F444408

General Info

Members Datasets Scaffolds Average Seq Length
440 183 880 217

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10766522|Ga0105240_107665222
Length 253
Sequence MASPPVLRGFDPTLLLVLNLVGTFVFGLSGGMTGVRARLDLFGAVVLAVVVGLAGGIIRDLLIGTPPATFRDWRYLAVAGGAGLVTTLAHPTIDRLERPIQALDAAGLALFCVTGAATALAHRLGVAEAVILGAITGIGGGMVRDILVREIPTVLRGGLYAIPALVGAGIVVAAYHAGARTVTFPMIGAAVCFFMRMAGLRYGIGLPAAADVAVTTRLRVRRGHPVDDDAGHTQRQEPPDVSAGRAVDRDLAE

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
139 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
140 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
141 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
142 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
183 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0.91
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 6.59
Rhizosphere 91.14
Stem 0
Stem Tuber 0
Unclassified 5.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10766522 3300009093 Unclassified 1048
2 rootH1_10142899 3300003323 Bacteria 1819
3 Ga0070658_10085767 3300005327 Bacteria 2590
4 Ga0070658_10096677 3300005327 Bacteria 2438
5 Ga0070658_10251831 3300005327 Bacteria 1498
6 Ga0070683_100002930 3300005329 Bacteria 13674
7 Ga0070683_100009898 3300005329 Bacteria 8171
8 Ga0070683_100165184 3300005329 Unclassified 2100
9 Ga0070683_100193314 3300005329 Bacteria 1932
10 Ga0070683_100250017 3300005329 Bacteria 1686
11 Ga0070683_100251047 3300005329 Bacteria 1682
12 Ga0070683_100374868 3300005329 Bacteria 1356
13 Ga0070670_100414120 3300005331 Bacteria 1191
14 Ga0068869_100159443 3300005334 Bacteria 1755
15 Ga0070680_100015369 3300005336 Bacteria 5999
16 Ga0070680_100035521 3300005336 Bacteria 4024
17 Ga0070680_100047560 3300005336 Bacteria 3493
18 Ga0070680_100064694 3300005336 Bacteria 2997
19 Ga0070680_100177945 3300005336 Unclassified 1791
20 Ga0070682_100028812 3300005337 Bacteria 3342
21 Ga0070682_100030034 3300005337 Bacteria 3277
22 Ga0070682_100078105 3300005337 Bacteria 2134
23 Ga0070682_100188859 3300005337 Bacteria 1445
24 Ga0070682_100214692 3300005337 Bacteria 1365
25 Ga0070682_100513441 3300005337 Bacteria 931
26 Ga0068868_100017660 3300005338 Bacteria 5319
27 Ga0070660_100068728 3300005339 Bacteria 2762
28 Ga0070660_100103562 3300005339 Unclassified 2257
29 Ga0070660_100374026 3300005339 Bacteria 1176
30 Ga0070660_101115822 3300005339 Bacteria 668
31 Ga0070689_100184811 3300005340 Bacteria 1695
32 Ga0070689_100263996 3300005340 Bacteria 1424
33 Ga0070691_10060279 3300005341 Bacteria 1824
34 Ga0070687_100088437 3300005343 Bacteria 1708
35 Ga0070661_100009888 3300005344 Bacteria 6617
36 Ga0070661_100018395 3300005344 Bacteria 4967
37 Ga0070668_100022539 3300005347 Bacteria 4761
38 Ga0070669_100030404 3300005353 Bacteria 3896
39 Ga0070675_100340372 3300005354 Bacteria 1328
40 Ga0070674_100132615 3300005356 Bacteria 1859
41 Ga0070674_100853381 3300005356 Bacteria 790
42 Ga0070688_100283887 3300005365 Bacteria 1190
43 Ga0070688_100420822 3300005365 Bacteria 993
44 Ga0070659_100013451 3300005366 Bacteria 6092
45 Ga0070659_100019174 3300005366 Bacteria 5177
46 Ga0070659_100215464 3300005366 Bacteria 1583
47 Ga0070714_100065404 3300005435 Bacteria 3131
48 Ga0070714_100368525 3300005435 Bacteria 1352
49 Ga0070714_100442834 3300005435 Bacteria 1233
50 Ga0070713_100020118 3300005436 Bacteria 5111
51 Ga0070713_100389396 3300005436 Bacteria 1300
52 Ga0070705_100004606 3300005440 Bacteria 6710
53 Ga0070700_100044048 3300005441 Bacteria 2746
54 Ga0070694_100385244 3300005444 Unclassified 1094
55 Ga0070708_100136678 3300005445 Bacteria 2271
56 Ga0070708_100720988 3300005445 Unclassified 938
57 Ga0070663_100116669 3300005455 Bacteria 2012
58 Ga0070663_100190995 3300005455 Bacteria 1594
59 Ga0070663_100524469 3300005455 Bacteria 987
60 Ga0070678_100071792 3300005456 Bacteria 2592
61 Ga0070662_100572220 3300005457 Bacteria 948
62 Ga0070681_10007287 3300005458 Bacteria 10795
63 Ga0070681_10021325 3300005458 Bacteria 6494
64 Ga0070681_10027551 3300005458 Bacteria 5713
65 Ga0070681_10041818 3300005458 Bacteria 4594
66 Ga0070681_10083296 3300005458 Bacteria 3152
67 Ga0070681_10087670 3300005458 Bacteria 3065
68 Ga0070681_10090508 3300005458 Bacteria 3010
69 Ga0070681_10091592 3300005458 Bacteria 2990
70 Ga0070681_10329487 3300005458 Bacteria 1436
71 Ga0070681_10604522 3300005458 Bacteria 1011
72 Ga0070685_10361357 3300005466 Unclassified 995
73 Ga0070706_100197413 3300005467 Bacteria 1880
74 Ga0070706_100461261 3300005467 Bacteria 1182
75 Ga0070707_100077483 3300005468 Bacteria 3208
76 Ga0070679_100017297 3300005530 Bacteria 6977
