F444258

General Info

Members Datasets Scaffolds Average Seq Length
439 253 436 132

Family's Representative Sequence

Representative Sequence 3300042016|Ga0439463_099352|Ga0439463_099352_122_580
Length 152
Sequence MPTEPRIWYLKLDTAKEHAMSDESEIRALIERWADAVHAGDMGGVLADHADDIVMFDVPPPDDGVRGIEAYRATWPPFFEWQRQGATFEIVSLEVTAGADVAFAHALLRCGTDEELRKDPDNRLRLTIGLRREGGRWVVSHEHHSFPDKSQS

Samples

Sample ID Description Type Environment
1 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
2 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
3 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
155 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
160 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
161 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
175 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
176 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
177 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
178 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
179 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
186 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
187 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
188 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
189 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
190 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
191 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
192 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
193 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
194 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
195 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
196 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
197 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
198 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
199 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
200 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
201 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
206 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
233 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
234 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
235 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
236 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
237 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
247 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
248 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
249 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
250 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
251 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0
Isolates 0.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.64
Nodule 0
Rhizoplane 6.15
Rhizosphere 86.56
Stem 0
Stem Tuber 0
Unclassified 3.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10112659 3300001990 Bacteria 804
2 JGI24743J22301_10001115 3300001991 Bacteria 3595
3 JGI24744J21845_10006744 3300002077 Bacteria 2376
4 JGI24744J21845_10013870 3300002077 Bacteria 1624
5 JGI24034J26672_10039511 3300002239 Bacteria 789
