F444523

General Info

Members Datasets Scaffolds Average Seq Length
440 238 880 143

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_0292437|Ga0501072_0292437_531_1067
Length 161
Sequence MTIAMLSLVGILIALYLTLYKLGVIGGLTCTVGSCETVNTSRWATFLGLPVAAWGVGAYVALFALSLAGTADRHAGSQTISVLLVAIAAWSVLFSAWLTYLELFVIRAICIWCVASAVLLVAILVVSVMDWRGSSRDSGFRVASLPQNDRSDQAVNLPGVV

Samples

Sample ID Description Type Environment
1 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
151 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
152 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
153 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
154 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
155 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
161 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
162 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
163 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
164 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
205 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
206 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
207 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
208 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
209 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
210 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
211 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
212 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
213 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
214 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
215 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
216 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
217 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
218 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
219 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
220 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
221 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
222 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
223 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
224 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
227 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
228 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
229 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
230 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.05
Rhizosphere 97.73
Stem 0
Stem Tuber 0
Unclassified 26.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501072_0292437 3300049588 Bacteria 1295
2 Ga0065715_10014827 3300005293 Bacteria 2936
3 Ga0070658_10121793 3300005327 Bacteria 2168
4 Ga0070658_10391916 3300005327 Bacteria 1192
5 Ga0070676_10789300 3300005328 Unclassified 700
6 Ga0070683_100041829 3300005329 Bacteria 4218
7 Ga0070683_100172572 3300005329 Bacteria 2053
8 Ga0070690_100029945 3300005330 Unclassified 3380
9 Ga0070690_100266149 3300005330 Unclassified 1218
10 Ga0070680_100004892 3300005336 Bacteria 10087
11 Ga0070680_100015411 3300005336 Bacteria 5992
12 Ga0070680_100066980 3300005336 Bacteria 2945
13 Ga0070680_100076663 3300005336 Bacteria 2752
14 Ga0070680_100094998 3300005336 Unclassified 2471
15 Ga0070680_100166474 3300005336 Bacteria 1854
16 Ga0070680_100285456 3300005336 Unclassified 1399
17 Ga0070680_100488600 3300005336 Bacteria 1053
18 Ga0070680_101219620 3300005336 Unclassified 651
19 Ga0070680_101407908 3300005336 Unclassified 604
20 Ga0070682_100017291 3300005337 Bacteria 4203
21 Ga0070682_100031567 3300005337 Bacteria 3204
22 Ga0070660_100113720 3300005339 Bacteria 2155
23 Ga0070660_100230675 3300005339 Bacteria 1506
24 Ga0070660_101481681 3300005339 Unclassified 577
25 Ga0070691_10097617 3300005341 Bacteria 1456
26 Ga0070687_100011484 3300005343 Unclassified 3876
27 Ga0070661_100011269 3300005344 Bacteria 6228
28 Ga0070692_10055637 3300005345 Bacteria 2069
29 Ga0070692_10098136 3300005345 Bacteria 1602
30 Ga0070692_10678694 3300005345 Bacteria 691
31 Ga0070692_11231511 3300005345 Bacteria 534
32 Ga0070668_100005834 3300005347 Bacteria 9130
33 Ga0070669_100000545 3300005353 Bacteria 28111
34 Ga0070669_100057586 3300005353 Bacteria 2851
35 Ga0070669_100213283 3300005353 Bacteria 1524
36 Ga0070669_100623916 3300005353 Bacteria 905
37 Ga0070675_100084217 3300005354 Unclassified 2655
38 Ga0070675_100453012 3300005354 Bacteria 1151
39 Ga0070675_100826472 3300005354 Bacteria 847
40 Ga0070671_100140409 3300005355 Bacteria 2038
41 Ga0070671_100209644 3300005355 Bacteria 1653
42 Ga0070671_100424931 3300005355 Unclassified 1138
