F444278

General Info

Members Datasets Scaffolds Average Seq Length
439 216 411 199

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0076116|Ga0495648_0076116_118_825
Length 235
Sequence LNWQRSCKPPNPLKGEQEILTILNIRNKRYNDMNEQVSKANSPIRGRGGILIIDNYDSFTYNLVHLVNELGQQCEVWRNDKFAIDDVDAFDKIILSPGPGIPSEAGLLLDVIEKYSPTKSIFGVCLGQQAIAEVFGGSLYNLSQPMHGIATPIKVTNRQEPLFKDLPDTFKVGRYHSWVVSDKDLPQVLQVTAIDEEDNSIMALSHREYDVRGVQFHPESILTQYGKELMQNWLS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2738541284 Pedobacter sp. YR016 Isolate Unclassified
5 2738541302 Pedobacter sp. CF074 Isolate Unclassified
6 2738543023 Pedobacter sp. OK628 Isolate Unclassified
7 2739367651 Pedobacter sp. OK291 Isolate Unclassified
8 2739367656 Pedobacter sp. CF523 Isolate Unclassified
9 2739367663 Pedobacter sp. YR510 Isolate Unclassified
10 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
11 2818991437 Pedobacter terrae 518 Isolate Unclassified
12 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
13 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
14 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
15 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
16 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
17 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
18 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
19 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
20 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
21 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
22 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
23 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
24 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
25 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
26 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
27 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
28 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
29 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
30 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
31 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
32 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
33 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
34 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
35 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
36 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
37 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
38 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
39 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
40 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
41 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
42 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
43 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
44 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
45 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
46 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
47 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
50 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
51 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
52 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
53 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
54 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
104 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
107 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
108 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
109 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
110 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
111 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
163 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
164 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
176 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
179 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
180 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
181 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
182 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
185 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
190 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
191 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
192 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
193 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
194 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
195 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
196 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
201 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
206 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
207 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
210 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
211 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
212 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
213 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
214 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
215 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
216 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.94
Metatranscriptomes 0.68
Isolates 6.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.66
Nodule 0
Rhizoplane 0.91
Rhizosphere 82
Stem 0
Stem Tuber 0
Unclassified 8.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3644333 2162886007 Bacteria 4177
2 JGI24736J21556_1001996 3300001904 Bacteria 3626
3 JGI24736J21556_1006200 3300001904 Bacteria 2016
4 JGI24741J21665_1010754 3300001915 Bacteria 1623
5 JGI24740J21852_10025058 3300001979 Bacteria 2015
6 JGI24740J21852_10031857 3300001979 Bacteria 1693
7 JGI24739J22299_10012865 3300001989 Bacteria 3065
8 JGI24739J22299_10013000 3300001989 Bacteria 3046
9 JGI24737J22298_10001771 3300001990 Bacteria 7731
10 JGI24737J22298_10006255 3300001990 Bacteria 4076
11 JGI24735J21928_10000007 3300002067 Bacteria 333510
12 JGI25162J39368_1000055 3300002737 Bacteria 147236
13 JGI25162J39368_1001849 3300002737 Bacteria 9811
14 JGI25152J39213_1000016 3300002773 Bacteria 110433
15 JGI25150J39212_1000003 3300002774 Bacteria 508651
16 JGI25150J39212_1000004 3300002774 Bacteria 417320
17 JGI25151J46595_10000002 3300003187 Bacteria 731381
18 JGI25165J46597_1000305 3300003214 Bacteria 61229
19 JGI25153J46596_10000015 3300003215 Bacteria 289820