77 Ga0070679_100017538 3300005530 Bacteria 6929
78 Ga0070679_100048809 3300005530 Bacteria 4217
79 Ga0070679_100067811 3300005530 Bacteria 3558
80 Ga0070679_100117777 3300005530 Bacteria 2641
81 Ga0070679_100212027 3300005530 Bacteria 1900
82 Ga0070679_100226757 3300005530 Bacteria 1828
83 Ga0070679_100335880 3300005530 Bacteria 1459
84 Ga0070679_100418985 3300005530 Unclassified 1284
85 Ga0070684_100021047 3300005535 Bacteria 5419
86 Ga0070684_100025797 3300005535 Bacteria 4943
87 Ga0070684_100064939 3300005535 Bacteria 3203
88 Ga0070684_100408085 3300005535 Bacteria 1253
89 Ga0070684_100412876 3300005535 Bacteria 1245
90 Ga0068853_100082117 3300005539 Bacteria 2823
91 Ga0068853_100214643 3300005539 Bacteria 1755
92 Ga0070686_100027807 3300005544 Bacteria 3425
93 Ga0070695_100136116 3300005545 Bacteria 1698
94 Ga0070696_100008238 3300005546 Bacteria 6977
95 Ga0070696_100018724 3300005546 Bacteria 4684
96 Ga0070693_100022235 3300005547 Bacteria 3368
97 Ga0070693_100143353 3300005547 Unclassified 1506
98 Ga0070693_100166180 3300005547 Bacteria 1409
99 Ga0070665_100056118 3300005548 Bacteria 3950
100 Ga0070665_100121436 3300005548 Bacteria 2614
101 Ga0070665_100767022 3300005548 Bacteria 977
102 Ga0070704_100011458 3300005549 Bacteria 5436
103 Ga0068855_100095601 3300005563 Bacteria 3424
104 Ga0068855_100411797 3300005563 Unclassified 1480
105 Ga0068855_100522821 3300005563 Bacteria 1287
106 Ga0070664_100043864 3300005564 Bacteria 3775
107 Ga0070664_100060278 3300005564 Bacteria 3230
108 Ga0068857_100011802 3300005577 Bacteria 7599
109 Ga0068857_100174147 3300005577 Bacteria 1957
110 Ga0068857_100214124 3300005577 Bacteria 1758
111 Ga0068857_100293454 3300005577 Bacteria 1498
112 Ga0068854_100159305 3300005578 Bacteria 1746
113 Ga0068854_100304255 3300005578 Bacteria 1291
114 Ga0068854_100327234 3300005578 Bacteria 1248
115 Ga0068856_100102242 3300005614 Bacteria 2859
116 Ga0068852_100078841 3300005616 Bacteria 2915
117 Ga0068864_100080304 3300005618 Bacteria 2857
118 Ga0068861_100076420 3300005719 Bacteria 2610
119 Ga0068858_100267347 3300005842 Bacteria 1626
120 Ga0068858_100307939 3300005842 Bacteria 1512
121 Ga0068860_100179480 3300005843 Bacteria 2046
122 Ga0068860_100864682 3300005843 Bacteria 919
123 Ga0068862_100318268 3300005844 Bacteria 1435
124 Ga0070717_10420893 3300006028 Bacteria 1201
125 Ga0070717_10488715 3300006028 Bacteria 1112
126 Ga0068871_100716394 3300006358 Bacteria 918
127 Ga0068871_100744367 3300006358 Bacteria 901
128 Ga0075428_100279336 3300006844 Bacteria 1797
129 Ga0075430_100385902 3300006846 Bacteria 1156
130 Ga0105240_10012558 3300009093 Bacteria 11684
131 Ga0105240_10047551 3300009093 Bacteria 5429
132 Ga0105240_10474926 3300009093 Bacteria 1395
133 Ga0105240_10533727 3300009093 Bacteria 1300
134 Ga0111539_10138191 3300009094 Bacteria 2854
135 Ga0105245_10009115 3300009098 Bacteria 8651
136 Ga0105245_10304537 3300009098 Unclassified 1565
137 Ga0105245_10406254 3300009098 Bacteria 1362
138 Ga0105245_10673374 3300009098 Bacteria 1066
139 Ga0105247_10200102 3300009101 Bacteria 1342
140 Ga0105243_10364887 3300009148 Bacteria 1330
141 Ga0105243_11336041 3300009148 Bacteria 735
142 Ga0105241_10066108 3300009174 Bacteria 2795
143 Ga0105237_10111462 3300009545 Bacteria 2728
144 Ga0105238_10086742 3300009551 Bacteria 3117
145 Ga0105249_10183741 3300009553 Bacteria 2036
146 Ga0105239_10024255 3300010375 Bacteria 6680
147 Ga0105239_10075278 3300010375 Bacteria 3712
148 Ga0105239_10417402 3300010375 Bacteria 1520
149 Ga0105246_10012571 3300011119 Bacteria 5287
150 Ga0105246_10290841 3300011119 Bacteria 1314
151 Ga0157370_10001705 3300013104 Bacteria 27045
152 Ga0157370_10004906 3300013104 Bacteria 15159
153 Ga0157370_10782831 3300013104 Bacteria 868
154 Ga0157369_10004176 3300013105 Bacteria 17112
155 Ga0157369_10018535 3300013105 Bacteria 7802
156 Ga0157369_10194011 3300013105 Bacteria 2133
157 Ga0157369_10341825 3300013105 Bacteria 1555
158 Ga0157369_10457674 3300013105 Bacteria 1321
159 Ga0163162_10441355 3300013306 Bacteria 1434
160 Ga0157372_10016630 3300013307 Bacteria 7894
161 Ga0157372_10059932 3300013307 Bacteria 4258
162 Ga0157372_10180270 3300013307 Bacteria 2445
163 Ga0157372_10238305 3300013307 Bacteria 2110
164 Ga0157372_10549860 3300013307 Bacteria 1346
165 Ga0157372_10625810 3300013307 Bacteria 1254
166 Ga0157372_10636552 3300013307 Bacteria 1242
167 Ga0157372_10856065 3300013307 Bacteria 1055
168 Ga0157375_10373014 3300013308 Bacteria 1593
169 Ga0163163_10073740 3300014325 Bacteria 3404
170 Ga0163163_10429794 3300014325 Bacteria 1380
171 Ga0157380_10109307 3300014326 Bacteria 2320