6 JGI24742J22300_10009813 3300002244 Bacteria 1582
7 JGI25407J50210_10000720 3300003373 Bacteria 6925
8 JGI25407J50210_10004238 3300003373 Bacteria 3488
9 JGI25407J50210_10009075 3300003373 Bacteria 2514
10 JGI25407J50210_10070226 3300003373 Bacteria 874
11 JGI25405J52794_10027329 3300003911 Bacteria 1175
12 Ga0070676_10061245 3300005328 Bacteria 2237
13 Ga0070690_100044212 3300005330 Bacteria 2826
14 Ga0068869_100217337 3300005334 Bacteria 1513
15 Ga0070666_10174932 3300005335 Bacteria 1505
16 Ga0070666_10290447 3300005335 Bacteria 1163
17 Ga0070680_100917521 3300005336 Bacteria 756
18 Ga0070682_100223232 3300005337 Bacteria 1342
19 Ga0068868_100036734 3300005338 Bacteria 3794
20 Ga0068868_100597967 3300005338 Bacteria 977
21 Ga0070660_100679475 3300005339 Bacteria 863
22 Ga0070689_100079297 3300005340 Bacteria 2575
23 Ga0070691_10237465 3300005341 Bacteria 972
24 Ga0070692_10122471 3300005345 Bacteria 1452
25 Ga0070692_10470039 3300005345 Bacteria 809
26 Ga0070668_100008673 3300005347 Bacteria 7549
27 Ga0070668_100047712 3300005347 Bacteria 3293
28 Ga0070669_100070317 3300005353 Bacteria 2587
29 Ga0070669_100222883 3300005353 Bacteria 1491
30 Ga0070675_100387946 3300005354 Bacteria 1244
31 Ga0070675_100451301 3300005354 Bacteria 1153
32 Ga0070671_100226471 3300005355 Bacteria 1586
33 Ga0070674_100006602 3300005356 Bacteria 6782
34 Ga0070674_100062059 3300005356 Bacteria 2610
35 Ga0070674_100452738 3300005356 Bacteria 1060
36 Ga0070674_101529275 3300005356 Bacteria 600
37 Ga0070673_100360802 3300005364 Bacteria 1291
38 Ga0070688_100082648 3300005365 Bacteria 2082
39 Ga0070667_100270195 3300005367 Bacteria 1524
40 Ga0070714_100819230 3300005435 Bacteria 902
41 Ga0070710_10001850 3300005437 Bacteria 9970
42 Ga0070710_10010111 3300005437 Bacteria 4629
43 Ga0070701_10142827 3300005438 Bacteria 1371
44 Ga0070711_100033844 3300005439 Bacteria 3404
45 Ga0070705_100057520 3300005440 Bacteria 2294
46 Ga0070705_100417353 3300005440 Bacteria 998
47 Ga0070700_100039737 3300005441 Bacteria 2876
48 Ga0070700_100045587 3300005441 Bacteria 2705
49 Ga0070694_100055110 3300005444 Bacteria 2696
50 Ga0070694_100116323 3300005444 Bacteria 1912
51 Ga0070708_100497539 3300005445 Bacteria 1150
52 Ga0070663_100007014 3300005455 Bacteria 6826
53 Ga0070678_100000467 3300005456 Bacteria 19301
54 Ga0070678_100112488 3300005456 Bacteria 2132
55 Ga0070678_101565283 3300005456 Bacteria 618
56 Ga0070662_100018969 3300005457 Bacteria 4661
57 Ga0070662_101659508 3300005457 Bacteria 552
58 Ga0068867_100004148 3300005459 Bacteria 10184
59 Ga0068867_100165643 3300005459 Bacteria 1746
60 Ga0070685_10069034 3300005466 Bacteria 2089
61 Ga0070685_10268378 3300005466 Bacteria 1138
62 Ga0070679_100212640 3300005530 Bacteria 1897
63 Ga0068853_100051695 3300005539 Bacteria 3538
64 Ga0068853_100123628 3300005539 Bacteria 2310
65 Ga0070672_100595526 3300005543 Bacteria 962
66 Ga0070695_100102060 3300005545 Bacteria 1933
67 Ga0070696_100142929 3300005546 Bacteria 1750
68 Ga0070665_100219226 3300005548 Bacteria 1903
69 Ga0070665_100495677 3300005548 Bacteria 1233