20 rootH1_10016176 3300003316 Bacteria 26999
21 rootH1_10016176 3300003323 Bacteria 2806
22 rootH2_10001273 3300003320 Bacteria 179792
23 rootH2_10173626 3300003320 Bacteria 1054
24 rootH2_10236101 3300003320 Bacteria 1723
25 rootL2_10166471 3300003322 Bacteria 2556
26 rootL2_10290323 3300003322 Bacteria 1534
27 rootH1_10005288 3300003323 Bacteria 25229
28 rootH1_10015911 3300003323 Bacteria 2460
29 rootH1_10109363 3300003323 Bacteria 1947
30 rootH1_10122919 3300003323 Bacteria 1442
31 rootH1_10151469 3300003323 Bacteria 2104
32 Ga0055536_1000006 3300003781 Bacteria 347733
33 Ga0055530_10004623 3300003791 Bacteria 7006
34 Ga0058863_11839005 3300004799 Bacteria 13465
35 Ga0058862_12232769 3300004803 Bacteria 1437
36 Ga0065714_10002214 3300005288 Bacteria 58836
37 Ga0065714_10004278 3300005288 Bacteria 7122
38 Ga0065714_10004780 3300005288 Bacteria 13537
39 Ga0065714_10031206 3300005288 Bacteria 1028
40 Ga0065714_10075856 3300005288 Bacteria 2857
41 Ga0065714_10079969 3300005288 Bacteria 2475
42 Ga0065714_10080698 3300005288 Bacteria 2422
43 Ga0065714_10122825 3300005288 Bacteria 1328
44 Ga0065714_10209708 3300005288 Bacteria 870
45 Ga0065704_10000206 3300005289 Bacteria 121672
46 Ga0065704_10073053 3300005289 Bacteria 7630
47 Ga0070658_10000008 3300005327 Bacteria 319912
48 Ga0070658_10040982 3300005327 Bacteria 3736
49 Ga0070658_10095360 3300005327 Bacteria 2456
50 Ga0070676_10015945 3300005328 Bacteria 4147
51 Ga0068869_100184796 3300005334 Bacteria 1636
52 Ga0070680_100003016 3300005336 Bacteria 12497
53 Ga0068868_100138788 3300005338 Bacteria 1994
54 Ga0070660_100025877 3300005339 Bacteria 4364
55 Ga0070660_100026304 3300005339 Bacteria 4331
56 Ga0070660_100082220 3300005339 Bacteria 2529
57 Ga0070671_100016950 3300005355 Bacteria 5892
58 Ga0070673_100006158 3300005364 Bacteria 7774
59 Ga0070659_100003407 3300005366 Bacteria 11330
60 Ga0070659_100034316 3300005366 Bacteria 3946
61 Ga0070663_100000447 3300005455 Bacteria 21810
62 Ga0070678_100384968 3300005456 Bacteria 1214
63 Ga0070662_100000468 3300005457 Bacteria 24024
64 Ga0070681_10344374 3300005458 Bacteria 1401
65 Ga0068867_100004709 3300005459 Bacteria 9601
66 Ga0070679_100007681 3300005530 Bacteria 10095
67 Ga0070679_100193940 3300005530 Bacteria 1999
68 Ga0068853_100024320 3300005539 Bacteria 5077
69 Ga0068853_100037508 3300005539 Bacteria 4124
70 Ga0070665_100000118 3300005548 Bacteria 149830
71 Ga0068855_100001431 3300005563 Bacteria 29691
72 Ga0068855_100004525 3300005563 Bacteria 16986
73 Ga0068855_100019618 3300005563 Bacteria 8121
74 Ga0068855_100032516 3300005563 Bacteria 6227
75 Ga0068855_100101116 3300005563 Bacteria 3319
76 Ga0068855_100284593 3300005563 Bacteria 1834
77 Ga0068857_100114976 3300005577 Bacteria 2420
78 Ga0068854_100043274 3300005578 Bacteria 3191
79 Ga0068854_100681665 3300005578 Bacteria 885
80 Ga0068856_100000108 3300005614 Bacteria 81559
81 Ga0068856_100008974 3300005614 Bacteria 9730
82 Ga0068856_100015811 3300005614 Bacteria 7299
83 Ga0068856_100051537 3300005614 Bacteria 4058
84 Ga0068852_100016148 3300005616 Bacteria 5813
85 Ga0068864_100610354 3300005618 Bacteria 1059
86 Ga0075366_10065981 3300006195 Bacteria 2153
87 Ga0097621_100000015 3300006237 Bacteria 92182
88 Ga0068871_100000051 3300006358 Bacteria 64844
89 Ga0068865_100000120 3300006881 Bacteria 39809
90 Ga0105244_10017654 3300009036 Bacteria 4027
91 Ga0105240_10000158 3300009093 Bacteria 139180
92 Ga0105240_10036011 3300009093 Bacteria 6373
93 Ga0105240_10045368 3300009093 Bacteria 5576
94 Ga0105240_10153572 3300009093 Bacteria 2740
95 Ga0105240_10545044 3300009093 Bacteria 1284
96 Ga0105240_10590105 3300009093 Bacteria 1224
97 Ga0105240_10665634 3300009093 Bacteria 1140
98 Ga0105240_11042649 3300009093 Bacteria 873
99 Ga0105240_11694200 3300009093 Bacteria 660
100 Ga0105245_10362676 3300009098 Bacteria 1438
101 Ga0105241_10007909 3300009174 Bacteria 7817
102 Ga0105241_10008119 3300009174 Bacteria 7727
103 Ga0105241_10117108 3300009174 Bacteria 2141
104 Ga0105241_10127353 3300009174 Bacteria 2058
105 Ga0105241_10601964 3300009174 Bacteria 993
106 Ga0105241_10701193 3300009174 Bacteria 924
107 Ga0105237_10000813 3300009545 Bacteria 42706
108 Ga0105237_10004869 3300009545 Bacteria 15388
109 Ga0105237_10006094 3300009545 Bacteria 13480
110 Ga0105237_10023728 3300009545 Bacteria 6280
111 Ga0105237_10024437 3300009545 Bacteria 6181
112 Ga0105237_10035341 3300009545 Bacteria 5057
113 Ga0105237_10073531 3300009545 Bacteria 3410
114 Ga0105237_10689634 3300009545 Bacteria 1028
115 Ga0105238_10021356 3300009551 Bacteria 6596
116 Ga0105238_10208643 3300009551 Bacteria 1929
117 Ga0105238_10325931 3300009551 Bacteria 1522
118 Ga0105239_10000008 3300010375 Bacteria 376925
119 Ga0105239_10000095 3300010375 Bacteria 124330
120 Ga0105239_10000327 3300010375 Bacteria 70423
121 Ga0105239_10000428 3300010375 Bacteria 61391
122 Ga0105239_10004144 3300010375 Bacteria 17403
123 Ga0105239_10006307 3300010375 Bacteria 13793
124 Ga0105239_10080410 3300010375 Bacteria 3586
125 Ga0105239_10097944 3300010375 Bacteria 3241
126 Ga0105246_10243182 3300011119 Bacteria 1424
127 Ga0105246_10664017 3300011119 Bacteria 909
128 Ga0157373_10000152 3300013100 Bacteria 55831
129 Ga0157373_10008157 3300013100 Bacteria 7785
130 Ga0157373_10053561 3300013100 Bacteria 2869
131 Ga0157373_10220539 3300013100 Bacteria 1338
132 Ga0157371_10000117 3300013102 Bacteria 121069
133 Ga0157371_10000888 3300013102 Bacteria 33749
134 Ga0157371_10000912 3300013102 Bacteria 33281
135 Ga0157371_10001432 3300013102 Bacteria 24789
136 Ga0157371_10004676 3300013102 Bacteria 11836
137 Ga0157371_10008927 3300013102 Bacteria 7936
138 Ga0157371_10029645 3300013102 Bacteria 3954
139 Ga0157371_10102099 3300013102 Bacteria 2035
140 Ga0157371_10404934 3300013102 Bacteria 999
141 Ga0157370_10001102 3300013104 Bacteria 33889
142 Ga0157370_10004615 3300013104 Bacteria 15750
143 Ga0157370_10033672 3300013104 Bacteria 4995
144 Ga0157370_10036289 3300013104 Bacteria 4785
145 Ga0157370_10072938 3300013104 Bacteria 3239
146 Ga0157370_10088280 3300013104 Bacteria 2912
147 Ga0157370_10115681 3300013104 Bacteria 2505
148 Ga0157370_10183123 3300013104 Bacteria 1946
149 Ga0157370_10435419 3300013104 Bacteria 1206
150 Ga0157370_10479939 3300013104 Bacteria 1142