43 Ga0070674_100039135 3300005356 Bacteria 3201
44 Ga0070674_100067621 3300005356 Unclassified 2514
45 Ga0070674_100187102 3300005356 Unclassified 1590
46 Ga0070673_100005173 3300005364 Bacteria 8329
47 Ga0070673_100088923 3300005364 Bacteria 2520
48 Ga0070673_101031482 3300005364 Unclassified 767
49 Ga0070659_101132670 3300005366 Unclassified 690
50 Ga0070667_100272632 3300005367 Bacteria 1517
51 Ga0070709_10004734 3300005434 Bacteria 7347
52 Ga0070700_100060809 3300005441 Bacteria 2381
53 Ga0070700_100151994 3300005441 Unclassified 1584
54 Ga0070700_100483432 3300005441 Bacteria 949
55 Ga0070694_100053647 3300005444 Unclassified 2729
56 Ga0070694_100072992 3300005444 Bacteria 2369
57 Ga0070708_100000089 3300005445 Bacteria 59378
58 Ga0070708_100795324 3300005445 Unclassified 889
59 Ga0070663_100004710 3300005455 Bacteria 8045
60 Ga0070663_100388274 3300005455 Bacteria 1138
61 Ga0070663_100389379 3300005455 Unclassified 1137
62 Ga0070678_100031309 3300005456 Bacteria 3668
63 Ga0070678_100410239 3300005456 Bacteria 1179
64 Ga0070678_101095705 3300005456 Bacteria 735
65 Ga0070662_100061960 3300005457 Bacteria 2732
66 Ga0070662_100067676 3300005457 Bacteria 2623
67 Ga0070662_101238847 3300005457 Bacteria 642
68 Ga0070681_10005428 3300005458 Bacteria 12316
69 Ga0070681_10005852 3300005458 Bacteria 11906
70 Ga0070681_10034253 3300005458 Bacteria 5100
71 Ga0070681_10103126 3300005458 Bacteria 2797
72 Ga0070681_10119705 3300005458 Unclassified 2569
73 Ga0070681_10127990 3300005458 Bacteria 2472
74 Ga0070681_10250758 3300005458 Bacteria 1683
75 Ga0070681_10301221 3300005458 Bacteria 1513
76 Ga0068867_100006955 3300005459 Bacteria 8003
77 Ga0068867_100019919 3300005459 Bacteria 4782
78 Ga0068867_100281493 3300005459 Bacteria 1364
79 Ga0070685_10324717 3300005466 Bacteria 1044
80 Ga0070706_100070190 3300005467 Unclassified 3240
81 Ga0070706_100145916 3300005467 Unclassified 2209
82 Ga0070707_100000317 3300005468 Bacteria 47396
83 Ga0070707_100149248 3300005468 Bacteria 2276
84 Ga0070707_100477540 3300005468 Unclassified 1208
85 Ga0070698_100082823 3300005471 Bacteria 3199
86 Ga0070698_100105365 3300005471 Bacteria 2790
87 Ga0070698_100669170 3300005471 Bacteria 980
88 Ga0070699_100219094 3300005518 Bacteria 1696
89 Ga0070699_100381950 3300005518 Unclassified 1272
90 Ga0070679_100002058 3300005530 Bacteria 18073
91 Ga0070679_100010345 3300005530 Bacteria 8846
92 Ga0070679_100011408 3300005530 Bacteria 8468
93 Ga0070679_100033707 3300005530 Bacteria 5070
94 Ga0070679_100061906 3300005530 Bacteria 3730
95 Ga0070679_100312231 3300005530 Unclassified 1522
96 Ga0070679_100545123 3300005530 Bacteria 1103
97 Ga0070684_100191373 3300005535 Bacteria 1862
98 Ga0070684_100368976 3300005535 Unclassified 1321
99 Ga0070684_100371625 3300005535 Bacteria 1316
100 Ga0068853_100106514 3300005539 Bacteria 2485
101 Ga0068853_102236669 3300005539 Unclassified 530
102 Ga0070672_100107245 3300005543 Bacteria 2273
103 Ga0070672_100348271 3300005543 Bacteria 1262
104 Ga0070672_100820522 3300005543 Bacteria 819
105 Ga0070686_100137723 3300005544 Bacteria 1696
106 Ga0070695_100466729 3300005545 Bacteria 970
107 Ga0070696_100001495 3300005546 Bacteria 15335
108 Ga0070696_100101259 3300005546 Bacteria 2064
109 Ga0070696_100148596 3300005546 Bacteria 1718
110 Ga0070696_100473597 3300005546 Bacteria 992
111 Ga0070696_100820015 3300005546 Bacteria 767
112 Ga0070693_100000716 3300005547 Bacteria 14629
113 Ga0070693_100154676 3300005547 Bacteria 1455
114 Ga0070693_100318246 3300005547 Bacteria 1055
115 Ga0070665_100022326 3300005548 Bacteria 6368
116 Ga0070704_100005456 3300005549 Bacteria 7409
117 Ga0068855_100181738 3300005563 Bacteria 2377
118 Ga0068855_100768670 3300005563 Bacteria 1026
119 Ga0070664_100020777 3300005564 Bacteria 5409
120 Ga0070664_100078786 3300005564 Bacteria 2834
121 Ga0070664_100307199 3300005564 Unclassified 1434
122 Ga0070664_100307498 3300005564 Unclassified 1434
123 Ga0070664_100384982 3300005564 Unclassified 1281
124 Ga0068857_100673466 3300005577 Bacteria 981
125 Ga0068854_100061187 3300005578 Bacteria 2726
126 Ga0068854_100393007 3300005578 Bacteria 1146
127 Ga0068854_101131591 3300005578 Bacteria 699
128 Ga0068854_101610370 3300005578 Unclassified 592
129 Ga0068856_100600505 3300005614 Unclassified 1122
130 Ga0068856_100784203 3300005614 Bacteria 973
131 Ga0068856_101237792 3300005614 Bacteria 762
132 Ga0068852_100073153 3300005616 Bacteria 3015
133 Ga0068859_100288454 3300005617 Bacteria 1734