70 Ga0070665_101564365 3300005548 Bacteria 667
71 Ga0070704_100000602 3300005549 Bacteria 17305
72 Ga0070704_100010411 3300005549 Bacteria 5656
73 Ga0068854_100000791 3300005578 Bacteria 18804
74 Ga0068854_100359197 3300005578 Bacteria 1195
75 Ga0068856_100754813 3300005614 Bacteria 993
76 Ga0070702_100056123 3300005615 Bacteria 2273
77 Ga0070702_100058819 3300005615 Bacteria 2228
78 Ga0068852_100003821 3300005616 Bacteria 10578
79 Ga0068859_100041464 3300005617 Bacteria 4623
80 Ga0068859_100124199 3300005617 Bacteria 2649
81 Ga0068864_100607185 3300005618 Bacteria 1062
82 Ga0068861_100049521 3300005719 Bacteria 3181
83 Ga0068863_100784092 3300005841 Bacteria 950
84 Ga0068858_100007165 3300005842 Bacteria 10817
85 Ga0068860_100007042 3300005843 Bacteria 11257
86 Ga0068860_100021868 3300005843 Bacteria 6189
87 Ga0068862_100014349 3300005844 Bacteria 6572
88 Ga0081455_10006480 3300005937 Bacteria 12549
89 Ga0081538_10000734 3300005981 Bacteria 35846
90 Ga0081538_10000938 3300005981 Bacteria 31462
91 Ga0081538_10001146 3300005981 Bacteria 28009
92 Ga0081538_10001613 3300005981 Bacteria 23127
93 Ga0081538_10005254 3300005981 Bacteria 11695
94 Ga0081538_10009073 3300005981 Bacteria 8343
95 Ga0081538_10011131 3300005981 Bacteria 7312
96 Ga0081538_10022056 3300005981 Bacteria 4625
97 Ga0081538_10046068 3300005981 Bacteria 2695
98 Ga0081539_10021668 3300005985 Bacteria 4282
99 Ga0075365_10128868 3300006038 Bacteria 1750
100 Ga0075368_10322435 3300006042 Unclassified 669
101 Ga0075363_100464319 3300006048 Bacteria 749
102 Ga0075364_10413925 3300006051 Bacteria 920
103 Ga0070715_10110957 3300006163 Bacteria 1293
104 Ga0070716_100008590 3300006173 Bacteria 5074
105 Ga0070712_100069845 3300006175 Bacteria 2507
106 Ga0075367_10179014 3300006178 Bacteria 1322
107 Ga0075366_10306564 3300006195 Bacteria 972
108 Ga0097621_100052835 3300006237 Bacteria 3311
109 Ga0097621_100063534 3300006237 Bacteria 3035
110 Ga0068871_100016121 3300006358 Bacteria 5615
111 Ga0075428_100005551 3300006844 Bacteria 14031
112 Ga0075428_100047208 3300006844 Bacteria 4731
113 Ga0075428_100097359 3300006844 Bacteria 3208
114 Ga0075428_100143967 3300006844 Bacteria 2591
115 Ga0075428_100342812 3300006844 Bacteria 1604
116 Ga0075428_100527455 3300006844 Bacteria 1263
117 Ga0075428_101322677 3300006844 Bacteria 758
118 Ga0075430_100005024 3300006846 Bacteria 11136
119 Ga0075430_100010232 3300006846 Bacteria 7940
120 Ga0075430_100014922 3300006846 Bacteria 6615
121 Ga0075430_100647925 3300006846 Bacteria 871
122 Ga0075431_100042397 3300006847 Bacteria 4693
123 Ga0075431_100080398 3300006847 Bacteria 3365
124 Ga0075431_100257746 3300006847 Bacteria 1771
125 Ga0075431_100309824 3300006847 Bacteria 1594
126 Ga0075431_101843422 3300006847 Bacteria 561
127 Ga0075433_10558343 3300006852 Bacteria 1006
128 Ga0075429_100023765 3300006880 Bacteria 5318
129 Ga0075429_100097135 3300006880 Bacteria 2570
130 Ga0075429_100107235 3300006880 Bacteria 2441
131 Ga0075429_100944503 3300006880 Unclassified 754
132 Ga0068865_100103169 3300006881 Bacteria 2091