151 Ga0157369_10000047 3300013105 Bacteria 172682
152 Ga0157369_10000101 3300013105 Bacteria 118683
153 Ga0157369_10021821 3300013105 Bacteria 7160
154 Ga0157369_10064434 3300013105 Bacteria 3947
155 Ga0157369_10158513 3300013105 Bacteria 2389
156 Ga0157369_10198867 3300013105 Bacteria 2104
157 Ga0157374_10000137 3300013296 Bacteria 66006
158 Ga0157374_10000741 3300013296 Bacteria 28443
159 Ga0157374_10011439 3300013296 Bacteria 7684
160 Ga0157378_10023686 3300013297 Bacteria 5400
161 Ga0157378_10052948 3300013297 Bacteria 3612
162 Ga0163162_10000012 3300013306 Bacteria 292674
163 Ga0163162_10000557 3300013306 Bacteria 34493
164 Ga0163162_10064932 3300013306 Bacteria 3696
165 Ga0157372_10000041 3300013307 Bacteria 158494
166 Ga0157372_10000199 3300013307 Bacteria 66101
167 Ga0157372_10004737 3300013307 Bacteria 14447
168 Ga0157372_10004866 3300013307 Bacteria 14273
169 Ga0157372_10033897 3300013307 Bacteria 5611
170 Ga0157372_10232059 3300013307 Bacteria 2140
171 Ga0157375_10015704 3300013308 Bacteria 6784
172 Ga0157375_10116568 3300013308 Bacteria 2775
173 Ga0157375_10451058 3300013308 Bacteria 1452
174 Ga0157375_10746024 3300013308 Bacteria 1130
175 Ga0157375_11968520 3300013308 Bacteria 694
176 Ga0182008_10000020 3300014497 Bacteria 228333
177 Ga0182008_10000315 3300014497 Bacteria 38030
178 Ga0182008_10000894 3300014497 Bacteria 20715
179 Ga0182008_10026907 3300014497 Bacteria 2915
180 Ga0182008_10028891 3300014497 Bacteria 2803
181 Ga0182008_10033318 3300014497 Bacteria 2585
182 Ga0157377_10091154 3300014745 Bacteria 1800
183 Ga0157376_10525110 3300014969 Bacteria 1167
184 Ga0182006_1000153 3300015261 Bacteria 73985
185 Ga0182006_1000287 3300015261 Bacteria 44409
186 Ga0182006_1000947 3300015261 Bacteria 19348
187 Ga0182006_1001658 3300015261 Bacteria 13113
188 Ga0182006_1007627 3300015261 Bacteria 4944
189 Ga0182007_10000005 3300015262 Bacteria 442702
190 Ga0182007_10005366 3300015262 Bacteria 5639
191 Ga0182007_10013562 3300015262 Bacteria 3103
192 Ga0182007_10067380 3300015262 Bacteria 1172
193 Ga0183373_1002 3300015682 Bacteria 990153
194 Ga0163161_10000306 3300017792 Bacteria 42759
195 Ga0163161_10000360 3300017792 Bacteria 38354
196 Ga0163161_10002950 3300017792 Bacteria 12055
197 Ga0163161_10020833 3300017792 Bacteria 4604
198 Ga0163161_10089253 3300017792 Bacteria 2280
199 Ga0163161_10232431 3300017792 Bacteria 1431
200 Ga0206351_10418890 3300020077 Bacteria 712
201 Ga0213872_10018002 3300021361 Bacteria 3259
202 Ga0209563_111208 3300025230 Bacteria 1273
203 Ga0207427_100423 3300025231 Bacteria 23892
204 Ga0209437_100026 3300025233 Bacteria 542698
205 Ga0209437_100130 3300025233 Bacteria 183731
206 Ga0207425_1000003 3300025245 Bacteria 1145342
207 Ga0209026_1000304 3300025250 Bacteria 53704
208 Ga0209026_1004800 3300025250 Bacteria 3860
209 Ga0209129_1000014 3300025258 Bacteria 509018
210 Ga0209233_1000206 3300025261 Bacteria 117820
211 Ga0209233_1000466 3300025261 Bacteria 25583
212 Ga0209455_1000854 3300025272 Bacteria 16294
213 Ga0209676_1000039 3300025292 Bacteria 443158
214 Ga0209025_1000007 3300025294 Bacteria 1145109
215 Ga0209758_1000012 3300025297 Bacteria 949866
216 Ga0209050_1000033 3300025298 Bacteria 442615
217 Ga0207647_10000049 3300025904 Bacteria 88392
218 Ga0207647_10000103 3300025904 Bacteria 65792
219 Ga0207645_10000058 3300025907 Bacteria 78487
220 Ga0207705_10000026 3300025909 Bacteria 256051
221 Ga0207705_10023176 3300025909 Bacteria 4429
222 Ga0207654_10004708 3300025911 Bacteria 6903
223 Ga0207654_10008233 3300025911 Bacteria 5264
224 Ga0207654_10071425 3300025911 Bacteria 2063
225 Ga0207654_10075451 3300025911 Bacteria 2015
226 Ga0207654_10080178 3300025911 Bacteria 1962
227 Ga0207654_10355488 3300025911 Bacteria 1009
228 Ga0207707_10215707 3300025912 Bacteria 1671
229 Ga0207695_10000235 3300025913 Bacteria 146984
230 Ga0207695_10015443 3300025913 Bacteria 8988
231 Ga0207695_10099600 3300025913 Bacteria 2904
232 Ga0207695_10113439 3300025913 Bacteria 2686
233 Ga0207695_10142225 3300025913 Bacteria 2347
234 Ga0207695_10788183 3300025913 Bacteria 830
235 Ga0207671_10002136 3300025914 Bacteria 21585
236 Ga0207671_10003198 3300025914 Bacteria 16504
237 Ga0207671_10005006 3300025914 Bacteria 12403
238 Ga0207671_10007251 3300025914 Bacteria 9654
239 Ga0207671_10007981 3300025914 Bacteria 9066
240 Ga0207671_10008464 3300025914 Bacteria 8721
241 Ga0207671_10072347 3300025914 Bacteria 2573
242 Ga0207671_10436667 3300025914 Bacteria 1042
243 Ga0207660_10011225 3300025917 Bacteria 5827
244 Ga0207657_10025398 3300025919 Bacteria 5464
245 Ga0207657_10108142 3300025919 Bacteria 2299
246 Ga0207657_10152323 3300025919 Bacteria 1882
247 Ga0207652_10025777 3300025921 Bacteria 4892
248 Ga0207652_10235863 3300025921 Bacteria 1649
249 Ga0207694_10020393 3300025924 Bacteria 5015
250 Ga0207687_10127453 3300025927 Bacteria 1913
251 Ga0207644_10006841 3300025931 Bacteria 7431
252 Ga0207690_10013035 3300025932 Bacteria 4986
253 Ga0207690_10032027 3300025932 Bacteria 3370
254 Ga0207706_10000111 3300025933 Bacteria 87282
255 Ga0207704_10000353 3300025938 Bacteria 21450
256 Ga0207689_10179372 3300025942 Bacteria 1747
257 Ga0207667_10000457 3300025949 Bacteria 54773
258 Ga0207667_10001338 3300025949 Bacteria 30924
259 Ga0207667_10068214 3300025949 Bacteria 3704
260 Ga0207667_10342790 3300025949 Bacteria 1525
261 Ga0207651_10003306 3300025960 Bacteria 7899
262 Ga0207640_10021566 3300025981 Bacteria 3842
263 Ga0207640_10670570 3300025981 Bacteria 886
264 Ga0207677_10052634 3300026023 Bacteria 2767
265 Ga0207677_10093317 3300026023 Bacteria 2194
266 Ga0207639_10164453 3300026041 Bacteria 1873
267 Ga0207639_10379902 3300026041 Bacteria 1268
268 Ga0207702_10000183 3300026078 Bacteria 75210
269 Ga0207702_10004469 3300026078 Bacteria 12422
270 Ga0207702_10111849 3300026078 Bacteria 2429
271 Ga0207702_10298203 3300026078 Bacteria 1529
272 Ga0207648_10000458 3300026089 Bacteria 45301
273 Ga0207674_10549637 3300026116 Bacteria 1115
274 Ga0207674_10598934 3300026116 Bacteria 1065
275 Ga0207698_10076411 3300026142 Bacteria 2680
276 Ga0268266_10000121 3300028379 Bacteria 154995
277 Ga0307517_10001388 3300028786 Bacteria 40654
278 Ga0307515_10000077 3300028794 Bacteria 228162
279 Ga0307515_10007186 3300028794 Bacteria 22080
280 Ga0307515_10064389 3300028794 Bacteria 5126