134 Ga0068866_10007089 3300005718 Unclassified 4687
135 Ga0068861_100005892 3300005719 Bacteria 8330
136 Ga0068861_100678634 3300005719 Bacteria 955
137 Ga0068861_101003083 3300005719 Bacteria 797
138 Ga0068870_10012072 3300005840 Bacteria 4025
139 Ga0068862_100003812 3300005844 Bacteria 12844
140 Ga0081539_10000087 3300005985 Bacteria 214031
141 Ga0070716_100004829 3300006173 Bacteria 6477
142 Ga0097621_100747595 3300006237 Unclassified 903
143 Ga0097621_100818413 3300006237 Bacteria 864
144 Ga0075430_100006591 3300006846 Bacteria 9786
145 Ga0075430_100022145 3300006846 Bacteria 5402
146 Ga0075430_100080153 3300006846 Unclassified 2735
147 Ga0075431_100017492 3300006847 Bacteria 7287
148 Ga0075431_100102838 3300006847 Bacteria 2948
149 Ga0075431_100143347 3300006847 Bacteria 2462
150 Ga0075431_100357662 3300006847 Bacteria 1467
151 Ga0075431_100458407 3300006847 Unclassified 1270
152 Ga0075433_10001700 3300006852 Bacteria 16419
153 Ga0075433_11029587 3300006852 Bacteria 717
154 Ga0075434_100025029 3300006871 Bacteria 5838
155 Ga0075434_100914598 3300006871 Bacteria 892
156 Ga0075429_100049305 3300006880 Bacteria 3661
157 Ga0068865_100087136 3300006881 Bacteria 2256
158 Ga0068865_100346171 3300006881 Bacteria 1203
159 Ga0075436_100023633 3300006914 Unclassified 4222
160 Ga0097620_100288492 3300006931 Bacteria 1734
161 Ga0075435_100123621 3300007076 Bacteria 2161
162 Ga0075435_100215649 3300007076 Unclassified 1629
163 Ga0105240_10294011 3300009093 Bacteria 1861
164 Ga0105245_10109011 3300009098 Bacteria 2572
165 Ga0105245_11184414 3300009098 Bacteria 812
166 Ga0114129_10024727 3300009147 Bacteria 8514
167 Ga0114129_12100924 3300009147 Unclassified 681
168 Ga0105243_10221340 3300009148 Unclassified 1673
169 Ga0105241_10092049 3300009174 Bacteria 2394
170 Ga0105241_10164209 3300009174 Unclassified 1828
171 Ga0105248_10029350 3300009177 Bacteria 6136
172 Ga0105248_10253623 3300009177 Bacteria 1980
173 Ga0105248_10421611 3300009177 Unclassified 1503
174 Ga0105237_10071082 3300009545 Bacteria 3475
175 Ga0105238_10083430 3300009551 Bacteria 3185
176 Ga0105249_10000224 3300009553 Bacteria 64572
177 Ga0105249_10543240 3300009553 Bacteria 1212
178 Ga0157373_10195577 3300013100 Bacteria 1425
179 Ga0157371_10065245 3300013102 Bacteria 2579
180 Ga0157370_10061254 3300013104 Bacteria 3572
181 Ga0157369_10156137 3300013105 Bacteria 2410
182 Ga0157369_10285076 3300013105 Bacteria 1720
183 Ga0157374_10037521 3300013296 Bacteria 4448
184 Ga0157378_10029438 3300013297 Bacteria 4848
185 Ga0157378_10053531 3300013297 Unclassified 3593
186 Ga0157378_10240040 3300013297 Bacteria 1731
187 Ga0157378_10410427 3300013297 Bacteria 1336
188 Ga0157378_11840499 3300013297 Bacteria 654
189 Ga0163162_11164852 3300013306 Bacteria 874
190 Ga0163162_11677557 3300013306 Bacteria 726
191 Ga0157372_11346359 3300013307 Unclassified 823
192 Ga0157372_11654575 3300013307 Bacteria 737
193 Ga0157372_12646437 3300013307 Unclassified 576
194 Ga0157375_10056671 3300013308 Unclassified 3871
195 Ga0157375_10249624 3300013308 Bacteria 1935
196 Ga0157380_10043849 3300014326 Bacteria 3503
197 Ga0157380_12246359 3300014326 Unclassified 610
198 Ga0182008_10003068 3300014497 Bacteria 10259
199 Ga0157377_10523751 3300014745 Unclassified 833
200 Ga0157376_10796867 3300014969 Bacteria 957
201 Ga0163161_10217282 3300017792 Bacteria 1479
202 Ga0207682_10042841 3300025893 Unclassified 1850
203 Ga0207645_10011485 3300025907 Bacteria 6045
204 Ga0207645_10406492 3300025907 Unclassified 916
205 Ga0207643_10009044 3300025908 Bacteria 5349
206 Ga0207705_10031690 3300025909 Bacteria 3775
207 Ga0207705_10150981 3300025909 Bacteria 1741
208 Ga0207705_10223468 3300025909 Bacteria 1431
209 Ga0207684_10106264 3300025910 Bacteria 2401
210 Ga0207707_10004390 3300025912 Bacteria 12455
211 Ga0207707_10026589 3300025912 Bacteria 5058
212 Ga0207707_10057388 3300025912 Bacteria 3389
213 Ga0207707_10064161 3300025912 Bacteria 3197
214 Ga0207707_10103965 3300025912 Unclassified 2482
215 Ga0207707_10208934 3300025912 Bacteria 1701
216 Ga0207707_10258049 3300025912 Bacteria 1513
217 Ga0207707_10594488 3300025912 Bacteria 937
218 Ga0207707_10779064 3300025912 Bacteria 798
219 Ga0207671_10069671 3300025914 Bacteria 2621
220 Ga0207660_10012495 3300025917 Bacteria 5557
221 Ga0207660_10029564 3300025917 Bacteria 3760
222 Ga0207660_10203287 3300025917 Unclassified 1548
223 Ga0207660_10232990 3300025917 Bacteria 1448
224 Ga0207660_10517885 3300025917 Bacteria 968
225 Ga0207660_10550482 3300025917 Bacteria 938