133 Ga0068865_100523317 3300006881 Bacteria 992
134 Ga0097620_100041464 3300006931 Bacteria 4623
135 Ga0097620_100124193 3300006931 Bacteria 2649
136 Ga0075435_100018857 3300007076 Bacteria 5257
137 Ga0105251_10356789 3300009011 Bacteria 668
138 Ga0111539_10187033 3300009094 Bacteria 2418
139 Ga0111539_10455001 3300009094 Bacteria 1491
140 Ga0111539_10529674 3300009094 Bacteria 1373
141 Ga0105245_10004967 3300009098 Bacteria 11694
142 Ga0105245_10097547 3300009098 Bacteria 2714
143 Ga0105245_10522032 3300009098 Bacteria 1206
144 Ga0105245_10933566 3300009098 Bacteria 910
145 Ga0105247_10025789 3300009101 Bacteria 3548
146 Ga0114129_10041710 3300009147 Bacteria 6463
147 Ga0114129_10205482 3300009147 Bacteria 2665
148 Ga0114129_10333986 3300009147 Bacteria 2012
149 Ga0114129_10374484 3300009147 Bacteria 1881
150 Ga0114129_10811474 3300009147 Bacteria 1193
151 Ga0114129_12164942 3300009147 Unclassified 670
152 Ga0105243_10008681 3300009148 Bacteria 7790
153 Ga0105243_10085439 3300009148 Bacteria 2586
154 Ga0105243_10110904 3300009148 Bacteria 2295
155 Ga0105243_10337172 3300009148 Bacteria 1380
156 Ga0105242_10005121 3300009176 Bacteria 10110
157 Ga0105242_10153123 3300009176 Bacteria 2012
158 Ga0105248_10147711 3300009177 Bacteria 2652
159 Ga0105248_10718266 3300009177 Bacteria 1127
160 Ga0105238_10360668 3300009551 Bacteria 1443
161 Ga0105249_10077184 3300009553 Bacteria 3089
162 Ga0105249_10134005 3300009553 Bacteria 2368
163 Ga0105249_11274787 3300009553 Bacteria 806
164 Ga0105249_11560162 3300009553 Bacteria 733
165 Ga0105239_10022933 3300010375 Bacteria 6882
166 Ga0105239_10084185 3300010375 Bacteria 3503
167 Ga0105246_10055624 3300011119 Bacteria 2732
168 Ga0105246_10170648 3300011119 Bacteria 1666
169 Ga0157373_11252243 3300013100 Bacteria 560
170 Ga0157369_10277204 3300013105 Bacteria 1746
171 Ga0157374_10023187 3300013296 Bacteria 5546
172 Ga0157378_10004671 3300013297 Bacteria 12016
173 Ga0163162_10104180 3300013306 Bacteria 2931
174 Ga0163162_10968782 3300013306 Bacteria 961
175 Ga0163162_11205680 3300013306 Bacteria 859
176 Ga0157372_10008000 3300013307 Bacteria 11247
177 Ga0157372_10396861 3300013307 Bacteria 1607
178 Ga0157375_10002631 3300013308 Bacteria 15547
179 Ga0157375_10258831 3300013308 Bacteria 1902
180 Ga0157380_10026827 3300014326 Bacteria 4376
181 Ga0157380_10132784 3300014326 Bacteria 2127
182 Ga0157377_10005782 3300014745 Bacteria 5839
183 Ga0157379_10081649 3300014968 Bacteria 2896
184 Ga0157379_11262922 3300014968 Bacteria 712
185 Ga0157376_10155131 3300014969 Bacteria 2069
186 Ga0163161_10000957 3300017792 Bacteria 22171
187 Ga0163161_10072226 3300017792 Bacteria 2526
188 Ga0207656_10051679 3300025321 Bacteria 1778
189 Ga0207642_10037207 3300025899 Bacteria 2095
190 Ga0207642_10124720 3300025899 Bacteria 1334
191 Ga0207688_10000638 3300025901 Bacteria 17256
192 Ga0207688_10002191 3300025901 Bacteria 10522
193 Ga0207688_10283976 3300025901 Bacteria 1009
194 Ga0207680_10169510 3300025903 Bacteria 1469
195 Ga0207647_10017746 3300025904 Bacteria 4831
196 Ga0207685_10057516 3300025905 Bacteria 1526