281 Ga0307515_10215889 3300028794 Bacteria 1749
282 Ga0265338_10180333 3300028800 Bacteria 1611
283 Ga0307509_10060583 3300031507 Bacteria 4000
284 Ga0307408_100000982 3300031548 Bacteria 22029
285 Ga0307408_100001497 3300031548 Bacteria 17331
286 Ga0307408_100001841 3300031548 Bacteria 15452
287 Ga0307405_10000009 3300031731 Bacteria 259388
288 Ga0307407_10000001 3300031903 Bacteria 570048
289 Ga0307412_10000001 3300031911 Bacteria 822691
290 Ga0307412_10382014 3300031911 Bacteria 1141
291 Ga0307409_100055346 3300031995 Bacteria 3062
292 Ga0307416_100000008 3300032002 Bacteria 401343
293 Ga0307416_100301394 3300032002 Bacteria 1593
294 Ga0307414_10002136 3300032004 Bacteria 10322
295 Ga0307414_10010567 3300032004 Bacteria 5366
296 Ga0307414_10011567 3300032004 Bacteria 5181
297 Ga0307414_10023027 3300032004 Bacteria 3941
298 Ga0307414_10034571 3300032004 Bacteria 3353
299 Ga0307414_10044506 3300032004 Bacteria 3032
300 Ga0307414_10122029 3300032004 Bacteria 2005
301 Ga0307414_10131876 3300032004 Bacteria 1941
302 Ga0307414_10196064 3300032004 Bacteria 1638
303 Ga0307414_10277639 3300032004 Bacteria 1406
304 Ga0307414_10783552 3300032004 Bacteria 868
305 Ga0307411_10059720 3300032005 Bacteria 2529
306 Ga0307510_10000419 3300033180 Bacteria 40732
307 Ga0373941_0020124 3300035115 Bacteria 1867
308 Ga0395899_0000017 3300037312 Bacteria 440179
309 Ga0395899_0000024 3300037312 Bacteria 357402
310 Ga0395899_0007040 3300037312 Bacteria 8703
311 Ga0395899_0011940 3300037312 Bacteria 6655
312 Ga0395900_0001352 3300037418 Bacteria 29621
313 Ga0395900_0002394 3300037418 Bacteria 20683
314 Ga0395900_0004216 3300037418 Bacteria 15260
315 Ga0395900_0148954 3300037418 Bacteria 2392
316 Ga0395905_0000246 3300037471 Bacteria 81356
317 Ga0395905_0000347 3300037471 Bacteria 65943
318 Ga0395905_0742247 3300037471 Bacteria 884
319 Ga0395901_0000184 3300038443 Bacteria 81257
320 Ga0395901_0002910 3300038443 Bacteria 17294
321 Ga0436361_0970870 3300039447 Bacteria 6029
322 Ga0451806_607969 3300041462 Bacteria 609
323 Ga0439448_0032843 3300042005 Bacteria 1653
324 Ga0439455_0085479 3300042012 Bacteria 861
325 Ga0451577_0024730 3300042876 Bacteria 5459
326 Ga0466969_0018082 3300044656 Bacteria 3678
327 Ga0466966_0021578 3300044684 Bacteria 4229
328 Ga0466966_0504351 3300044684 Bacteria 728
329 Ga0466961_0008211 3300044693 Bacteria 6652
330 Ga0453684_0000212 3300044712 Bacteria 254110
331 Ga0466959_0035944 3300045049 Bacteria 3661
332 Ga0466959_0083332 3300045049 Bacteria 2303
333 Ga0466958_0047669 3300045836 Bacteria 2587
334 Ga0495627_042679 3300046453 Bacteria 1389
335 Ga0495627_115107 3300046453 Bacteria 762
336 Ga0495638_0152293 3300046460 Bacteria 1341
337 Ga0495651_0111723 3300046462 Bacteria 2020
338 Ga0495650_0000050 3300046471 Bacteria 318894
339 Ga0495650_0030667 3300046471 Bacteria 2431
340 Ga0495585_0000235 3300046492 Bacteria 57308
341 Ga0495585_0184466 3300046492 Bacteria 1071
342 Ga0495606_0000036 3300046507 Bacteria 234596
343 Ga0495606_0013057 3300046507 Bacteria 6598
344 Ga0495606_0014319 3300046507 Bacteria 6203
345 Ga0495606_0024849 3300046507 Bacteria 4305
346 Ga0495606_0089431 3300046507 Bacteria 1897
347 Ga0495606_0203101 3300046507 Bacteria 1128
348 Ga0495610_0002059 3300046512 Bacteria 17179
349 Ga0495610_0003036 3300046512 Bacteria 13440
350 Ga0495610_0005070 3300046512 Bacteria 9491
351 Ga0495616_0001383 3300046513 Bacteria 16895
352 Ga0495616_0002111 3300046513 Bacteria 13329
353 Ga0495631_0016955 3300046518 Bacteria 3456
354 Ga0495637_0066212 3300046520 Bacteria 1469
355 Ga0495644_0006793 3300046523 Bacteria 4432
356 Ga0495648_0013965 3300046524 Bacteria 5908
357 Ga0495648_0076116 3300046524 Bacteria 1928
358 Ga0495663_0020111 3300046525 Bacteria 1915
359 Ga0495609_0021112 3300046538 Bacteria 3004
360 Ga0495609_0025381 3300046538 Bacteria 2717
361 Ga0495633_0006385 3300046558 Bacteria 7000
362 Ga0495633_0022998 3300046558 Bacteria 3092
363 Ga0495668_0000058 3300046616 Bacteria 195501
364 Ga0495668_0148865 3300046616 Bacteria 1282
365 Ga0495625_0000105 3300046660 Bacteria 126078
366 Ga0495625_0000641 3300046660 Bacteria 50345
367 Ga0495625_0001733 3300046660 Bacteria 25233
368 Ga0495625_0051990 3300046660 Bacteria 2935
369 Ga0495625_0102214 3300046660 Bacteria 1967
370 Ga0495625_0126375 3300046660 Bacteria 1735
371 Ga0495661_0001381 3300046665 Bacteria 20445
372 Ga0495661_0012265 3300046665 Bacteria 5789
373 Ga0495661_0069661 3300046665 Bacteria 2060
374 Ga0495669_0052545 3300046684 Bacteria 1831
375 Ga0495671_0018260 3300046692 Bacteria 3724
376 Ga0495649_0000011 3300046694 Bacteria 416695
377 Ga0495649_0068501 3300046694 Bacteria 1904
378 Ga0495660_0001859 3300046810 Bacteria 13854
379 Ga0495660_0292029 3300046810 Bacteria 742
380 Ga0495683_0035400 3300047323 Bacteria 2538
381 Ga0495687_001623 3300047443 Bacteria 20253
382 Ga0495687_005259 3300047443 Bacteria 8316
383 Ga0495687_023232 3300047443 Bacteria 2964
384 Ga0495673_0010850 3300047469 Bacteria 4930
385 Ga0495686_0000341 3300047472 Bacteria 76751
386 Ga0495686_0001597 3300047472 Bacteria 23929
387 Ga0495686_0020165 3300047472 Bacteria 4448
388 Ga0495614_0056541 3300048089 Bacteria 1684
389 Ga0496115_0456454 3300048918 Bacteria 1031
390 Ga0496115_0586777 3300048918 Bacteria 887
391 Ga0496122_0000817 3300048925 Bacteria 59596
392 Ga0496123_0005275 3300048926 Bacteria 13103
393 Ga0496125_0071642 3300048928 Bacteria 2706
394 Ga0495678_006203 3300049459 Bacteria 6396
395 Ga0501033_0234158 3300049570 Bacteria 1304
396 Ga0501249_048089 3300049679 Bacteria 976
397 Ga0501241_020198 3300049758 Bacteria 1224
398 Ga0501280_021524 3300049776 Bacteria 963
399 nmdc:mga0k408_100626_c1 3300050493 Bacteria 1704
400 nmdc:mga0k408_3876_c1 3300050493 Bacteria 7927
401 nmdc:mga0k408_429_c1 3300050493 Bacteria 22975
402 Ga0500635_0012440 3300053080 Bacteria 2444
403 Ga0500651_0000130 3300053093 Bacteria 46487
404 Ga0500608_000417 3300053122 Bacteria 16208
405 Ga0500608_162140 3300053122 Bacteria 968
406 Ga0500618_000020 3300053125 Bacteria 161356
407 Ga0500618_084043 3300053125 Bacteria 714
408 Ga0500564_154905 3300053138 Bacteria 974
409 Ga0500622_0000173 3300053156 Bacteria 69414
410 Ga0500622_0021684 3300053156 Bacteria 3409
411 Ga0500624_001227 3300053157 Bacteria 4574