172 Ga0182008_10092847 3300014497 Bacteria 1489
173 Ga0157377_10294168 3300014745 Bacteria 1069
174 Ga0157377_10511236 3300014745 Bacteria 841
175 Ga0157377_10716387 3300014745 Bacteria 728
176 Ga0157379_10203764 3300014968 Bacteria 1789
177 Ga0157376_10757435 3300014969 Bacteria 981
178 Ga0163161_10649843 3300017792 Bacteria 874
179 Ga0206354_10255970 3300020081 Bacteria 1849
180 Ga0206353_10150554 3300020082 Bacteria 1774
181 Ga0206353_11405735 3300020082 Bacteria 1964
182 Ga0206353_11837697 3300020082 Bacteria 2351
183 Ga0213876_10007823 3300021384 Bacteria 5799
184 Ga0213876_10204954 3300021384 Bacteria 1048
185 Ga0207656_10076570 3300025321 Bacteria 1496
186 Ga0207710_10122718 3300025900 Bacteria 1242
187 Ga0207688_10045059 3300025901 Bacteria 2460
188 Ga0207688_10085449 3300025901 Bacteria 1807
189 Ga0207688_10161490 3300025901 Bacteria 1328
190 Ga0207688_10334381 3300025901 Bacteria 931
191 Ga0207647_10182659 3300025904 Bacteria 1217
192 Ga0207643_10020160 3300025908 Bacteria 3658
193 Ga0207705_10078013 3300025909 Bacteria 2410
194 Ga0207705_10100111 3300025909 Bacteria 2132
195 Ga0207705_10111505 3300025909 Bacteria 2022
196 Ga0207684_10132583 3300025910 Bacteria 2139
197 Ga0207684_10448263 3300025910 Bacteria 1108
198 Ga0207654_10129324 3300025911 Bacteria 1596
199 Ga0207707_10012620 3300025912 Bacteria 7341
200 Ga0207707_10013550 3300025912 Bacteria 7106
201 Ga0207707_10040144 3300025912 Bacteria 4089
202 Ga0207707_10047495 3300025912 Bacteria 3738
203 Ga0207707_10091611 3300025912 Bacteria 2657
204 Ga0207707_10125231 3300025912 Bacteria 2247
205 Ga0207707_10159652 3300025912 Bacteria 1971
206 Ga0207707_10292090 3300025912 Bacteria 1410
207 Ga0207707_10432620 3300025912 Archaea 1127
208 Ga0207695_10207327 3300025913 Bacteria 1872
209 Ga0207695_10284359 3300025913 Bacteria 1547
210 Ga0207695_10380798 3300025913 Bacteria 1297
211 Ga0207671_10057811 3300025914 Bacteria 2875
212 Ga0207660_10022383 3300025917 Bacteria 4258
213 Ga0207660_10030679 3300025917 Bacteria 3696
214 Ga0207660_10031296 3300025917 Bacteria 3662
215 Ga0207660_10068240 3300025917 Bacteria 2578
216 Ga0207660_10088015 3300025917 Bacteria 2296
217 Ga0207660_10091692 3300025917 Bacteria 2254
218 Ga0207662_10053418 3300025918 Bacteria 2407
219 Ga0207662_10135134 3300025918 Bacteria 1558
220 Ga0207657_10003888 3300025919 Bacteria 15852
221 Ga0207657_10078150 3300025919 Bacteria 2787
222 Ga0207657_10163098 3300025919 Bacteria 1809
223 Ga0207657_10164700 3300025919 Bacteria 1799
224 Ga0207657_10217998 3300025919 Bacteria 1530
225 Ga0207657_10411020 3300025919 Bacteria 1064
226 Ga0207657_10529555 3300025919 Bacteria 922
227 Ga0207657_10928813 3300025919 Bacteria 670
228 Ga0207649_10082421 3300025920 Unclassified 2085
229 Ga0207652_10009700 3300025921 Bacteria 7745
230 Ga0207652_10030209 3300025921 Bacteria 4535
231 Ga0207652_10063473 3300025921 Bacteria 3195
232 Ga0207652_10101234 3300025921 Unclassified 2545
233 Ga0207652_10345404 3300025921 Bacteria 1343
234 Ga0207652_10505630 3300025921 Bacteria 1088
235 Ga0207652_10526594 3300025921 Bacteria 1063
236 Ga0207646_10049502 3300025922 Bacteria 3764
237 Ga0207694_10019663 3300025924 Bacteria 5109
238 Ga0207659_10184591 3300025926 Unclassified 1655
239 Ga0207687_10042382 3300025927 Bacteria 3131
240 Ga0207687_10071631 3300025927 Bacteria 2477
241 Ga0207687_10284672 3300025927 Unclassified 1326
242 Ga0207687_10423519 3300025927 Bacteria 1099
243 Ga0207700_10618377 3300025928 Bacteria 965
244 Ga0207664_10003930 3300025929 Bacteria 9991
245 Ga0207664_10059438 3300025929 Bacteria 3044
246 Ga0207690_10025011 3300025932 Bacteria 3745
247 Ga0207690_10046801 3300025932 Bacteria 2867
248 Ga0207690_10332214 3300025932 Bacteria 1197
249 Ga0207706_10139322 3300025933 Bacteria 2134
250 Ga0207709_10283662 3300025935 Bacteria 1224
251 Ga0207670_10018614 3300025936 Bacteria 4227
252 Ga0207669_10027410 3300025937 Bacteria 3119
253 Ga0207689_10528333 3300025942 Bacteria 990
254 Ga0207661_10001120 3300025944 Bacteria 17854
255 Ga0207661_10017811 3300025944 Bacteria 5264
256 Ga0207661_10022976 3300025944 Bacteria 4707
257 Ga0207661_10130351 3300025944 Unclassified 2153
258 Ga0207661_10154860 3300025944 Bacteria 1984
259 Ga0207661_10163630 3300025944 Bacteria 1932
260 Ga0207661_10240871 3300025944 Bacteria 1605
261 Ga0207679_10050203 3300025945 Bacteria 3047
262 Ga0207679_10502799 3300025945 Bacteria 1082
263 Ga0207667_10109841 3300025949 Bacteria 2844
264 Ga0207667_10164609 3300025949 Bacteria 2280
265 Ga0207667_10471980 3300025949 Bacteria 1274
266 Ga0207667_10704351 3300025949 Bacteria 1012