197 Ga0207699_10092573 3300025906 Bacteria 1900
198 Ga0207645_10016691 3300025907 Bacteria 4856
199 Ga0207645_10186381 3300025907 Bacteria 1362
200 Ga0207643_10148299 3300025908 Bacteria 1405
201 Ga0207671_10157368 3300025914 Bacteria 1758
202 Ga0207693_10000776 3300025915 Bacteria 28688
203 Ga0207693_10003141 3300025915 Bacteria 14203
204 Ga0207663_10047571 3300025916 Bacteria 2649
205 Ga0207657_10172761 3300025919 Bacteria 1750
206 Ga0207681_10028655 3300025923 Bacteria 3609
207 Ga0207681_10454626 3300025923 Bacteria 1042
208 Ga0207694_10615035 3300025924 Bacteria 914
209 Ga0207659_10088101 3300025926 Bacteria 2312
210 Ga0207687_10072514 3300025927 Bacteria 2464
211 Ga0207644_11004161 3300025931 Bacteria 700
212 Ga0207690_10053557 3300025932 Bacteria 2708
213 Ga0207706_10004169 3300025933 Bacteria 13611
214 Ga0207706_10006010 3300025933 Bacteria 11290
215 Ga0207709_10025857 3300025935 Bacteria 3365
216 Ga0207709_10033423 3300025935 Bacteria 3020
217 Ga0207669_10536127 3300025937 Bacteria 942
218 Ga0207669_11553622 3300025937 Bacteria 565
219 Ga0207704_10056547 3300025938 Bacteria 2404
220 Ga0207704_10131069 3300025938 Bacteria 1736
221 Ga0207665_10011883 3300025939 Bacteria 5717
222 Ga0207691_10168263 3300025940 Bacteria 1920
223 Ga0207711_10227588 3300025941 Bacteria 1707
224 Ga0207711_11504496 3300025941 Bacteria 616
225 Ga0207689_10154459 3300025942 Unclassified 1892
226 Ga0207667_10274139 3300025949 Bacteria 1724
227 Ga0207667_11752929 3300025949 Bacteria 586
228 Ga0207712_10004248 3300025961 Bacteria 9038
229 Ga0207712_10049103 3300025961 Bacteria 2939
230 Ga0207668_10574952 3300025972 Bacteria 979
231 Ga0207668_10771228 3300025972 Bacteria 849
232 Ga0207658_10042022 3300025986 Bacteria 3314
233 Ga0207677_10024865 3300026023 Bacteria 3727
234 Ga0207677_10225077 3300026023 Bacteria 1507
235 Ga0207703_10182737 3300026035 Bacteria 1851
236 Ga0207639_10042335 3300026041 Bacteria 3413
237 Ga0207678_10004074 3300026067 Bacteria 13148
238 Ga0207708_10447516 3300026075 Bacteria 1075
239 Ga0207702_10476909 3300026078 Bacteria 1213
240 Ga0207702_11498307 3300026078 Bacteria 668
241 Ga0207641_10195589 3300026088 Bacteria 1861
242 Ga0207648_10000538 3300026089 Bacteria 42268
243 Ga0207648_10009863 3300026089 Bacteria 9106
244 Ga0207676_10692652 3300026095 Bacteria 986
245 Ga0207675_100000834 3300026118 Bacteria 30656
246 Ga0207675_100022473 3300026118 Bacteria 5873
247 Ga0207683_10002401 3300026121 Bacteria 16354
248 Ga0207683_10969530 3300026121 Bacteria 789
249 Ga0207698_10591141 3300026142 Bacteria 1093
250 Ga0209813_10336134 3300027866 Unclassified 595
251 Ga0207428_10090538 3300027907 Bacteria 2376
252 Ga0207428_10581116 3300027907 Bacteria 808
253 Ga0268266_10291641 3300028379 Bacteria 1519
254 Ga0268266_10915942 3300028379 Bacteria 848
255 Ga0268266_11340925 3300028379 Bacteria 691
256 Ga0268264_10072266 3300028381 Bacteria 2925
257 Ga0307511_10000186 3300030521 Bacteria 61499
258 Ga0307512_10000766 3300030522 Bacteria 47681
259 Ga0307513_10051761 3300031456 Bacteria 4427