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032004 Ga0307414_10131876 Ga0307414_101318762 172
2 3300041462 Ga0451806_607969 Ga0451806_607969_13_534 172
3 3300032004 Ga0307414_10196064 Ga0307414_101960642 173
4 3300032005 Ga0307411_10059720 Ga0307411_100597202 173
5 iso_pu_bacteria 2852623160 2852627119 183
6 iso_pu_bacteria 2884933994 2884935149 185
7 iso_pu_bacteria 2738541284 2738761402 186
8 iso_pu_bacteria 2775506987 2776615988 186
9 iso_pu_bacteria 2945997725 2946003240 186
10 iso_pu_bacteria 2954016120 2954020102 186
11 3300013102 Ga0157371_10404934 Ga0157371_104049341 187
12 iso_pu_bacteria 2585427687 2586206759 187
13 iso_pu_bacteria 2599185184 2599481911 187
14 iso_pu_bacteria 2738541302 2738854904 187
15 iso_pu_bacteria 2739367656 2739614686 187
16 iso_pu_bacteria 2739367663 2739648097 187
17 iso_pu_bacteria 2818991437 2819547434 187
18 iso_pu_bacteria 2842722452 2842727577 187
19 iso_pu_bacteria 2842909656 2842911216 187
20 iso_pu_bacteria 2849281842 2849283170 187
21 iso_pu_bacteria 2857627736 2857630532 187
22 iso_pu_bacteria 2904445276 2904449675 187
23 iso_pu_bacteria 2928078545 2928084071 187
24 iso_pu_bacteria 2928147474 2928152837 187
25 3300005530 Ga0070679_100193940 Ga0070679_1001939402 188
26 3300005563 Ga0068855_100284593 Ga0068855_1002845932 188
27 3300005578 Ga0068854_100043274 Ga0068854_1000432742 188
28 3300005614 Ga0068856_100015811 Ga0068856_1000158119 188
29 3300005618 Ga0068864_100610354 Ga0068864_1006103542 188
30 3300009093 Ga0105240_10545044 Ga0105240_105450442 188
31 3300009174 Ga0105241_10601964 Ga0105241_106019641 188
32 3300009545 Ga0105237_10006094 Ga0105237_100060941 188
33 3300009545 Ga0105237_10023728 Ga0105237_100237288 188
34 3300009545 Ga0105237_10035341 Ga0105237_100353415 188
35 3300009551 Ga0105238_10325931 Ga0105238_103259312 188
36 3300010375 Ga0105239_10000095 Ga0105239_1000009551 188
37 3300010375 Ga0105239_10006307 Ga0105239_100063072 188
38 3300013104 Ga0157370_10183123 Ga0157370_101831232 188
39 3300013296 Ga0157374_10011439 Ga0157374_100114394 188
40 3300013307 Ga0157372_10004866 Ga0157372_1000486612 188
41 3300025914 Ga0207671_10005006 Ga0207671_100050068 188
42 3300025914 Ga0207671_10007981 Ga0207671_100079815 188
43 3300025914 Ga0207671_10072347 Ga0207671_100723472 188
44 3300025981 Ga0207640_10021566 Ga0207640_100215662 188
45 3300026078 Ga0207702_10004469 Ga0207702_100044696 188
46 3300031548 Ga0307408_100000982 Ga0307408_10000098219 188
47 3300031548 Ga0307408_100001841 Ga0307408_10000184112 188
48 3300032002 Ga0307416_100301394 Ga0307416_1003013941 188
49 3300037312 Ga0395899_0011940 Ga0395899_0011940_1396_2016 188
50 3300037418 Ga0395900_0002394 Ga0395900_0002394_3532_4152 188
51 3300037418 Ga0395900_0004216 Ga0395900_0004216_6827_7447 188
52 3300037471 Ga0395905_0000347 Ga0395905_0000347_52401_53021 188
53 3300038443 Ga0395901_0002910 Ga0395901_0002910_11518_12138 188
54 3300046471 Ga0495650_0030667 Ga0495650_0030667_323_934 188
55 3300046507 Ga0495606_0089431 Ga0495606_0089431_748_1320 188
56 3300046507 Ga0495606_0203101 Ga0495606_0203101_402_971 188
57 3300046513 Ga0495616_0002111 Ga0495616_0002111_5637_6248 188
58 3300046660 Ga0495625_0102214 Ga0495625_0102214_1146_1757 188
59 3300046660 Ga0495625_0126375 Ga0495625_0126375_211_822 188
60 3300046665 Ga0495661_0001381 Ga0495661_0001381_12478_13047 188
61 3300046665 Ga0495661_0012265 Ga0495661_0012265_4585_5154 188
62 3300047472 Ga0495686_0000341 Ga0495686_0000341_41956_42528 188
63 3300048918 Ga0496115_0586777 Ga0496115_0586777_214_825 188
64 3300049459 Ga0495678_006203 Ga0495678_006203_1451_2062 188
65 3300049570 Ga0501033_0234158 Ga0501033_0234158_569_1135 188
66 3300053125 Ga0500618_000020 Ga0500618_000020_20255_20866 188
67 3300053138 Ga0500564_154905 Ga0500564_154905_55_624 188
68 3300002737 JGI25162J39368_1000055 JGI25162J39368_100005598 189
69 3300003320 rootH2_10001273 rootH2_10001273164 189
70 3300003322 rootL2_10290323 rootL2_102903232 189
71 3300003323 rootH1_10122919 rootH1_101229191 189
72 3300005327 Ga0070658_10000008 Ga0070658_1000000848 189
73 3300005328 Ga0070676_10015945 Ga0070676_100159454 189
74 3300005334 Ga0068869_100184796 Ga0068869_1001847961 189
75 3300005339 Ga0070660_100082220 Ga0070660_1000822205 189
76 3300005355 Ga0070671_100016950 Ga0070671_1000169505 189
77 3300005364 Ga0070673_100006158 Ga0070673_1000061582 189
78 3300005459 Ga0068867_100004709 Ga0068867_1000047093 189
79 3300005539 Ga0068853_100024320 Ga0068853_1000243206 189
80 3300005539 Ga0068853_100037508 Ga0068853_1000375082 189
81 3300005548 Ga0070665_100000118 Ga0070665_100000118138 189
82 3300005563 Ga0068855_100019618 Ga0068855_10001961811 189
83 3300005616 Ga0068852_100016148 Ga0068852_1000161486 189
84 3300006195 Ga0075366_10065981 Ga0075366_100659812 189
85 3300006237 Ga0097621_100000015 Ga0097621_10000001519 189
86 3300006358 Ga0068871_100000051 Ga0068871_1000000512 189
87 3300006881 Ga0068865_100000120 Ga0068865_1000001203 189
88 3300009093 Ga0105240_10036011 Ga0105240_100360114 189
89 3300009093 Ga0105240_10045368 Ga0105240_100453683 189
90 3300009093 Ga0105240_10153572 Ga0105240_101535723 189
91 3300009093 Ga0105240_11042649 Ga0105240_110426491 189
92 3300009093 Ga0105240_11694200 Ga0105240_116942001 189
93 3300009098 Ga0105245_10362676 Ga0105245_103626762 189
94 3300009174 Ga0105241_10007909 Ga0105241_100079095 189
95 3300009174 Ga0105241_10008119 Ga0105241_100081197 189
96 3300009174 Ga0105241_10127353 Ga0105241_101273532 189
97 3300009545 Ga0105237_10000813 Ga0105237_1000081318 189
98 3300009545 Ga0105237_10024437 Ga0105237_100244375 189
99 3300009545 Ga0105237_10073531 Ga0105237_100735312 189
100 3300009545 Ga0105237_10689634 Ga0105237_106896342 189
101 3300009551 Ga0105238_10208643 Ga0105238_102086432 189
102 3300010375 Ga0105239_10000327 Ga0105239_100003272 189
103 3300010375 Ga0105239_10004144 Ga0105239_1000414415 189
104 3300011119 Ga0105246_10243182 Ga0105246_102431822 189
105 3300011119 Ga0105246_10664017 Ga0105246_106640171 189
106 3300013100 Ga0157373_10053561 Ga0157373_100535612 189
107 3300013100 Ga0157373_10220539 Ga0157373_102205392 189
108 3300013102 Ga0157371_10102099 Ga0157371_101020992 189
109 3300013105 Ga0157369_10000047 Ga0157369_1000004744 189
110 3300013105 Ga0157369_10198867 Ga0157369_101988672 189
111 3300013296 Ga0157374_10000137 Ga0157374_1000013711 189
112 3300013296 Ga0157374_10000741 Ga0157374_1000074122 189
113 3300013297 Ga0157378_10023686 Ga0157378_100236863 189
114 3300013297 Ga0157378_10052948 Ga0157378_100529482 189
115 3300013306 Ga0163162_10000012 Ga0163162_10000012149 189
116 3300013306 Ga0163162_10064932 Ga0163162_100649322 189
117 3300013307 Ga0157372_10232059 Ga0157372_102320592 189
118 3300013308 Ga0157375_10015704 Ga0157375_100157048 189
119 3300013308 Ga0157375_10116568 Ga0157375_101165682 189
120 3300013308 Ga0157375_10451058 Ga0157375_104510582 189
121 3300014745 Ga0157377_10091154 Ga0157377_100911543 189
122 3300014969 Ga0157376_10525110 Ga0157376_105251102 189
