_1002190 Ga0209758_10021909 282
374 3300025302 Ga0207426_1000005 Ga0207426_1000005532 282
375 3300025901 Ga0207688_10061986 Ga0207688_100619862 282
376 3300025923 Ga0207681_10424617 Ga0207681_104246171 282
377 iso_pu_bacteria 2775506902 2776272718 282
378 iso_pu_bacteria 2775506904 2776284661 282
379 iso_pu_bacteria 2840764183 2840768781 282
380 3300046506 Ga0495583_0000972 Ga0495583_0000972_18365_19333 283
381 3300053161 Ga0500634_0008432 Ga0500634_0008432_877_1845 283
382 iso_pu_bacteria 2821443989 2821448088 283
383 3300025292 Ga0209676_1000026 Ga0209676_1000026404 284
384 3300025298 Ga0209050_1004960 Ga0209050_100496012 284
385 3300041413 Ga0439465_0009229 Ga0439465_0009229_915_1883 284
386 3300053136 Ga0500559_0037883 Ga0500559_0037883_136_1095 284
387 3300001979 JGI24740J21852_10009548 JGI24740J21852_100095484 285
388 3300002704 JGI25155J39150_1000003 JGI25155J39150_1000003272 285
389 3300002705 JGI25156J39149_1000004 JGI25156J39149_1000004266 285
390 3300002737 JGI25162J39368_1000114 JGI25162J39368_100011431 285
391 3300002737 JGI25162J39368_1000222 JGI25162J39368_100022237 285
392 3300002738 JGI25154J39366_1000088 JGI25154J39366_100008810 285
393 3300002741 JGI25157J39369_1000004 JGI25157J39369_100000410 285
394 3300003214 JGI25165J46597_1000232 JGI25165J46597_100023232 285
395 3300003214 JGI25165J46597_1000233 JGI25165J46597_100023326 285
396 3300003316 rootH1_10030109 rootH1_100301094 285
397 3300003322 rootL2_10009270 rootL2_100092702 285
398 3300005367 Ga0070667_100027677 Ga0070667_1000276771 285
399 3300005578 Ga0068854_100231120 Ga0068854_1002311202 285
400 3300005614 Ga0068856_100017286 Ga0068856_1000172867 285
401 3300005616 Ga0068852_100281967 Ga0068852_1002819672 285
402 3300005834 Ga0068851_10172764 Ga0068851_101727642 285
403 3300006353 Ga0075370_10016298 Ga0075370_100162983 285
404 3300009093 Ga0105240_10000012 Ga0105240_10000012196 285
405 3300009177 Ga0105248_10221627 Ga0105248_102216273 285
406 3300009545 Ga0105237_10000941 Ga0105237_1000094112 285
407 3300010375 Ga0105239_10181064 Ga0105239_101810642 285
408 3300013104 Ga0157370_10002378 Ga0157370_100023786 285
409 3300014497 Ga0182008_10054396 Ga0182008_100543962 285
410 3300015262 Ga0182007_10006059 Ga0182007_100060593 285
411 3300015265 Ga0182005_1014839 Ga0182005_10148392 285
412 3300025206 Ga0209435_100006 Ga0209435_10000611 285
413 3300025233 Ga0209437_100022 Ga0209437_100022444 285
414 3300025233 Ga0209437_100040 Ga0209437_100040206 285
415 3300025246 Ga0209646_1000015 Ga0209646_1000015523 285
416 3300025250 Ga0209026_1000039 Ga0209026_100003911 285
417 3300025256 Ga0209759_1000005 Ga0209759_100000511 285
418 3300025261 Ga0209233_1000031 Ga0209233_1000031444 285
419 3300025261 Ga0209233_1000051 Ga0209233_1000051207 285
420 3300025261 Ga0209233_1000146 Ga0209233_100014615 285
421 3300025321 Ga0207656_10127439 Ga0207656_101274392 285
422 3300025913 Ga0207695_10000120 Ga0207695_1000012017 285
423 3300025914 Ga0207671_10000023 Ga0207671_1000002368 285
424 3300025986 Ga0207658_10019123 Ga0207658_100191231 285
425 3300026078 Ga0207702_10049088 Ga0207702_100490883 285
426 3300027312 Ga0209371_1003015 Ga0209371_10030152 285
427 3300030500 Ga0268256_1002669 Ga0268256_10026693 285
428 3300044765 Ga0466970_0001826 Ga0466970_0001826_559_1503 285
429 3300048905 Ga0496102_0019790 Ga0496102_0019790_4433_5377 285
430 3300048906 Ga0496103_0058955 Ga0496103_0058955_748_1692 285
431 3300048919 Ga0496116_0005245 Ga0496116_0005245_4259_5203 285
432 3300048920 Ga0496117_0001510 Ga0496117_0001510_19743_20687 285
433 3300048921 Ga0496118_0001956 Ga0496118_0001956_19731_20675 285
434 3300048922 Ga0496119_0007327 Ga0496119_0007327_2269_3213 285
435 3300048923 Ga0496120_0017475 Ga0496120_0017475_1566_2510 285
436 3300048924 Ga0496121_0002903 Ga0496121_0002903_8551_9495 285
437 3300048925 Ga0496122_0005369 Ga0496122_0005369_4948_5892 285
438 3300048927 Ga0496124_0001996 Ga0496124_0001996_20083_21027 285
439 3300048928 Ga0496125_0193810 Ga0496125_0193810_72_1016 285
440 3300053125 Ga0500618_007661 Ga0500618_007661_625_1569 285

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

86

287

0.93

Feature Viewer

pLDDT pTM Quality
68.2 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map