267 Ga0207651_11036486 3300025960 Bacteria 734
268 Ga0207712_10335102 3300025961 Bacteria 1253
269 Ga0207668_10141239 3300025972 Bacteria 1852
270 Ga0207668_10454673 3300025972 Bacteria 1094
271 Ga0207640_10127039 3300025981 Bacteria 1837
272 Ga0207677_10335028 3300026023 Bacteria 1262
273 Ga0207639_10368004 3300026041 Bacteria 1288
274 Ga0207678_10183017 3300026067 Bacteria 1789
275 Ga0207678_10362284 3300026067 Bacteria 1251
276 Ga0207678_10487055 3300026067 Bacteria 1074
277 Ga0207708_10055814 3300026075 Bacteria 3012
278 Ga0207708_10072441 3300026075 Bacteria 2640
279 Ga0207702_10011437 3300026078 Bacteria 7398
280 Ga0207702_10060061 3300026078 Bacteria 3240
281 Ga0207702_10071613 3300026078 Bacteria 2985
282 Ga0207702_11459059 3300026078 Bacteria 678
283 Ga0207641_10528756 3300026088 Bacteria 1148
284 Ga0207641_11380021 3300026088 Bacteria 706
285 Ga0207648_10163011 3300026089 Bacteria 1969
286 Ga0207674_10079466 3300026116 Bacteria 3284
287 Ga0207674_10164151 3300026116 Bacteria 2175
288 Ga0207674_10225408 3300026116 Bacteria 1823
289 Ga0207674_10553475 3300026116 Bacteria 1111
290 Ga0207675_100033230 3300026118 Bacteria 4807
291 Ga0207683_10059053 3300026121 Bacteria 3368
292 Ga0207683_10697446 3300026121 Bacteria 941
293 Ga0207698_10358505 3300026142 Bacteria 1380
294 Ga0268266_10124316 3300028379 Bacteria 2300
295 Ga0326468_10007929 3300031889 Bacteria 1018
296 Ga0395899_0006360 3300037312 Bacteria 9148
297 Ga0395899_0049487 3300037312 Bacteria 3124
298 Ga0395900_0052573 3300037418 Bacteria 4193
299 Ga0395900_0078378 3300037418 Bacteria 3395
300 Ga0395900_0191921 3300037418 Bacteria 2071
301 Ga0395898_0038700 3300037466 Bacteria 4725
302 Ga0395898_0115936 3300037466 Bacteria 2566
303 Ga0395898_0205461 3300037466 Bacteria 1879
304 Ga0395898_0269542 3300037466 Bacteria 1624
305 Ga0395898_0809724 3300037466 Bacteria 877
306 Ga0395905_0049243 3300037471 Bacteria 3948
307 Ga0436364_1037164 3300037853 Bacteria 2885
308 Ga0395901_0000308 3300038443 Bacteria 59999
309 Ga0395901_0044084 3300038443 Bacteria 4626
310 Ga0395901_0078453 3300038443 Bacteria 3448
311 Ga0395901_0151257 3300038443 Bacteria 2439
312 Ga0395901_0360558 3300038443 Bacteria 1499
313 Ga0436365_0516306 3300039437 Bacteria 11593
314 Ga0436365_0561527 3300039437 Bacteria 4183
315 Ga0436365_1086679 3300039437 Bacteria 1961
316 Ga0436365_1290606 3300039437 Bacteria 1914
317 Ga0436365_1437680 3300039437 Bacteria 1134
318 Ga0436362_1009668 3300039453 Unclassified 1125
319 Ga0439452_013303 3300042010 Bacteria 2314
320 Ga0439463_083502 3300042016 Bacteria 822
321 Ga0466969_0007001 3300044656 Bacteria 6000
322 Ga0466965_0107644 3300044683 Bacteria 1430
323 Ga0466966_0004706 3300044684 Bacteria 8982
324 Ga0466966_0041720 3300044684 Bacteria 2948
325 Ga0466966_0109114 3300044684 Bacteria 1707
326 Ga0466966_0111895 3300044684 Unclassified 1683
327 Ga0466966_0301611 3300044684 Unclassified 963
328 Ga0466961_0023948 3300044693 Bacteria 3928
329 Ga0466961_0232245 3300044693 Bacteria 1135
330 Ga0466961_0232632 3300044693 Bacteria 1134
331 Ga0466963_0002465 3300044694 Bacteria 10344
332 Ga0466963_0006112 3300044694 Bacteria 7100
333 Ga0466963_0006274 3300044694 Bacteria 7029
334 Ga0466963_0009527 3300044694 Bacteria 5850
335 Ga0466963_0059532 3300044694 Bacteria 2549
336 Ga0466963_0064264 3300044694 Bacteria 2458
337 Ga0466963_0070435 3300044694 Bacteria 2352
338 Ga0466963_0072018 3300044694 Bacteria 2327
339 Ga0466964_0001548 3300044706 Bacteria 7904
340 Ga0466964_0002284 3300044706 Bacteria 6799
341 Ga0466964_0020727 3300044706 Bacteria 2534
342 Ga0466964_0038724 3300044706 Bacteria 1918
343 Ga0466964_0080120 3300044706 Bacteria 1400
344 Ga0466971_0003121 3300044719 Bacteria 7051
345 Ga0466971_0043507 3300044719 Bacteria 2018
346 Ga0466971_0079779 3300044719 Bacteria 1492
347 Ga0466968_0137153 3300044735 Bacteria 1116
348 Ga0466970_0002735 3300044765 Bacteria 8523
349 Ga0466970_0140041 3300044765 Unclassified 1332
350 Ga0466970_0140746 3300044765 Bacteria 1329
351 Ga0466970_0348290 3300044765 Bacteria 840
352 Ga0466957_0029353 3300044842 Bacteria 3279
353 Ga0466957_0068808 3300044842 Bacteria 2186
354 Ga0466960_0000125 3300044901 Bacteria 25681
355 Ga0466960_0016017 3300044901 Bacteria 3243
356 Ga0466960_0153200 3300044901 Bacteria 1233
357 Ga0466959_0011059 3300045049 Bacteria 6476
358 Ga0466959_0064303 3300045049 Bacteria 2663
359 Ga0466959_0093704 3300045049 Bacteria 2155
360 Ga0466959_0095236 3300045049 Bacteria 2135
361 Ga0466959_0157571 3300045049 Bacteria 1597
362 Ga0466959_0321727 3300045049 Bacteria 1057
363 Ga0466959_0333482 3300045049 Bacteria 1035