123 3300021361 Ga0213872_10018002 Ga0213872_100180021 189
124 3300025233 Ga0209437_100130 Ga0209437_100130130 189
125 3300025272 Ga0209455_1000854 Ga0209455_100085410 189
126 3300025907 Ga0207645_10000058 Ga0207645_1000005844 189
127 3300025909 Ga0207705_10000026 Ga0207705_1000002648 189
128 3300025911 Ga0207654_10071425 Ga0207654_100714252 189
129 3300025911 Ga0207654_10075451 Ga0207654_100754512 189
130 3300025913 Ga0207695_10015443 Ga0207695_1001544311 189
131 3300025913 Ga0207695_10142225 Ga0207695_101422251 189
132 3300025913 Ga0207695_10788183 Ga0207695_107881832 189
133 3300025914 Ga0207671_10002136 Ga0207671_1000213624 189
134 3300025914 Ga0207671_10003198 Ga0207671_1000319811 189
135 3300025914 Ga0207671_10436667 Ga0207671_104366671 189
136 3300025919 Ga0207657_10152323 Ga0207657_101523233 189
137 3300025927 Ga0207687_10127453 Ga0207687_101274533 189
138 3300025931 Ga0207644_10006841 Ga0207644_100068417 189
139 3300025938 Ga0207704_10000353 Ga0207704_100003533 189
140 3300025942 Ga0207689_10179372 Ga0207689_101793722 189
141 3300025949 Ga0207667_10068214 Ga0207667_100682142 189
142 3300025960 Ga0207651_10003306 Ga0207651_100033062 189
143 3300026023 Ga0207677_10052634 Ga0207677_100526341 189
144 3300026089 Ga0207648_10000458 Ga0207648_1000045836 189
145 3300026142 Ga0207698_10076411 Ga0207698_100764113 189
146 3300028379 Ga0268266_10000121 Ga0268266_1000012119 189
147 3300028786 Ga0307517_10001388 Ga0307517_100013886 189
148 3300028794 Ga0307515_10215889 Ga0307515_102158892 189
149 3300031507 Ga0307509_10060583 Ga0307509_100605832 189
150 3300031903 Ga0307407_10000001 Ga0307407_10000001322 189
151 3300031911 Ga0307412_10382014 Ga0307412_103820142 189
152 3300031995 Ga0307409_100055346 Ga0307409_1000553462 189
153 3300032002 Ga0307416_100000008 Ga0307416_10000000867 189
154 3300032004 Ga0307414_10010567 Ga0307414_100105674 189
155 3300032004 Ga0307414_10783552 Ga0307414_107835522 189
156 3300033180 Ga0307510_10000419 Ga0307510_1000041925 189
157 3300035115 Ga0373941_0020124 Ga0373941_0020124_547_1170 189
158 3300037312 Ga0395899_0007040 Ga0395899_0007040_2598_3188 189
159 3300037418 Ga0395900_0001352 Ga0395900_0001352_2675_3265 189
160 3300037471 Ga0395905_0000246 Ga0395905_0000246_78052_78642 189
161 3300038443 Ga0395901_0000184 Ga0395901_0000184_77993_78583 189
162 3300039447 Ga0436361_0970870 Ga0436361_0970870_2648_3238 189
163 3300042005 Ga0439448_0032843 Ga0439448_0032843_36_626 189
164 3300042012 Ga0439455_0085479 Ga0439455_0085479_71_661 189
165 3300045049 Ga0466959_0083332 Ga0466959_0083332_184_852 189
166 3300046453 Ga0495627_115107 Ga0495627_115107_81_695 189
167 3300046460 Ga0495638_0152293 Ga0495638_0152293_153_725 189
168 3300046462 Ga0495651_0111723 Ga0495651_0111723_797_1429 189
169 3300046471 Ga0495650_0000050 Ga0495650_0000050_300573_301145 189
170 3300046492 Ga0495585_0000235 Ga0495585_0000235_9401_10015 189
171 3300046492 Ga0495585_0184466 Ga0495585_0184466_90_680 189
172 3300046507 Ga0495606_0000036 Ga0495606_0000036_48387_48959 189
173 3300046507 Ga0495606_0014319 Ga0495606_0014319_1089_1703 189
174 3300046512 Ga0495610_0005070 Ga0495610_0005070_3547_4119 189
175 3300046513 Ga0495616_0001383 Ga0495616_0001383_11018_11590 189
176 3300046518 Ga0495631_0016955 Ga0495631_0016955_1708_2298 189
177 3300046520 Ga0495637_0066212 Ga0495637_0066212_664_1281 189
178 3300046524 Ga0495648_0013965 Ga0495648_0013965_498_1112 189
179 3300046538 Ga0495609_0021112 Ga0495609_0021112_924_1496 189
180 3300046558 Ga0495633_0022998 Ga0495633_0022998_2434_3006 189
181 3300046616 Ga0495668_0000058 Ga0495668_0000058_110196_110810 189
182 3300046660 Ga0495625_0000105 Ga0495625_0000105_64808_65380 189
183 3300046660 Ga0495625_0000641 Ga0495625_0000641_2827_3399 189
184 3300046660 Ga0495625_0001733 Ga0495625_0001733_23057_23671 189
185 3300046665 Ga0495661_0069661 Ga0495661_0069661_1429_2001 189
186 3300046684 Ga0495669_0052545 Ga0495669_0052545_138_728 189
187 3300046692 Ga0495671_0018260 Ga0495671_0018260_2246_2818 189
188 3300046694 Ga0495649_0000011 Ga0495649_0000011_59561_60133 189
189 3300046694 Ga0495649_0068501 Ga0495649_0068501_1123_1713 189
190 3300046810 Ga0495660_0292029 Ga0495660_0292029_32_646 189
191 3300047323 Ga0495683_0035400 Ga0495683_0035400_33_605 189
192 3300047443 Ga0495687_005259 Ga0495687_005259_741_1331 189
193 3300047443 Ga0495687_023232 Ga0495687_023232_2013_2588 189
194 3300047469 Ga0495673_0010850 Ga0495673_0010850_4144_4716 189
195 3300047472 Ga0495686_0020165 Ga0495686_0020165_1253_1885 189
196 3300048089 Ga0495614_0056541 Ga0495614_0056541_193_807 189
197 3300050493 nmdc:mga0k408_3876_c1 nmdc:mga0k408_3876_c1_1319_1891 189
198 3300050493 nmdc:mga0k408_429_c1 nmdc:mga0k408_429_c1_19759_20331 189
199 3300053080 Ga0500635_0012440 Ga0500635_0012440_1189_1776 189
200 3300053122 Ga0500608_000417 Ga0500608_000417_3630_4220 189
201 3300053122 Ga0500608_162140 Ga0500608_162140_295_906 189
202 3300053125 Ga0500618_084043 Ga0500618_084043_48_620 189
203 3300053156 Ga0500622_0021684 Ga0500622_0021684_743_1315 189
204 3300053157 Ga0500624_001227 Ga0500624_001227_1117_1689 189
205 iso_pu_bacteria 2919437846 2919439566 189
206 3300001904 JGI24736J21556_1006200 JGI24736J21556_10062002 190
207 3300001915 JGI24741J21665_1010754 JGI24741J21665_10107541 190
208 3300001979 JGI24740J21852_10025058 JGI24740J21852_100250582 190
209 3300001979 JGI24740J21852_10031857 JGI24740J21852_100318571 190
210 3300001989 JGI24739J22299_10013000 JGI24739J22299_100130002 190
211 3300001990 JGI24737J22298_10001771 JGI24737J22298_100017713 190
212 3300002737 JGI25162J39368_1001849 JGI25162J39368_10018492 190
213 3300002773 JGI25152J39213_1000016 JGI25152J39213_10000169 190
214 3300002774 JGI25150J39212_1000003 JGI25150J39212_1000003386 190
215 3300002774 JGI25150J39212_1000004 JGI25150J39212_1000004238 190
216 3300003187 JGI25151J46595_10000002 JGI25151J46595_10000002386 190
217 3300003214 JGI25165J46597_1000305 JGI25165J46597_10003057 190
218 3300003215 JGI25153J46596_10000015 JGI25153J46596_10000015197 190
219 3300003316 rootH1_10016176 rootH1_1001617614 190
220 3300003320 rootH2_10173626 rootH2_101736262 190
221 3300003320 rootH2_10236101 rootH2_102361011 190
222 3300003322 rootL2_10166471 rootL2_101664712 190
223 3300003323 rootH1_10005288 rootH1_1000528819 190
224 3300003323 rootH1_10015911 rootH1_100159114 190
225 3300003323 rootH1_10109363 rootH1_101093632 190
226 3300003781 Ga0055536_1000006 Ga0055536_1000006220 190
227 3300003791 Ga0055530_10004623 Ga0055530_100046233 190
228 3300004799 Ga0058863_11839005 Ga0058863_1183900511 190
229 3300004803 Ga0058862_12232769 Ga0058862_122327692 190
230 3300005288 Ga0065714_10002214 Ga0065714_1000221415 190
231 3300005288 Ga0065714_10004278 Ga0065714_100042782 190
232 3300005288 Ga0065714_10004780 Ga0065714_1000478012 190
233 3300005288 Ga0065714_10075856 Ga0065714_100758562 190
234 3300005288 Ga0065714_10080698 Ga0065714_100806983 190