260 Ga0307509_10015244 3300031507 Bacteria 8981
261 Ga0307408_100150694 3300031548 Bacteria 1835
262 Ga0307408_100991602 3300031548 Bacteria 774
263 Ga0307408_101207717 3300031548 Unclassified 706
264 Ga0307508_10040268 3300031616 Bacteria 4195
265 Ga0307514_10197219 3300031649 Bacteria 1272
266 Ga0307516_10871040 3300031730 Bacteria 565
267 Ga0307405_10024964 3300031731 Bacteria 3424
268 Ga0307405_10028034 3300031731 Bacteria 3275
269 Ga0307413_10101201 3300031824 Bacteria 1905
270 Ga0307413_10466503 3300031824 Bacteria 1006
271 Ga0307413_11438135 3300031824 Bacteria 607
272 Ga0307518_10040819 3300031838 Bacteria 3376
273 Ga0307518_10056229 3300031838 Bacteria 2858
274 Ga0307410_10046505 3300031852 Bacteria 2895
275 Ga0307410_10076394 3300031852 Bacteria 2338
276 Ga0307410_10126430 3300031852 Bacteria 1872
277 Ga0307410_10142093 3300031852 Bacteria 1777
278 Ga0307410_11759404 3300031852 Bacteria 550
279 Ga0307406_10055933 3300031901 Bacteria 2524
280 Ga0307406_10126771 3300031901 Bacteria 1785
281 Ga0307406_10301503 3300031901 Bacteria 1231
282 Ga0307406_10316402 3300031901 Bacteria 1205
283 Ga0307406_10883494 3300031901 Unclassified 760
284 Ga0307407_10024683 3300031903 Bacteria 3156
285 Ga0307407_10034775 3300031903 Bacteria 2762
286 Ga0307407_10067839 3300031903 Bacteria 2110
287 Ga0307407_10111381 3300031903 Bacteria 1719
288 Ga0307407_10244261 3300031903 Bacteria 1226
289 Ga0307407_10272394 3300031903 Unclassified 1169
290 Ga0307407_10526129 3300031903 Bacteria 870
291 Ga0307407_10944153 3300031903 Bacteria 664
292 Ga0307412_10059764 3300031911 Bacteria 2556
293 Ga0307412_11567482 3300031911 Bacteria 601
294 Ga0307409_100011673 3300031995 Bacteria 5553
295 Ga0307409_100105971 3300031995 Bacteria 2345
296 Ga0307409_100168938 3300031995 Bacteria 1923
297 Ga0307409_100518060 3300031995 Bacteria 1164
298 Ga0307409_101060545 3300031995 Unclassified 830
299 Ga0307416_100023486 3300032002 Bacteria 4476
300 Ga0307416_100043758 3300032002 Bacteria 3509
301 Ga0307416_100099475 3300032002 Bacteria 2526
302 Ga0307416_100368294 3300032002 Bacteria 1462
303 Ga0307416_100815784 3300032002 Bacteria 1029
304 Ga0307414_10035149 3300032004 Bacteria 3332
305 Ga0307414_10295830 3300032004 Bacteria 1367
306 Ga0307411_10059673 3300032005 Bacteria 2530
307 Ga0307411_10238553 3300032005 Bacteria 1422
308 Ga0307411_11015295 3300032005 Bacteria 743
309 Ga0307411_11209254 3300032005 Bacteria 685
310 Ga0307415_100030670 3300032126 Bacteria 3454
311 Ga0307415_100086618 3300032126 Bacteria 2254
312 Ga0307415_100144340 3300032126 Bacteria 1822
313 Ga0307415_100163979 3300032126 Bacteria 1726
314 Ga0307415_100182748 3300032126 Bacteria 1647
315 Ga0307415_100219860 3300032126 Bacteria 1522
316 Ga0307415_100546202 3300032126 Bacteria 1022
317 Ga0307415_100883508 3300032126 Bacteria 822
318 Ga0307507_10118318 3300033179 Bacteria 2130
319 Ga0307510_10058155 3300033180 Bacteria 4006
320 Ga0373958_0139878 3300034819 Bacteria 598
321 Ga0373938_0048832 3300034957 Bacteria 961
322 Ga0373952_0032100 3300035092 Bacteria 1171
323 Ga0373941_0427278 3300035115 Bacteria 552