226 Ga0207660_10687864 3300025917 Unclassified 834
227 Ga0207662_10011243 3300025918 Unclassified 4956
228 Ga0207657_10007873 3300025919 Bacteria 10875
229 Ga0207657_10211977 3300025919 Bacteria 1554
230 Ga0207657_10297041 3300025919 Unclassified 1280
231 Ga0207649_10691374 3300025920 Bacteria 790
232 Ga0207652_10003840 3300025921 Bacteria 12319
233 Ga0207652_10005503 3300025921 Bacteria 10272
234 Ga0207652_10010965 3300025921 Bacteria 7307
235 Ga0207652_10129534 3300025921 Unclassified 2249
236 Ga0207652_10144191 3300025921 Bacteria 2130
237 Ga0207652_10248074 3300025921 Bacteria 1605
238 Ga0207652_10970349 3300025921 Unclassified 748
239 Ga0207646_10007348 3300025922 Bacteria 11219
240 Ga0207646_10072200 3300025922 Bacteria 3083
241 Ga0207681_10006965 3300025923 Bacteria 6937
242 Ga0207681_10045151 3300025923 Unclassified 2957
243 Ga0207681_10047918 3300025923 Bacteria 2882
244 Ga0207694_10303214 3300025924 Bacteria 1315
245 Ga0207650_10135536 3300025925 Bacteria 1931
246 Ga0207650_10443055 3300025925 Bacteria 1080
247 Ga0207650_10895453 3300025925 Unclassified 753
248 Ga0207687_10970106 3300025927 Bacteria 728
249 Ga0207644_10174915 3300025931 Bacteria 1679
250 Ga0207644_10289985 3300025931 Unclassified 1316
251 Ga0207644_10294379 3300025931 Bacteria 1306
252 Ga0207690_11499802 3300025932 Unclassified 564
253 Ga0207706_10028510 3300025933 Unclassified 4987
254 Ga0207706_10051857 3300025933 Bacteria 3622
255 Ga0207706_10115919 3300025933 Bacteria 2356
256 Ga0207706_10282178 3300025933 Bacteria 1448
257 Ga0207669_10263207 3300025937 Bacteria 1291
258 Ga0207669_10961406 3300025937 Bacteria 716
259 Ga0207665_10003155 3300025939 Bacteria 11051
260 Ga0207691_10005767 3300025940 Bacteria 11986
261 Ga0207691_10014209 3300025940 Bacteria 7595
262 Ga0207691_10142599 3300025940 Bacteria 2110
263 Ga0207711_10060616 3300025941 Bacteria 3261
264 Ga0207711_10154976 3300025941 Bacteria 2070
265 Ga0207661_10012961 3300025944 Bacteria 6082
266 Ga0207679_10008649 3300025945 Bacteria 6489
267 Ga0207679_10016157 3300025945 Bacteria 4950
268 Ga0207667_10100833 3300025949 Bacteria 2978
269 Ga0207667_10117222 3300025949 Bacteria 2744
270 Ga0207667_10680977 3300025949 Bacteria 1032
271 Ga0207651_10216522 3300025960 Bacteria 1545
272 Ga0207651_10324964 3300025960 Bacteria 1287
273 Ga0207668_10397470 3300025972 Unclassified 1164
274 Ga0207640_10017898 3300025981 Bacteria 4153
275 Ga0207658_10191515 3300025986 Bacteria 1700
276 Ga0207677_10155156 3300026023 Bacteria 1772
277 Ga0207677_10324373 3300026023 Unclassified 1281
278 Ga0207677_10569492 3300026023 Bacteria 990
279 Ga0207639_10107835 3300026041 Unclassified 2263
280 Ga0207678_10001013 3300026067 Bacteria 25635
281 Ga0207678_10497476 3300026067 Bacteria 1062
282 Ga0207708_10025034 3300026075 Unclassified 4515
283 Ga0207708_10063233 3300026075 Unclassified 2827
284 Ga0207708_10226129 3300026075 Bacteria 1501
285 Ga0207702_10524895 3300026078 Bacteria 1156
286 Ga0207702_12421567 3300026078 Bacteria 512
287 Ga0207648_10015820 3300026089 Bacteria 6916
288 Ga0207648_10035536 3300026089 Bacteria 4389
289 Ga0207648_10193515 3300026089 Bacteria 1803
290 Ga0207674_10024667 3300026116 Bacteria 6421
291 Ga0207675_100037472 3300026118 Bacteria 4523
292 Ga0207675_100261230 3300026118 Bacteria 1678
293 Ga0207683_10020772 3300026121 Bacteria 5618
294 Ga0207683_10050924 3300026121 Bacteria 3628
295 Ga0207683_10503961 3300026121 Bacteria 1118
296 Ga0207698_10197656 3300026142 Bacteria 1798
297 Ga0209995_1027947 3300027471 Bacteria 942
298 Ga0209968_1053732 3300027526 Bacteria 703
299 Ga0209998_10000439 3300027717 Bacteria 11589
300 Ga0268265_10546903 3300028380 Unclassified 1098
301 Ga0316182_1453216 3300030745 Unclassified 676
302 Ga0307408_100016682 3300031548 Bacteria 4909
303 Ga0307408_100017172 3300031548 Bacteria 4842
304 Ga0307408_101119593 3300031548 Unclassified 731
305 Ga0307405_10020682 3300031731 Unclassified 3682
306 Ga0307405_10076275 3300031731 Bacteria 2174
307 Ga0307405_10106039 3300031731 Bacteria 1894
308 Ga0307405_10407906 3300031731 Unclassified 1066
309 Ga0307405_10456253 3300031731 Unclassified 1015
310 Ga0307413_10208145 3300031824 Unclassified 1418
311 Ga0307410_10071664 3300031852 Bacteria 2404
312 Ga0307410_10082370 3300031852 Unclassified 2263
313 Ga0307410_11077647 3300031852 Unclassified 696
314 Ga0307406_10012171 3300031901 Bacteria 4900
315 Ga0307406_10127740 3300031901 Bacteria 1779
316 Ga0307406_10842359 3300031901 Unclassified 777