235 3300005288 Ga0065714_10209708 Ga0065714_102097081 190
236 3300005289 Ga0065704_10000206 Ga0065704_1000020651 190
237 3300005289 Ga0065704_10073053 Ga0065704_100730537 190
238 3300005327 Ga0070658_10040982 Ga0070658_100409823 190
239 3300005327 Ga0070658_10095360 Ga0070658_100953601 190
240 3300005336 Ga0070680_100003016 Ga0070680_1000030164 190
241 3300005339 Ga0070660_100026304 Ga0070660_1000263044 190
242 3300005366 Ga0070659_100003407 Ga0070659_1000034078 190
243 3300005366 Ga0070659_100034316 Ga0070659_1000343164 190
244 3300005455 Ga0070663_100000447 Ga0070663_10000044714 190
245 3300005458 Ga0070681_10344374 Ga0070681_103443742 190
246 3300005530 Ga0070679_100007681 Ga0070679_1000076819 190
247 3300005563 Ga0068855_100001431 Ga0068855_10000143112 190
248 3300005563 Ga0068855_100004525 Ga0068855_1000045258 190
249 3300005563 Ga0068855_100032516 Ga0068855_1000325163 190
250 3300005563 Ga0068855_100101116 Ga0068855_1001011162 190
251 3300005577 Ga0068857_100114976 Ga0068857_1001149762 190
252 3300005578 Ga0068854_100681665 Ga0068854_1006816652 190
253 3300005614 Ga0068856_100000108 Ga0068856_10000010833 190
254 3300005614 Ga0068856_100008974 Ga0068856_10000897412 190
255 3300005614 Ga0068856_100051537 Ga0068856_1000515373 190
256 3300009036 Ga0105244_10017654 Ga0105244_100176543 190
257 3300009093 Ga0105240_10000158 Ga0105240_1000015885 190
258 3300009093 Ga0105240_10665634 Ga0105240_106656341 190
259 3300009174 Ga0105241_10117108 Ga0105241_101171082 190
260 3300009174 Ga0105241_10701193 Ga0105241_107011931 190
261 3300009545 Ga0105237_10004869 Ga0105237_100048694 190
262 3300009551 Ga0105238_10021356 Ga0105238_100213566 190
263 3300010375 Ga0105239_10000008 Ga0105239_10000008336 190
264 3300010375 Ga0105239_10000428 Ga0105239_100004284 190
265 3300013100 Ga0157373_10008157 Ga0157373_100081575 190
266 3300013102 Ga0157371_10000912 Ga0157371_1000091223 190
267 3300013102 Ga0157371_10001432 Ga0157371_1000143220 190
268 3300013102 Ga0157371_10008927 Ga0157371_100089275 190
269 3300013102 Ga0157371_10029645 Ga0157371_100296453 190
270 3300013104 Ga0157370_10001102 Ga0157370_1000110219 190
271 3300013104 Ga0157370_10004615 Ga0157370_100046158 190
272 3300013104 Ga0157370_10033672 Ga0157370_100336722 190
273 3300013104 Ga0157370_10036289 Ga0157370_100362894 190
274 3300013104 Ga0157370_10072938 Ga0157370_100729382 190
275 3300013104 Ga0157370_10479939 Ga0157370_104799392 190
276 3300013105 Ga0157369_10000101 Ga0157369_1000010156 190
277 3300013105 Ga0157369_10021821 Ga0157369_100218218 190
278 3300013105 Ga0157369_10064434 Ga0157369_100644342 190
279 3300013306 Ga0163162_10000557 Ga0163162_1000055722 190
280 3300013307 Ga0157372_10000041 Ga0157372_1000004153 190
281 3300013307 Ga0157372_10000199 Ga0157372_1000019946 190
282 3300013308 Ga0157375_10746024 Ga0157375_107460242 190
283 3300013308 Ga0157375_11968520 Ga0157375_119685201 190
284 3300014497 Ga0182008_10000315 Ga0182008_100003158 190
285 3300014497 Ga0182008_10000894 Ga0182008_1000089413 190
286 3300014497 Ga0182008_10026907 Ga0182008_100269072 190
287 3300014497 Ga0182008_10028891 Ga0182008_100288911 190
288 3300014497 Ga0182008_10033318 Ga0182008_100333183 190
289 3300015261 Ga0182006_1000153 Ga0182006_100015348 190
290 3300015261 Ga0182006_1000287 Ga0182006_10002873 190
291 3300015261 Ga0182006_1000947 Ga0182006_100094718 190
292 3300015261 Ga0182006_1007627 Ga0182006_10076273 190
293 3300015262 Ga0182007_10000005 Ga0182007_10000005131 190
294 3300015262 Ga0182007_10005366 Ga0182007_100053666 190
295 3300015262 Ga0182007_10013562 Ga0182007_100135622 190
296 3300015262 Ga0182007_10067380 Ga0182007_100673801 190
297 3300015682 Ga0183373_1002 Ga0183373_1002718 190
298 3300017792 Ga0163161_10000306 Ga0163161_1000030616 190
299 3300017792 Ga0163161_10000360 Ga0163161_1000036035 190
300 3300017792 Ga0163161_10002950 Ga0163161_1000295010 190
301 3300017792 Ga0163161_10020833 Ga0163161_100208334 190
302 3300017792 Ga0163161_10232431 Ga0163161_102324312 190
303 3300020077 Ga0206351_10418890 Ga0206351_104188902 190
304 3300025230 Ga0209563_111208 Ga0209563_1112082 190
305 3300025231 Ga0207427_100423 Ga0207427_10042319 190
306 3300025233 Ga0209437_100026 Ga0209437_100026369 190
307 3300025233 Ga0209437_100026 Ga0209437_10002659 190
308 3300025245 Ga0207425_1000003 Ga0207425_1000003459 190
309 3300025250 Ga0209026_1000304 Ga0209026_10003042 190
310 3300025250 Ga0209026_1004800 Ga0209026_10048004 190
311 3300025258 Ga0209129_1000014 Ga0209129_1000014374 190
312 3300025261 Ga0209233_1000206 Ga0209233_100020640 190
313 3300025261 Ga0209233_1000466 Ga0209233_100046622 190
314 3300025292 Ga0209676_1000039 Ga0209676_1000039312 190
315 3300025294 Ga0209025_1000007 Ga0209025_1000007458 190
316 3300025297 Ga0209758_1000012 Ga0209758_1000012459 190
317 3300025298 Ga0209050_1000033 Ga0209050_1000033136 190
318 3300025904 Ga0207647_10000103 Ga0207647_1000010314 190
319 3300025909 Ga0207705_10023176 Ga0207705_100231767 190
320 3300025911 Ga0207654_10008233 Ga0207654_100082334 190
321 3300025911 Ga0207654_10080178 Ga0207654_100801782 190
322 3300025911 Ga0207654_10355488 Ga0207654_103554881 190
323 3300025912 Ga0207707_10215707 Ga0207707_102157072 190
324 3300025913 Ga0207695_10000235 Ga0207695_1000023585 190
325 3300025913 Ga0207695_10099600 Ga0207695_100996002 190
326 3300025913 Ga0207695_10113439 Ga0207695_101134395 190
327 3300025914 Ga0207671_10007251 Ga0207671_100072514 190
328 3300025914 Ga0207671_10008464 Ga0207671_100084649 190
329 3300025917 Ga0207660_10011225 Ga0207660_100112253 190
330 3300025921 Ga0207652_10025777 Ga0207652_100257775 190
331 3300025921 Ga0207652_10235863 Ga0207652_102358632 190
332 3300025924 Ga0207694_10020393 Ga0207694_100203934 190
333 3300025932 Ga0207690_10013035 Ga0207690_100130354 190
334 3300025932 Ga0207690_10032027 Ga0207690_100320273 190
335 3300025949 Ga0207667_10000457 Ga0207667_1000045747 190
336 3300025949 Ga0207667_10001338 Ga0207667_1000133812 190
337 3300025949 Ga0207667_10342790 Ga0207667_103427902 190
338 3300025981 Ga0207640_10670570 Ga0207640_106705702 190
339 3300026078 Ga0207702_10000183 Ga0207702_1000018326 190
340 3300026078 Ga0207702_10111849 Ga0207702_101118492 190
341 3300026078 Ga0207702_10298203 Ga0207702_102982032 190
342 3300026116 Ga0207674_10549637 Ga0207674_105496372 190
343 3300026116 Ga0207674_10598934 Ga0207674_105989342 190
344 3300028794 Ga0307515_10000077 Ga0307515_1000007758 190
345 3300028794 Ga0307515_10007186 Ga0307515_1000718611 190
346 3300028794 Ga0307515_10064389 Ga0307515_100643892 190
347 3300028800 Ga0265338_10180333 Ga0265338_101803332 190
348 3300031731 Ga0307405_10000009 Ga0307405_10000009145 190
349 3300031911 Ga0307412_10000001 Ga0307412_10000001379 190
350 3300032004 Ga0307414_10011567 Ga0307414_100115677 190
351 3300032004 Ga0307414_10023027 Ga0307414_100230274 190
352 3300032004 Ga0307414_10034571 Ga0307414_100345712 190
353 3300032004 Ga0307414_10044506 Ga0307414_100445062 190