324 Ga0373931_0898457 3300035691 Bacteria 595
325 Ga0395900_1564525 3300037418 Unclassified 571
326 Ga0395898_0323239 3300037466 Bacteria 1472
327 Ga0395905_0214093 3300037471 Bacteria 1805
328 Ga0395901_0329335 3300038443 Bacteria 1579
329 Ga0395901_1493046 3300038443 Bacteria 632
330 Ga0439438_057921 3300041405 Bacteria 974
331 Ga0451837_0078867 3300041494 Bacteria 596
332 Ga0451841_0173632 3300041498 Bacteria 579
333 Ga0451843_0187215 3300041509 Bacteria 670
334 Ga0439448_0034950 3300042005 Bacteria 1608
335 Ga0439450_029468 3300042008 Bacteria 1227
336 Ga0439455_0027522 3300042012 Bacteria 1394
337 Ga0439455_0070995 3300042012 Bacteria 936
338 Ga0439463_032430 3300042016 Bacteria 1320
339 Ga0439463_099352 3300042016 Bacteria 750
340 Ga0450923_045900 3300042125 Bacteria 929
341 Ga0450888_044632 3300042126 Bacteria 623
342 Ga0450905_020956 3300042142 Bacteria 964
343 Ga0439464_0015062 3300042439 Bacteria 2084
344 Ga0439464_0205808 3300042439 Bacteria 629
345 Ga0439460_0009786 3300042461 Bacteria 2441
346 Ga0450916_004771 3300042530 Bacteria 1545
347 Ga0439440_0015696 3300042993 Bacteria 1649
348 Ga0439440_0076327 3300042993 Bacteria 880
349 Ga0439440_0174310 3300042993 Bacteria 627
350 Ga0495637_0343015 3300046520 Bacteria 525
351 Ga0495663_0165542 3300046525 Bacteria 760
352 Ga0495658_0250084 3300046683 Bacteria 1115
353 Ga0495658_0427027 3300046683 Bacteria 846
354 Ga0495613_0134384 3300046689 Bacteria 1770
355 Ga0495613_0147511 3300046689 Bacteria 1679
356 Ga0495680_0871163 3300047322 Bacteria 584
357 Ga0495687_002242 3300047443 Bacteria 15941
358 Ga0495686_0030207 3300047472 Bacteria 3521
359 Ga0496100_0007603 3300048903 Bacteria 5992
360 Ga0496101_0139442 3300048904 Bacteria 1847
361 Ga0496102_0016631 3300048905 Bacteria 6431
362 Ga0496102_0021643 3300048905 Bacteria 5688
363 Ga0496103_0046524 3300048906 Bacteria 2679
364 Ga0496103_0379316 3300048906 Bacteria 908
365 Ga0496105_0102303 3300048908 Bacteria 2366
366 Ga0496105_0363875 3300048908 Bacteria 1153
367 Ga0496106_0014262 3300048909 Bacteria 5870
368 Ga0496106_0979871 3300048909 Bacteria 665
369 Ga0496107_0050690 3300048910 Bacteria 2993
370 Ga0496107_0209484 3300048910 Bacteria 1449
371 Ga0496108_0000230 3300048911 Bacteria 50141
372 Ga0496108_0075511 3300048911 Bacteria 2848
373 Ga0496108_0448563 3300048911 Bacteria 1127
374 Ga0496109_0000990 3300048912 Bacteria 23432
375 Ga0496109_0053635 3300048912 Bacteria 3678
376 Ga0496109_0208040 3300048912 Bacteria 1840
377 Ga0496110_0170807 3300048913 Bacteria 1973
378 Ga0496110_0354142 3300048913 Bacteria 1337
379 Ga0496110_0483425 3300048913 Bacteria 1128
380 Ga0496111_0281097 3300048914 Bacteria 1234
381 Ga0496112_0055705 3300048915 Bacteria 3889
382 Ga0496113_0150793 3300048916 Bacteria 1834
383 Ga0496113_0589874 3300048916 Bacteria 890
384 Ga0496115_0087670 3300048918 Bacteria 2540
385 Ga0496115_0355510 3300048918 Bacteria 1194
386 Ga0501031_0578786 3300049568 Bacteria 723
387 Ga0501037_0162112 3300049573 Bacteria 1594
388 Ga0501038_0022278 3300049574 Bacteria 5678