364 Ga0466958_0005347 3300045836 Bacteria 6898
365 Ga0466958_0014957 3300045836 Bacteria 4438
366 Ga0466958_0020814 3300045836 Bacteria 3828
367 Ga0466958_0052179 3300045836 Bacteria 2478
368 Ga0466958_0054424 3300045836 Bacteria 2427
369 Ga0466958_0083580 3300045836 Bacteria 1968
370 Ga0466958_0107489 3300045836 Bacteria 1740
371 Ga0466958_0175362 3300045836 Bacteria 1359
372 Ga0466958_0176076 3300045836 Bacteria 1356
373 Ga0466967_0002632 3300045976 Bacteria 11303
374 Ga0466967_0005603 3300045976 Bacteria 8733
375 Ga0466967_0020541 3300045976 Bacteria 5343
376 Ga0466967_0080404 3300045976 Bacteria 2941
377 Ga0466967_0107620 3300045976 Bacteria 2557
378 Ga0466967_0151340 3300045976 Bacteria 2169
379 Ga0466967_0159973 3300045976 Bacteria 2113
380 Ga0466967_0213071 3300045976 Bacteria 1833
381 Ga0466967_0214131 3300045976 Bacteria 1828
382 Ga0466967_0253748 3300045976 Bacteria 1681
383 Ga0466967_0438964 3300045976 Bacteria 1274
384 Ga0496100_0615272 3300048903 Bacteria 844
385 Ga0496100_0633477 3300048903 Unclassified 832
386 Ga0496101_0253058 3300048904 Bacteria 1373
387 Ga0496102_0115949 3300048905 Bacteria 2499
388 Ga0496102_0122620 3300048905 Bacteria 2428
389 Ga0496102_0244476 3300048905 Bacteria 1692
390 Ga0496102_0301608 3300048905 Bacteria 1510
391 Ga0496103_0073508 3300048906 Bacteria 2142
392 Ga0496103_0132888 3300048906 Bacteria 1590
393 Ga0496104_0268736 3300048907 Bacteria 1618
394 Ga0496104_0666726 3300048907 Bacteria 949
395 Ga0496107_0352780 3300048910 Bacteria 1095
396 Ga0496108_0009863 3300048911 Bacteria 7740
397 Ga0496108_0123535 3300048911 Bacteria 2221
398 Ga0496108_0450449 3300048911 Bacteria 1124
399 Ga0496109_0002143 3300048912 Bacteria 16424
400 Ga0496109_0400734 3300048912 Bacteria 1296
401 Ga0496110_0003010 3300048913 Bacteria 12781
402 Ga0496110_0419335 3300048913 Bacteria 1220
403 Ga0496110_0484952 3300048913 Bacteria 1126
404 Ga0496110_0796131 3300048913 Bacteria 849
405 Ga0496111_0015342 3300048914 Bacteria 5255
406 Ga0496111_0424841 3300048914 Bacteria 982
407 Ga0496112_0073821 3300048915 Bacteria 3372
408 Ga0496112_0106539 3300048915 Bacteria 2773
409 Ga0496113_0017572 3300048916 Bacteria 4968
410 Ga0496113_0269231 3300048916 Unclassified 1361
411 Ga0496114_0169692 3300048917 Bacteria 1901
412 Ga0496114_0466955 3300048917 Bacteria 1117
413 Ga0501069_0042359 3300049585 Bacteria 2518
414 Ga0501069_0054418 3300049585 Bacteria 2229
415 Ga0501069_0238583 3300049585 Bacteria 1059
416 Ga0501070_0003049 3300049586 Bacteria 14589
417 Ga0501070_0005128 3300049586 Bacteria 11167
418 Ga0501070_0075066 3300049586 Bacteria 2799
419 Ga0501070_0261269 3300049586 Bacteria 1415
420 Ga0501072_0026171 3300049588 Bacteria 4547
421 Ga0501072_0110532 3300049588 Bacteria 2188
422 Ga0501073_0118869 3300049589 Bacteria 1832
423 Ga0501074_0006767 3300049590 Bacteria 8275
424 Ga0501074_0014579 3300049590 Bacteria 5718
425 Ga0501074_0034188 3300049590 Bacteria 3685
426 Ga0501074_0243077 3300049590 Unclassified 1280
427 Ga0501079_0202941 3300049741 Bacteria 1549
428 Ga0501079_0322005 3300049741 Bacteria 1210
429 Ga0501080_0022733 3300049742 Bacteria 5809
430 Ga0501080_0025127 3300049742 Bacteria 5529
431 Ga0501080_0614182 3300049742 Unclassified 964
432 Ga0501083_0009358 3300049744 Bacteria 6917
433 Ga0501035_0285596 3300049822 Bacteria 1393
434 Ga0501044_0253276 3300049823 Bacteria 1701
435 nmdc:mga03683_16634_c2 3300050489 Bacteria 2437
436 nmdc:mga08y16_779622_c1 3300050511 Bacteria 950
437 Ga0495619_0073331 3300053085 Bacteria 2294
438 Ga0590077_063688 3300059426 Bacteria 837
439 Ga0501082_0677033 3300060353 Bacteria 903
440 Ga0466962_0006915 3300061719 Bacteria 5438
441 Ga0105240_10766522
442 rootH1_10142899
443 Ga0070658_10085767
444 Ga0070658_10096677
445 Ga0070658_10251831
446 Ga0070683_100002930
447 Ga0070683_100009898
448 Ga0070683_100165184
449 Ga0070683_100193314
450 Ga0070683_100250017
451 Ga0070683_100251047
452 Ga0070683_100374868
453 Ga0070670_100414120
454 Ga0068869_100159443
455 Ga0070680_100015369
456 Ga0070680_100035521
457 Ga0070680_100047560
458 Ga0070680_100064694
459 Ga0070680_100177945
460 Ga0070682_100028812
461 Ga0070682_100030034
462 Ga0070682_100078105
463 Ga0070682_100188859
464 Ga0070682_100214692
465 Ga0070682_100513441
466 Ga0068868_100017660
467 Ga0070660_100068728
468 Ga0070660_100103562
469 Ga0070660_100374026
470 Ga0070660_101115822
471 Ga0070689_100184811
472 Ga0070689_100263996
473 Ga0070691_10060279
474 Ga0070687_100088437
475 Ga0070661_100009888
476 Ga0070661_100018395
477 Ga0070668_100022539
478 Ga0070669_100030404
479 Ga0070675_100340372