354 3300037312 Ga0395899_0000017 Ga0395899_0000017_227627_228202 190
355 3300037312 Ga0395899_0000024 Ga0395899_0000024_185218_185838 190
356 3300037418 Ga0395900_0148954 Ga0395900_0148954_234_854 190
357 3300037471 Ga0395905_0742247 Ga0395905_0742247_16_639 190
358 3300042876 Ga0451577_0024730 Ga0451577_0024730_2638_3210 190
359 3300044656 Ga0466969_0018082 Ga0466969_0018082_2585_3190 190
360 3300044684 Ga0466966_0021578 Ga0466966_0021578_1729_2334 190
361 3300044684 Ga0466966_0504351 Ga0466966_0504351_94_669 190
362 3300044693 Ga0466961_0008211 Ga0466961_0008211_2762_3367 190
363 3300044712 Ga0453684_0000212 Ga0453684_0000212_248589_249161 190
364 3300045049 Ga0466959_0035944 Ga0466959_0035944_988_1593 190
365 3300045836 Ga0466958_0047669 Ga0466958_0047669_975_1580 190
366 3300046453 Ga0495627_042679 Ga0495627_042679_632_1222 190
367 3300046507 Ga0495606_0013057 Ga0495606_0013057_3642_4262 190
368 3300046507 Ga0495606_0024849 Ga0495606_0024849_1757_2347 190
369 3300046512 Ga0495610_0002059 Ga0495610_0002059_11656_12243 190
370 3300046512 Ga0495610_0003036 Ga0495610_0003036_1618_2202 190
371 3300046523 Ga0495644_0006793 Ga0495644_0006793_2156_2782 190
372 3300046525 Ga0495663_0020111 Ga0495663_0020111_148_738 190
373 3300046538 Ga0495609_0025381 Ga0495609_0025381_1975_2592 190
374 3300046558 Ga0495633_0006385 Ga0495633_0006385_5817_6407 190
375 3300046616 Ga0495668_0148865 Ga0495668_0148865_219_845 190
376 3300046660 Ga0495625_0051990 Ga0495625_0051990_1658_2296 190
377 3300046810 Ga0495660_0001859 Ga0495660_0001859_11418_12038 190
378 3300047443 Ga0495687_001623 Ga0495687_001623_2502_3122 190
379 3300047472 Ga0495686_0001597 Ga0495686_0001597_16839_17417 190
380 3300048918 Ga0496115_0456454 Ga0496115_0456454_190_795 190
381 3300048925 Ga0496122_0000817 Ga0496122_0000817_7977_8549 190
382 3300048926 Ga0496123_0005275 Ga0496123_0005275_12244_12816 190
383 3300048928 Ga0496125_0071642 Ga0496125_0071642_2102_2674 190
384 3300049679 Ga0501249_048089 Ga0501249_048089_11_601 190
385 3300049776 Ga0501280_021524 Ga0501280_021524_365_940 190
386 3300050493 nmdc:mga0k408_100626_c1 nmdc:mga0k408_100626_c1_46_675 190
387 3300053156 Ga0500622_0000173 Ga0500622_0000173_23017_23655 190
388 iso_pu_bacteria 2738543023 2739304325 190
389 iso_pu_bacteria 2919186247 2919188539 190
390 iso_pu_bacteria 2939664404 2939667306 190
391 iso_pu_bacteria 2977232053 2977234885 190
392 iso_pu_bacteria 8055588893 8055591354 190
393 3300001904 JGI24736J21556_1001996 JGI24736J21556_10019962 191
394 3300001989 JGI24739J22299_10012865 JGI24739J22299_100128653 191
395 3300001990 JGI24737J22298_10006255 JGI24737J22298_100062554 191
396 3300002067 JGI24735J21928_10000007 JGI24735J21928_1000000711 191
397 3300005338 Ga0068868_100138788 Ga0068868_1001387882 191
398 3300005339 Ga0070660_100025877 Ga0070660_1000258772 191
399 3300005456 Ga0070678_100384968 Ga0070678_1003849682 191
400 3300005457 Ga0070662_100000468 Ga0070662_10000046819 191
401 3300010375 Ga0105239_10080410 Ga0105239_100804104 191
402 3300010375 Ga0105239_10097944 Ga0105239_100979442 191
403 3300013105 Ga0157369_10158513 Ga0157369_101585132 191
404 3300013307 Ga0157372_10033897 Ga0157372_100338972 191
405 3300025904 Ga0207647_10000049 Ga0207647_1000004973 191
406 3300025911 Ga0207654_10004708 Ga0207654_100047083 191
407 3300025919 Ga0207657_10025398 Ga0207657_100253982 191
408 3300025919 Ga0207657_10108142 Ga0207657_101081422 191
409 3300025933 Ga0207706_10000111 Ga0207706_1000011172 191
410 3300026023 Ga0207677_10093317 Ga0207677_100933172 191
411 3300026041 Ga0207639_10164453 Ga0207639_101644532 191
412 iso_pu_bacteria 2852627209 2852628182 191
413 iso_pu_bacteria 2902048731 2902049643 192
414 iso_pu_bacteria 2739367651 2739586981 193
415 3300005288 Ga0065714_10031206 Ga0065714_100312061 194
416 3300005288 Ga0065714_10079969 Ga0065714_100799692 194
417 3300005288 Ga0065714_10122825 Ga0065714_101228252 194
418 3300013104 Ga0157370_10088280 Ga0157370_100882803 194
419 3300017792 Ga0163161_10089253 Ga0163161_100892532 194
420 3300031548 Ga0307408_100001497 Ga0307408_1000014977 194
421 3300046524 Ga0495648_0076116 Ga0495648_0076116_118_825 194
422 3300009093 Ga0105240_10590105 Ga0105240_105901052 195
423 3300013100 Ga0157373_10000152 Ga0157373_1000015212 195
424 3300013307 Ga0157372_10004737 Ga0157372_1000473715 195
425 3300026041 Ga0207639_10379902 Ga0207639_103799022 195
426 2162886007 SwRhRL2b_contig_3644333 SwRhRL2b_0516.00000060 196
427 3300003323 rootH1_10151469 rootH1_101514692 196
428 3300013102 Ga0157371_10000117 Ga0157371_100001172 196
429 3300013102 Ga0157371_10000888 Ga0157371_100008882 196
430 3300013102 Ga0157371_10004676 Ga0157371_1000467611 196
431 3300013104 Ga0157370_10115681 Ga0157370_101156813 196
432 3300013104 Ga0157370_10435419 Ga0157370_104354192 196
433 3300014497 Ga0182008_10000020 Ga0182008_1000002022 196
434 3300015261 Ga0182006_1001658 Ga0182006_10016582 196
435 3300032004 Ga0307414_10002136 Ga0307414_100021363 196
436 3300032004 Ga0307414_10122029 Ga0307414_101220293 196
437 3300032004 Ga0307414_10277639 Ga0307414_102776392 196
438 3300049758 Ga0501241_020198 Ga0501241_020198_61_651 196
439 3300053093 Ga0500651_0000130 Ga0500651_0000130_30133_30723 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

51

235

0.95

PF07722

Peptidase_C26

Peptidase C26

103

219

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.9485 8 194
8hx7-assembly1.cif.gz_A crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine 0.9323 10 193
8hx7-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine 0.9304 10 195
8hx6-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae 0.9287 8 195
8hx6-assembly1.cif.gz_A crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae 0.9284 8 195
ID Description Score Start End Superfamily
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9706 11 196 3.40.50.880
af_K7L2D7_74_267_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9655 10 196 3.40.50.880
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9604 11 196 3.40.50.880
af_Q2FYR8_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9593 11 195 3.40.50.880
af_Q2G099_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9538 11 195 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A258KFR6-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9967 25 194 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-A0A2H9VPM8-F1-model_v4 Anthranilate synthase component 2 0.9957 10 194 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-A0A4R0N2I9-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9955 9 193 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-A0A348V775-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.993 62 196 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-R7D318-F1-model_v4 Glutamine amidotransferase of anthranilate synthase 0.9924 9 196 GO:0000162
GO:0004049
GO:0005829
GO:0006541
GO:0016740

Feature Viewer

pLDDT pTM Quality
93.84 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map