317 Ga0307406_11420300 3300031901 Bacteria 609
318 Ga0307407_10047340 3300031903 Unclassified 2440
319 Ga0307407_10340988 3300031903 Bacteria 1058
320 Ga0307412_10001454 3300031911 Bacteria 13172
321 Ga0307412_10097386 3300031911 Bacteria 2073
322 Ga0307412_10511122 3300031911 Bacteria 1002
323 Ga0307409_100098185 3300031995 Unclassified 2421
324 Ga0307409_100150158 3300031995 Unclassified 2021
325 Ga0307409_100845347 3300031995 Unclassified 926
326 Ga0307409_101266934 3300031995 Bacteria 762
327 Ga0307416_100023331 3300032002 Bacteria 4488
328 Ga0307416_100430207 3300032002 Bacteria 1367
329 Ga0307416_100492025 3300032002 Unclassified 1289
330 Ga0307416_101611775 3300032002 Bacteria 754
331 Ga0307414_10533034 3300032004 Unclassified 1044
332 Ga0307414_11033356 3300032004 Unclassified 757
333 Ga0307414_11641385 3300032004 Bacteria 599
334 Ga0307411_10070923 3300032005 Bacteria 2359
335 Ga0307411_10197426 3300032005 Unclassified 1542
336 Ga0307411_10514309 3300032005 Unclassified 1015
337 Ga0307411_11246358 3300032005 Unclassified 676
338 Ga0307411_11804574 3300032005 Bacteria 568
339 Ga0307415_100415779 3300032126 Bacteria 1152
340 Ga0373948_0113402 3300034817 Unclassified 649
341 Ga0373938_0027790 3300034957 Bacteria 1192
342 Ga0373938_0053137 3300034957 Bacteria 930
343 Ga0373929_0072474 3300035085 Unclassified 826
344 Ga0373932_0038140 3300035112 Unclassified 1373
345 Ga0373941_0006802 3300035115 Bacteria 2771
346 Ga0373941_0037548 3300035115 Bacteria 1479
347 Ga0373961_0172223 3300035241 Unclassified 749
348 Ga0373931_1097297 3300035691 Bacteria 542
349 Ga0373935_0051582 3300035692 Bacteria 2613
350 Ga0373937_0081792 3300036401 Bacteria 2988
351 Ga0395905_0184750 3300037471 Bacteria 1957
352 Ga0451789_0453464 3300041443 Unclassified 717
353 Ga0451807_2654675 3300041486 Bacteria 863
354 Ga0451853_1790155 3300041512 Unclassified 610
355 Ga0439431_0137152 3300041997 Bacteria 689
356 Ga0439462_0008661 3300042015 Bacteria 2569
357 Ga0451577_0235323 3300042876 Bacteria 1656
358 Ga0466966_0003349 3300044684 Bacteria 10566
359 Ga0453684_0039035 3300044712 Bacteria 6476
360 Ga0466959_0016914 3300045049 Bacteria 5338
361 Ga0495592_0379690 3300046454 Bacteria 899
362 Ga0495629_0334247 3300046459 Bacteria 1035
363 Ga0495651_0050922 3300046462 Bacteria 3194
364 Ga0495653_0039030 3300046463 Bacteria 3723
365 Ga0495662_0024415 3300046476 Bacteria 2917
366 Ga0495664_0054570 3300046477 Bacteria 2376
367 Ga0495608_0012134 3300046511 Bacteria 5990
368 Ga0495618_0084845 3300046514 Bacteria 2024
369 Ga0495628_0054636 3300046516 Bacteria 3147
370 Ga0495630_0380310 3300046517 Bacteria 1081
371 Ga0495586_0042220 3300046535 Bacteria 2456
372 Ga0495645_0061830 3300046543 Bacteria 2713
373 Ga0495667_0055940 3300046559 Bacteria 2594
374 Ga0495634_0111517 3300046642 Bacteria 1758
375 Ga0495635_0016810 3300046663 Bacteria 5110
376 Ga0495588_0005752 3300046674 Bacteria 5538
377 Ga0495657_0051287 3300046675 Bacteria 2770
378 Ga0495599_0003880 3300046678 Bacteria 8795
379 Ga0495646_0111359 3300046680 Bacteria 1558
380 Ga0495613_0157297 3300046689 Bacteria 1618
381 Ga0495600_0025018 3300046809 Bacteria 3846
382 Ga0495604_0074359 3300047317 Bacteria 2561
383 Ga0495674_0037313 3300047319 Bacteria 4366
384 Ga0495680_0033910 3300047322 Bacteria 4129
385 Ga0495675_0221018 3300047444 Bacteria 1146
386 Ga0495684_0015430 3300047471 Bacteria 5879
387 Ga0495602_0071561 3300048088 Bacteria 2961
388 Ga0496101_0103371 3300048904 Bacteria 2135
389 Ga0496102_0259047 3300048905 Bacteria 1640
390 Ga0496112_0006291 3300048915 Bacteria 10415
391 Ga0496112_0065790 3300048915 Bacteria 3577
392 Ga0496112_0829345 3300048915 Bacteria 849
393 Ga0496114_0053689 3300048917 Bacteria 3359
394 Ga0496115_0016184 3300048918 Bacteria 5674
395 Ga0501292_002287 3300049515 Bacteria 2456
396 Ga0501038_1270147 3300049574 Unclassified 532
397 Ga0501040_0150826 3300049576 Unclassified 1640
398 Ga0501198_010109 3300049649 Unclassified 1391
399 Ga0501202_002632 3300049652 Bacteria 3028
400 Ga0501216_001187 3300049660 Bacteria 3443
401 Ga0501217_008845 3300049661 Unclassified 2182
402 Ga0501224_004861 3300049664 Bacteria 1917
403 Ga0501227_019690 3300049665 Unclassified 1541
404 Ga0501233_001385 3300049668 Unclassified 4145
405 Ga0501236_041315 3300049670 Unclassified 765
406 Ga0501240_010216 3300049673 Unclassified 1243
407 Ga0501242_005807 3300049674 Unclassified 1397
408 Ga0501249_009311 3300049679 Unclassified 2043
409 Ga0501250_002574 3300049680 Bacteria 1656
410 Ga0501251_114378 3300049681 Unclassified 505