480 Ga0070674_100132615
481 Ga0070674_100853381
482 Ga0070688_100283887
483 Ga0070688_100420822
484 Ga0070659_100013451
485 Ga0070659_100019174
486 Ga0070659_100215464
487 Ga0070714_100065404
488 Ga0070714_100368525
489 Ga0070714_100442834
490 Ga0070713_100020118
491 Ga0070713_100389396
492 Ga0070705_100004606
493 Ga0070700_100044048
494 Ga0070694_100385244
495 Ga0070708_100136678
496 Ga0070708_100720988
497 Ga0070663_100116669
498 Ga0070663_100190995
499 Ga0070663_100524469
500 Ga0070678_100071792
501 Ga0070662_100572220
502 Ga0070681_10007287
503 Ga0070681_10021325
504 Ga0070681_10027551
505 Ga0070681_10041818
506 Ga0070681_10083296
507 Ga0070681_10087670
508 Ga0070681_10090508
509 Ga0070681_10091592
510 Ga0070681_10329487
511 Ga0070681_10604522
512 Ga0070685_10361357
513 Ga0070706_100197413
514 Ga0070706_100461261
515 Ga0070707_100077483
516 Ga0070679_100017297
517 Ga0070679_100017538
518 Ga0070679_100048809
519 Ga0070679_100067811
520 Ga0070679_100117777
521 Ga0070679_100212027
522 Ga0070679_100226757
523 Ga0070679_100335880
524 Ga0070679_100418985
525 Ga0070684_100021047
526 Ga0070684_100025797
527 Ga0070684_100064939
528 Ga0070684_100408085
529 Ga0070684_100412876
530 Ga0068853_100082117
531 Ga0068853_100214643
532 Ga0070686_100027807
533 Ga0070695_100136116
534 Ga0070696_100008238
535 Ga0070696_100018724
536 Ga0070693_100022235
537 Ga0070693_100143353
538 Ga0070693_100166180
539 Ga0070665_100056118
540 Ga0070665_100121436
541 Ga0070665_100767022
542 Ga0070704_100011458
543 Ga0068855_100095601
544 Ga0068855_100411797
545 Ga0068855_100522821
546 Ga0070664_100043864
547 Ga0070664_100060278
548 Ga0068857_100011802
549 Ga0068857_100174147
550 Ga0068857_100214124
551 Ga0068857_100293454
552 Ga0068854_100159305
553 Ga0068854_100304255
554 Ga0068854_100327234
555 Ga0068856_100102242
556 Ga0068852_100078841
557 Ga0068864_100080304
558 Ga0068861_100076420
559 Ga0068858_100267347
560 Ga0068858_100307939
561 Ga0068860_100179480
562 Ga0068860_100864682
563 Ga0068862_100318268
564 Ga0070717_10420893
565 Ga0070717_10488715
566 Ga0068871_100716394
567 Ga0068871_100744367
568 Ga0075428_100279336
569 Ga0075430_100385902
570 Ga0105240_10012558
571 Ga0105240_10047551
572 Ga0105240_10474926
573 Ga0105240_10533727
574 Ga0111539_10138191
575 Ga0105245_10009115
576 Ga0105245_10304537
577 Ga0105245_10406254
578 Ga0105245_10673374
579 Ga0105247_10200102
580 Ga0105243_10364887
581 Ga0105243_11336041
582 Ga0105241_10066108
583 Ga0105237_10111462
584 Ga0105238_10086742
585 Ga0105249_10183741
586 Ga0105239_10024255
587 Ga0105239_10075278
588 Ga0105239_10417402
589 Ga0105246_10012571
590 Ga0105246_10290841
591 Ga0157370_10001705
592 Ga0157370_10004906
593 Ga0157370_10782831
594 Ga0157369_10004176
595 Ga0157369_10018535
596 Ga0157369_10194011
597 Ga0157369_10341825
598 Ga0157369_10457674
599 Ga0163162_10441355
600 Ga0157372_10016630
601 Ga0157372_10059932
602 Ga0157372_10180270
603 Ga0157372_10238305
604 Ga0157372_10549860
605 Ga0157372_10625810
606 Ga0157372_10636552
607 Ga0157372_10856065
608 Ga0157375_10373014
609 Ga0163163_10073740
610 Ga0163163_10429794
611 Ga0157380_10109307
612 Ga0182008_10092847
613 Ga0157377_10294168
614 Ga0157377_10511236
615 Ga0157377_10716387
616 Ga0157379_10203764
617 Ga0157376_10757435
618 Ga0163161_10649843
619 Ga0206354_10255970
620 Ga0206353_10150554
621 Ga0206353_11405735
622 Ga0206353_11837697
623 Ga0213876_10007823
624 Ga0213876_10204954
625 Ga0207656_10076570
626 Ga0207710_10122718
627 Ga0207688_10045059
628 Ga0207688_10085449
629 Ga0207688_10161490
630 Ga0207688_10334381
631 Ga0207647_10182659
632 Ga0207643_10020160
633 Ga0207705_10078013
634 Ga0207705_10100111
635 Ga0207705_10111505
636 Ga0207684_10132583
637 Ga0207684_10448263
638 Ga0207654_10129324
639 Ga0207707_10012620
640 Ga0207707_10013550
641 Ga0207707_10040144
642 Ga0207707_10047495
643 Ga0207707_10091611
644 Ga0207707_10125231
645 Ga0207707_10159652
646 Ga0207707_10292090
647 Ga0207707_10432620
648 Ga0207695_10207327
649 Ga0207695_10284359
650 Ga0207695_10380798
651 Ga0207671_10057811
652 Ga0207660_10022383
653 Ga0207660_10030679
654 Ga0207660_10031296
655 Ga0207660_10068240
656 Ga0207660_10088015
657 Ga0207660_10091692
658 Ga0207662_10053418
659 Ga0207662_10135134
660 Ga0207657_10003888
661 Ga0207657_10078150
662 Ga0207657_10163098
663 Ga0207657_10164700
664 Ga0207657_10217998
665 Ga0207657_10411020
666 Ga0207657_10529555
667 Ga0207657_10928813
668 Ga0207649_10082421
669 Ga0207652_10009700
670 Ga0207652_10030209
671 Ga0207652_10063473
672 Ga0207652_10101234
673 Ga0207652_10345404
674 Ga0207652_10505630
675 Ga0207652_10526594
676 Ga0207646_10049502
677 Ga0207694_10019663
678 Ga0207659_10184591
679 Ga0207687_10042382
680 Ga0207687_10071631
681 Ga0207687_10284672
682 Ga0207687_10423519
683 Ga0207700_10618377
684 Ga0207664_10003930
685 Ga0207664_10059438
686 Ga0207690_10025011
687 Ga0207690_10046801
688 Ga0207690_10332214
689 Ga0207706_10139322
690 Ga0207709_10283662
691 Ga0207670_10018614
692 Ga0207669_10027410
693 Ga0207689_10528333
694 Ga0207661_10001120
695 Ga0207661_10017811
696 Ga0207661_10022976
697 Ga0207661_10130351
698 Ga0207661_10154860
699 Ga0207661_10163630
700 Ga0207661_10240871
701 Ga0207679_10050203
702 Ga0207679_10502799
703 Ga0207667_10109841
704 Ga0207667_10164609
705 Ga0207667_10471980
706 Ga0207667_10704351
707 Ga0207651_11036486
708 Ga0207712_10335102
709 Ga0207668_10141239
710 Ga0207668_10454673
711 Ga0207640_10127039
712 Ga0207677_10335028
713 Ga0207639_10368004
714 Ga0207678_10183017
715 Ga0207678_10362284
716 Ga0207678_10487055
717 Ga0207708_10055814
718 Ga0207708_10072441
719 Ga0207702_10011437
720 Ga0207702_10060061
721 Ga0207702_10071613
722 Ga0207702_11459059
723 Ga0207641_10528756
724 Ga0207641_11380021
725 Ga0207648_10163011
726 Ga0207674_10079466
727 Ga0207674_10164151
728 Ga0207674_10225408
729 Ga0207674_10553475
730 Ga0207675_100033230
731 Ga0207683_10059053
732 Ga0207683_10697446
733 Ga0207698_10358505
734 Ga0268266_10124316
735 Ga0326468_10007929
736 Ga0395899_0006360
737 Ga0395899_0049487
738 Ga0395900_0052573
739 Ga0395900_0078378
740 Ga0395900_0191921
741 Ga0395898_0038700
742 Ga0395898_0115936
743 Ga0395898_0205461
744 Ga0395898_0269542
745 Ga0395898_0809724
746 Ga0395905_0049243
747 Ga0436364_1037164
748 Ga0395901_0000308
749 Ga0395901_0044084
750 Ga0395901_0078453
751 Ga0395901_0151257
752 Ga0395901_0360558
753 Ga0436365_0516306
754 Ga0436365_0561527
755 Ga0436365_1086679
756 Ga0436365_1290606
757 Ga0436365_1437680
758 Ga0436362_1009668
759 Ga0439452_013303
760 Ga0439463_083502
761 Ga0466969_0007001
762 Ga0466965_0107644
763 Ga0466966_0004706
764 Ga0466966_0041720
765 Ga0466966_0109114
766 Ga0466966_0111895
767 Ga0466966_0301611
768 Ga0466961_0023948
769 Ga0466961_0232245
770 Ga0466961_0232632
771 Ga0466963_0002465
772 Ga0466963_0006112
773 Ga0466963_0006274
774 Ga0466963_0009527
775 Ga0466963_0059532
776 Ga0466963_0064264
777 Ga0466963_0070435
778 Ga0466963_0072018
779 Ga0466964_0001548
780 Ga0466964_0002284
781 Ga0466964_0020727
782 Ga0466964_0038724
783 Ga0466964_0080120
784 Ga0466971_0003121
785 Ga0466971_0043507
786 Ga0466971_0079779
787 Ga0466968_0137153
788 Ga0466970_0002735
789 Ga0466970_0140041
790 Ga0466970_0140746
791 Ga0466970_0348290
792 Ga0466957_0029353
793 Ga0466957_0068808
794 Ga0466960_0000125
795 Ga0466960_0016017
796 Ga0466960_0153200
797 Ga0466959_0011059
798 Ga0466959_0064303
799 Ga0466959_0093704
800 Ga0466959_0095236
801 Ga0466959_0157571
802 Ga0466959_0321727
803 Ga0466959_0333482
804 Ga0466958_0005347
805 Ga0466958_0014957
806 Ga0466958_0020814
807 Ga0466958_0052179
808 Ga0466958_0054424
809 Ga0466958_0083580
810 Ga0466958_0107489
811 Ga0466958_0175362
812 Ga0466958_0176076
813 Ga0466967_0002632
814 Ga0466967_0005603
815 Ga0466967_0020541
816 Ga0466967_0080404
817 Ga0466967_0107620
818 Ga0466967_0151340
819 Ga0466967_0159973
820 Ga0466967_0213071
821 Ga0466967_0214131
822 Ga0466967_0253748
823 Ga0466967_0438964
824 Ga0496100_0615272
825 Ga0496100_0633477
826 Ga0496101_0253058
827 Ga0496102_0115949
828 Ga0496102_0122620
829 Ga0496102_0244476
830 Ga0496102_0301608
831 Ga0496103_0073508
832 Ga0496103_0132888
833 Ga0496104_0268736
834 Ga0496104_0666726
835 Ga0496107_0352780
836 Ga0496108_0009863
837 Ga0496108_0123535
838 Ga0496108_0450449
839 Ga0496109_0002143
840 Ga0496109_0400734
841 Ga0496110_0003010
842 Ga0496110_0419335
843 Ga0496110_0484952
844 Ga0496110_0796131
845 Ga0496111_0015342
846 Ga0496111_0424841
847 Ga0496112_0073821
848 Ga0496112_0106539
849 Ga0496113_0017572
850 Ga0496113_0269231
851 Ga0496114_0169692
852 Ga0496114_0466955
853 Ga0501069_0042359
854 Ga0501069_0054418
855 Ga0501069_0238583
856 Ga0501070_0003049
857 Ga0501070_0005128
858 Ga0501070_0075066
859 Ga0501070_0261269
860 Ga0501072_0026171
861 Ga0501072_0110532
862 Ga0501073_0118869
863 Ga0501074_0006767
864 Ga0501074_0014579
865 Ga0501074_0034188
866 Ga0501074_0243077
867 Ga0501079_0202941
868 Ga0501079_0322005
869 Ga0501080_0022733
870 Ga0501080_0025127
871 Ga0501080_0614182
872 Ga0501083_0009358
873 Ga0501035_0285596
874 Ga0501044_0253276
875 nmdc:mga03683_16634_c2
876 nmdc:mga08y16_779622_c1
877 Ga0495619_0073331
878 Ga0590077_063688
879 Ga0501082_0677033
880 Ga0466962_0006915