411 Ga0501252_008866 3300049682 Unclassified 1164
412 Ga0501253_202506 3300049683 Unclassified 525
413 Ga0501257_014120 3300049686 Unclassified 1834
414 Ga0501259_012103 3300049688 Unclassified 1436
415 Ga0501259_081531 3300049688 Unclassified 712
416 Ga0501260_002878 3300049689 Unclassified 1515
417 Ga0501225_0006893 3300049705 Bacteria 3312
418 Ga0501234_000983 3300049707 Bacteria 4514
419 Ga0501245_045978 3300049708 Unclassified 762
420 Ga0501079_0575335 3300049741 Unclassified 886
421 Ga0501268_001833 3300049765 Bacteria 2711
422 Ga0501274_007886 3300049771 Unclassified 945
423 Ga0501276_002834 3300049773 Unclassified 1238
424 Ga0501283_011735 3300049779 Unclassified 1308
425 Ga0501212_010470 3300049851 Unclassified 1322
426 nmdc:mga05p37_1238314_c1 3300050507 Bacteria 767
427 nmdc:mga05p37_2196450_c1 3300050507 Bacteria 513
428 nmdc:mga05p37_363794_c1 3300050507 Bacteria 1700
429 nmdc:mga09592_107763_c1 3300050508 Bacteria 2390
430 nmdc:mga0qj67_3770_c1 3300050509 Bacteria 10941
431 nmdc:mga0qj67_93381_c1 3300050509 Bacteria 2419
432 nmdc:mga0qj67_98074_c1 3300050509 Bacteria 2361
433 nmdc:mga06r32_151911_c1 3300050510 Bacteria 2294
434 nmdc:mga06r32_251903_c1 3300050510 Bacteria 1753
435 nmdc:mga06r32_886577_c1 3300050510 Bacteria 849
436 nmdc:mga0n895_884952_c1 3300050512 Bacteria 879
437 nmdc:mga0rr50_1156206_c1 3300050513 Unclassified 658
438 nmdc:mga08x19_220266_c1 3300050514 Bacteria 1304
439 nmdc:mga0a205_11578_c1 3300050515 Bacteria 8126
440 nmdc:mga0a205_61581_c1 3300050515 Bacteria 3624
441 Ga0501072_0292437
442 Ga0065715_10014827
443 Ga0070658_10121793
444 Ga0070658_10391916
445 Ga0070676_10789300
446 Ga0070683_100041829
447 Ga0070683_100172572
448 Ga0070690_100029945
449 Ga0070690_100266149
450 Ga0070680_100004892
451 Ga0070680_100015411
452 Ga0070680_100066980
453 Ga0070680_100076663
454 Ga0070680_100094998
455 Ga0070680_100166474
456 Ga0070680_100285456
457 Ga0070680_100488600
458 Ga0070680_101219620
459 Ga0070680_101407908
460 Ga0070682_100017291
461 Ga0070682_100031567
462 Ga0070660_100113720
463 Ga0070660_100230675
464 Ga0070660_101481681
465 Ga0070691_10097617
466 Ga0070687_100011484
467 Ga0070661_100011269
468 Ga0070692_10055637
469 Ga0070692_10098136
470 Ga0070692_10678694
471 Ga0070692_11231511
472 Ga0070668_100005834
473 Ga0070669_100000545
474 Ga0070669_100057586
475 Ga0070669_100213283
476 Ga0070669_100623916
477 Ga0070675_100084217
478 Ga0070675_100453012
479 Ga0070675_100826472
480 Ga0070671_100140409
481 Ga0070671_100209644
482 Ga0070671_100424931
483 Ga0070674_100039135
484 Ga0070674_100067621
485 Ga0070674_100187102
486 Ga0070673_100005173
487 Ga0070673_100088923
488 Ga0070673_101031482
489 Ga0070659_101132670
490 Ga0070667_100272632
491 Ga0070709_10004734
492 Ga0070700_100060809
493 Ga0070700_100151994
494 Ga0070700_100483432
495 Ga0070694_100053647
496 Ga0070694_100072992
497 Ga0070708_100000089
498 Ga0070708_100795324
499 Ga0070663_100004710
500 Ga0070663_100388274
501 Ga0070663_100389379
502 Ga0070678_100031309
503 Ga0070678_100410239
504 Ga0070678_101095705
505 Ga0070662_100061960
506 Ga0070662_100067676
507 Ga0070662_101238847
508 Ga0070681_10005428
509 Ga0070681_10005852
510 Ga0070681_10034253
511 Ga0070681_10103126
512 Ga0070681_10119705
513 Ga0070681_10127990
514 Ga0070681_10250758
515 Ga0070681_10301221
516 Ga0068867_100006955
517 Ga0068867_100019919
518 Ga0068867_100281493
519 Ga0070685_10324717
520 Ga0070706_100070190
521 Ga0070706_100145916
522 Ga0070707_100000317
523 Ga0070707_100149248
524 Ga0070707_100477540
525 Ga0070698_100082823
526 Ga0070698_100105365
527 Ga0070698_100669170
528 Ga0070699_100219094
529 Ga0070699_100381950
530 Ga0070679_100002058
531 Ga0070679_100010345
532 Ga0070679_100011408
533 Ga0070679_100033707
534 Ga0070679_100061906
535 Ga0070679_100312231
536 Ga0070679_100545123
537 Ga0070684_100191373
538 Ga0070684_100368976
539 Ga0070684_100371625
540 Ga0068853_100106514
541 Ga0068853_102236669
542 Ga0070672_100107245
543 Ga0070672_100348271
544 Ga0070672_100820522
545 Ga0070686_100137723
546 Ga0070695_100466729
547 Ga0070696_100001495
548 Ga0070696_100101259
549 Ga0070696_100148596
550 Ga0070696_100473597
551 Ga0070696_100820015
552 Ga0070693_100000716
553 Ga0070693_100154676
554 Ga0070693_100318246
555 Ga0070665_100022326
556 Ga0070704_100005456
557 Ga0068855_100181738
558 Ga0068855_100768670
559 Ga0070664_100020777
560 Ga0070664_100078786
561 Ga0070664_100307199
562 Ga0070664_100307498
563 Ga0070664_100384982
564 Ga0068857_100673466