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03458

Gly_transporter

Glycine transporter

101

176

0.94

PF03458

Gly_transporter

Glycine transporter

16

91

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h36-assembly1.cif.gz_E crystal structures of the tric trimeric intracellular cation channel orthologue from rhodobacter sphaeroides 0.8521 5 179
5wtr-assembly2.cif.gz_F crystal structure of a prokaryotic tric channel in 0.5 m kcl 0.8286 7 182
5wue-assembly1.cif.gz_A structural basis for conductance through tric cation channels 0.8165 10 190
5h36-assembly1.cif.gz_E crystal structures of the tric trimeric intracellular cation channel orthologue from rhodobacter sphaeroides 0.7806 5 179
5wuf-assembly1.cif.gz_A structural basis for conductance through tric cation channels 0.774 8 183
ID Description Score Start End Superfamily
af_P0AFP0_4_80_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.9732 10 83 1.10.10.1740
af_P0AGM2_4_80_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.9363 10 85 1.10.10.1740
af_P0AFP0_91_166_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.9157 97 170 1.10.10.1740
af_P0AFP0_4_80_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.9124 10 83 1.10.10.1740
af_P0AGM2_4_80_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.9025 10 85 1.10.10.1740
ID Description Score Start End GO Terms
AF-A0A357MIK2-F1-model_v4 Glycine transporter domain-containing protein 0.9782 27 165 GO:0005886
AF-A0A2S8MPN2-F1-model_v4 deleted 0.9781 44 174
AF-A0A7Y3JHE5-F1-model_v4 Trimeric intracellular cation channel family protein 0.9728 7 141 GO:0005886
AF-A0A3M5CPB1-F1-model_v4 deleted 0.9694 9 138
AF-A0A537FD45-F1-model_v4 Trimeric intracellular cation channel family protein 0.9639 5 143 GO:0005886

Map