565 Ga0068854_100061187
566 Ga0068854_100393007
567 Ga0068854_101131591
568 Ga0068854_101610370
569 Ga0068856_100600505
570 Ga0068856_100784203
571 Ga0068856_101237792
572 Ga0068852_100073153
573 Ga0068859_100288454
574 Ga0068866_10007089
575 Ga0068861_100005892
576 Ga0068861_100678634
577 Ga0068861_101003083
578 Ga0068870_10012072
579 Ga0068862_100003812
580 Ga0081539_10000087
581 Ga0070716_100004829
582 Ga0097621_100747595
583 Ga0097621_100818413
584 Ga0075430_100006591
585 Ga0075430_100022145
586 Ga0075430_100080153
587 Ga0075431_100017492
588 Ga0075431_100102838
589 Ga0075431_100143347
590 Ga0075431_100357662
591 Ga0075431_100458407
592 Ga0075433_10001700
593 Ga0075433_11029587
594 Ga0075434_100025029
595 Ga0075434_100914598
596 Ga0075429_100049305
597 Ga0068865_100087136
598 Ga0068865_100346171
599 Ga0075436_100023633
600 Ga0097620_100288492
601 Ga0075435_100123621
602 Ga0075435_100215649
603 Ga0105240_10294011
604 Ga0105245_10109011
605 Ga0105245_11184414
606 Ga0114129_10024727
607 Ga0114129_12100924
608 Ga0105243_10221340
609 Ga0105241_10092049
610 Ga0105241_10164209
611 Ga0105248_10029350
612 Ga0105248_10253623
613 Ga0105248_10421611
614 Ga0105237_10071082
615 Ga0105238_10083430
616 Ga0105249_10000224
617 Ga0105249_10543240
618 Ga0157373_10195577
619 Ga0157371_10065245
620 Ga0157370_10061254
621 Ga0157369_10156137
622 Ga0157369_10285076
623 Ga0157374_10037521
624 Ga0157378_10029438
625 Ga0157378_10053531
626 Ga0157378_10240040
627 Ga0157378_10410427
628 Ga0157378_11840499
629 Ga0163162_11164852
630 Ga0163162_11677557
631 Ga0157372_11346359
632 Ga0157372_11654575
633 Ga0157372_12646437
634 Ga0157375_10056671
635 Ga0157375_10249624
636 Ga0157380_10043849
637 Ga0157380_12246359
638 Ga0182008_10003068
639 Ga0157377_10523751
640 Ga0157376_10796867
641 Ga0163161_10217282
642 Ga0207682_10042841
643 Ga0207645_10011485
644 Ga0207645_10406492
645 Ga0207643_10009044
646 Ga0207705_10031690
647 Ga0207705_10150981
648 Ga0207705_10223468
649 Ga0207684_10106264
650 Ga0207707_10004390
651 Ga0207707_10026589
652 Ga0207707_10057388
653 Ga0207707_10064161
654 Ga0207707_10103965
655 Ga0207707_10208934
656 Ga0207707_10258049
657 Ga0207707_10594488
658 Ga0207707_10779064
659 Ga0207671_10069671
660 Ga0207660_10012495
661 Ga0207660_10029564
662 Ga0207660_10203287
663 Ga0207660_10232990
664 Ga0207660_10517885
665 Ga0207660_10550482
666 Ga0207660_10687864
667 Ga0207662_10011243
668 Ga0207657_10007873
669 Ga0207657_10211977
670 Ga0207657_10297041
671 Ga0207649_10691374
672 Ga0207652_10003840
673 Ga0207652_10005503
674 Ga0207652_10010965
675 Ga0207652_10129534
676 Ga0207652_10144191
677 Ga0207652_10248074
678 Ga0207652_10970349
679 Ga0207646_10007348
680 Ga0207646_10072200
681 Ga0207681_10006965
682 Ga0207681_10045151
683 Ga0207681_10047918
684 Ga0207694_10303214
685 Ga0207650_10135536
686 Ga0207650_10443055
687 Ga0207650_10895453
688 Ga0207687_10970106
689 Ga0207644_10174915
690 Ga0207644_10289985
691 Ga0207644_10294379
692 Ga0207690_11499802
693 Ga0207706_10028510
694 Ga0207706_10051857
695 Ga0207706_10115919
696 Ga0207706_10282178
697 Ga0207669_10263207
698 Ga0207669_10961406
699 Ga0207665_10003155
700 Ga0207691_10005767
701 Ga0207691_10014209
702 Ga0207691_10142599
703 Ga0207711_10060616
704 Ga0207711_10154976
705 Ga0207661_10012961
706 Ga0207679_10008649
707 Ga0207679_10016157
708 Ga0207667_10100833
709 Ga0207667_10117222
710 Ga0207667_10680977
711 Ga0207651_10216522
712 Ga0207651_10324964
713 Ga0207668_10397470
714 Ga0207640_10017898
715 Ga0207658_10191515
716 Ga0207677_10155156
717 Ga0207677_10324373
718 Ga0207677_10569492
719 Ga0207639_10107835
720 Ga0207678_10001013
721 Ga0207678_10497476
722 Ga0207708_10025034
723 Ga0207708_10063233
724 Ga0207708_10226129
725 Ga0207702_10524895
726 Ga0207702_12421567
727 Ga0207648_10015820
728 Ga0207648_10035536
729 Ga0207648_10193515
730 Ga0207674_10024667
731 Ga0207675_100037472
732 Ga0207675_100261230
733 Ga0207683_10020772
734 Ga0207683_10050924
735 Ga0207683_10503961
736 Ga0207698_10197656
737 Ga0209995_1027947
738 Ga0209968_1053732
739 Ga0209998_10000439
740 Ga0268265_10546903
741 Ga0316182_1453216
742 Ga0307408_100016682
743 Ga0307408_100017172
744 Ga0307408_101119593
745 Ga0307405_10020682
746 Ga0307405_10076275
747 Ga0307405_10106039
748 Ga0307405_10407906
749 Ga0307405_10456253
750 Ga0307413_10208145
751 Ga0307410_10071664
752 Ga0307410_10082370
753 Ga0307410_11077647
754 Ga0307406_10012171
755 Ga0307406_10127740
756 Ga0307406_10842359
757 Ga0307406_11420300
758 Ga0307407_10047340
759 Ga0307407_10340988
760 Ga0307412_10001454
761 Ga0307412_10097386
762 Ga0307412_10511122
763 Ga0307409_100098185
764 Ga0307409_100150158
765 Ga0307409_100845347
766 Ga0307409_101266934
767 Ga0307416_100023331
768 Ga0307416_100430207
769 Ga0307416_100492025
770 Ga0307416_101611775
771 Ga0307414_10533034
772 Ga0307414_11033356
773 Ga0307414_11641385
774 Ga0307411_10070923
775 Ga0307411_10197426
776 Ga0307411_10514309
777 Ga0307411_11246358
778 Ga0307411_11804574
779 Ga0307415_100415779
780 Ga0373948_0113402
781 Ga0373938_0027790
782 Ga0373938_0053137
783 Ga0373929_0072474
784 Ga0373932_0038140
785 Ga0373941_0006802
786 Ga0373941_0037548
787 Ga0373961_0172223
788 Ga0373931_1097297
789 Ga0373935_0051582
790 Ga0373937_0081792
791 Ga0395905_0184750
792 Ga0451789_0453464
793 Ga0451807_2654675
794 Ga0451853_1790155
795 Ga0439431_0137152
796 Ga0439462_0008661
797 Ga0451577_0235323
798 Ga0466966_0003349
799 Ga0453684_0039035
800 Ga0466959_0016914
801 Ga0495592_0379690
802 Ga0495629_0334247
803 Ga0495651_0050922
804 Ga0495653_0039030
805 Ga0495662_0024415
806 Ga0495664_0054570
807 Ga0495608_0012134
808 Ga0495618_0084845
809 Ga0495628_0054636
810 Ga0495630_0380310
811 Ga0495586_0042220
812 Ga0495645_0061830
813 Ga0495667_0055940
814 Ga0495634_0111517
815 Ga0495635_0016810
816 Ga0495588_0005752
817 Ga0495657_0051287
818 Ga0495599_0003880
819 Ga0495646_0111359
820 Ga0495613_0157297
821 Ga0495600_0025018
822 Ga0495604_0074359
823 Ga0495674_0037313
824 Ga0495680_0033910
825 Ga0495675_0221018
826 Ga0495684_0015430
827 Ga0495602_0071561
828 Ga0496101_0103371
829 Ga0496102_0259047
830 Ga0496112_0006291
831 Ga0496112_0065790
832 Ga0496112_0829345
833 Ga0496114_0053689
834 Ga0496115_0016184
835 Ga0501292_002287
836 Ga0501038_1270147
837 Ga0501040_0150826
838 Ga0501198_010109
839 Ga0501202_002632
840 Ga0501216_001187
841 Ga0501217_008845
842 Ga0501224_004861
843 Ga0501227_019690
844 Ga0501233_001385
845 Ga0501236_041315
846 Ga0501240_010216
847 Ga0501242_005807
848 Ga0501249_009311
849 Ga0501250_002574
850 Ga0501251_114378
851 Ga0501252_008866
852 Ga0501253_202506
853 Ga0501257_014120
854 Ga0501259_012103
855 Ga0501259_081531
856 Ga0501260_002878
857 Ga0501225_0006893
858 Ga0501234_000983
859 Ga0501245_045978
860 Ga0501079_0575335
861 Ga0501268_001833
862 Ga0501274_007886
863 Ga0501276_002834
864 Ga0501283_011735
865 Ga0501212_010470
866 nmdc:mga05p37_1238314_c1
867 nmdc:mga05p37_2196450_c1
868 nmdc:mga05p37_363794_c1
869 nmdc:mga09592_107763_c1
870 nmdc:mga0qj67_3770_c1
871 nmdc:mga0qj67_93381_c1
872 nmdc:mga0qj67_98074_c1
873 nmdc:mga06r32_151911_c1
874 nmdc:mga06r32_251903_c1
875 nmdc:mga06r32_886577_c1
876 nmdc:mga0n895_884952_c1
877 nmdc:mga0rr50_1156206_c1
878 nmdc:mga08x19_220266_c1
879 nmdc:mga0a205_11578_c1
880 nmdc:mga0a205_61581_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07884

VKOR

Vitamin K epoxide reductase family

1

128

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nv5-assembly2.cif.gz_B c50a mutant of synechococcus vkor, c2 crystal form (dehydrated) 0.8916 2 128
4nv5-assembly1.cif.gz_A c50a mutant of synechococcus vkor, c2 crystal form (dehydrated) 0.8896 4 129
4nv2-assembly1.cif.gz_A c50a mutant of synechococcus vkor, c2221 crystal form 0.8826 1 128
6wvh-assembly1.cif.gz_A human vkor with brodifacoum 0.8158 5 132
4nv2-assembly1.cif.gz_A c50a mutant of synechococcus vkor, c2221 crystal form 0.8096 1 128
ID Description Score Start End Superfamily
4nv5A01 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.8896 4 129 1.20.1440.130
af_Q54V87_14_188_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.8715 2 131 1.20.1440.130
af_Q10S76_73_247_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.866 3 136 1.20.1440.130
af_A1ZAJ5_3_151_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.8557 3 133 1.20.1440.130
af_I6X5W1_15_164_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.8443 2 131 1.20.1440.130
ID Description Score Start End GO Terms
AF-A0A7Y5PBN3-F1-model_v4 Vitamin K epoxide reductase family protein 0.9946 3 136 GO:0016020
GO:0016491
GO:0048038
AF-A0A2V7GHQ1-F1-model_v4 Vitamin K epoxide reductase 0.9901 2 134 GO:0016020
GO:0016491
GO:0048038
AF-A0A7Y5QL11-F1-model_v4 Vitamin K epoxide reductase family protein 0.9891 1 132 GO:0016020
GO:0016491
GO:0048038
AF-A0A2V7QJY1-F1-model_v4 Vitamin K epoxide reductase 0.9868 1 135 GO:0016020
GO:0016491
GO:0048038
AF-A0A7W1UIM1-F1-model_v4 Vitamin K epoxide reductase family protein 0.9846 1 136 GO:0016020
GO:0016491
GO:0048038

Map