389 Ga0501038_1291000 3300049574 Bacteria 527
390 Ga0501040_1404540 3300049576 Bacteria 507
391 Ga0501042_0593159 3300049578 Bacteria 805
392 Ga0501047_1424702 3300049581 Bacteria 508
393 Ga0501070_0787007 3300049586 Bacteria 748
394 Ga0501071_0594330 3300049587 Bacteria 851
395 Ga0501072_0225125 3300049588 Bacteria 1495
396 Ga0501072_1024673 3300049588 Bacteria 643
397 Ga0501081_1312481 3300049743 Bacteria 549
398 Ga0501045_0132540 3300049824 Bacteria 1853
399 nmdc:mga03n38_955875_c1 3300050490 Bacteria 506
400 nmdc:mga00v17_431881_c1 3300050491 Bacteria 855
401 nmdc:mga0yw44_76594_c1 3300050492 Bacteria 2088
402 nmdc:mga0k408_314945_c1 3300050493 Bacteria 934
403 nmdc:mga06z11_7799_c1 3300050494 Bacteria 4425
404 nmdc:mga04h51_371013_c1 3300050495 Unclassified 595
405 nmdc:mga05p37_121420_c1 3300050507 Bacteria 3209
406 nmdc:mga05p37_1776585_c1 3300050507 Unclassified 596
407 nmdc:mga05p37_46100_c1 3300050507 Bacteria 5360
408 nmdc:mga09592_104669_c1 3300050508 Bacteria 2425
409 nmdc:mga09592_154626_c1 3300050508 Unclassified 1980
410 nmdc:mga09592_1665333_c1 3300050508 Unclassified 515
411 nmdc:mga09592_35808_c1 3300050508 Bacteria 4156
412 nmdc:mga09592_953374_c1 3300050508 Bacteria 719
413 nmdc:mga0qj67_1002635_c1 3300050509 Bacteria 655
414 nmdc:mga0qj67_1097890_c1 3300050509 Bacteria 621
415 nmdc:mga0qj67_197226_c1 3300050509 Bacteria 1636
416 nmdc:mga0qj67_20684_c1 3300050509 Bacteria 5040
417 nmdc:mga06r32_15681_c1 3300050510 Bacteria 6885
418 nmdc:mga06r32_243420_c1 3300050510 Bacteria 1786
419 nmdc:mga06r32_279877_c1 3300050510 Bacteria 1655
420 nmdc:mga06r32_39227_c1 3300050510 Bacteria 4493
421 nmdc:mga06r32_55054_c1 3300050510 Bacteria 3815
422 nmdc:mga08y16_1169905_c1 3300050511 Bacteria 741
423 nmdc:mga08y16_146697_c1 3300050511 Bacteria 2453
424 nmdc:mga08y16_427099_c1 3300050511 Bacteria 1354
425 nmdc:mga0n895_16711_c1 3300050512 Bacteria 6741
426 nmdc:mga0rr50_22764_c1 3300050513 Bacteria 4307
427 nmdc:mga0a205_221332_c1 3300050515 Bacteria 1778
428 nmdc:mga0sz30_399371_c1 3300050516 Bacteria 616
429 Ga0500578_0210665 3300053086 Bacteria 1186
430 Ga0500641_0318154 3300053096 Bacteria 634
431 Ga0501084_1311171 3300054114 Bacteria 607
432 Ga0590071_010051 3300059421 Bacteria 2216
433 Ga0590071_108781 3300059421 Bacteria 702
434 Ga0590075_006808 3300059424 Bacteria 2706
435 Ga0501082_0583848 3300060353 Bacteria 978
436 Ga0530510_1164417 3300061734 Bacteria 591

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050507 nmdc:mga05p37_1776585_c1 nmdc:mga05p37_1776585_c1_30_389 109
2 3300006042 Ga0075368_10322435 Ga0075368_103224352 121
3 3300006178 Ga0075367_10179014 Ga0075367_101790141 121
4 3300006844 Ga0075428_100005551 Ga0075428_10000555110 121
5 3300006844 Ga0075428_100047208 Ga0075428_1000472085 121
6 3300006844 Ga0075428_100097359 Ga0075428_1000973593 121
7 3300006844 Ga0075428_100342812 Ga0075428_1003428122 121
8 3300006844 Ga0075428_101322677 Ga0075428_1013226772 121
9 3300006846 Ga0075430_100005024 Ga0075430_10000502415 121
10 3300006846 Ga0075430_100014922 Ga0075430_1000149225 121
11 3300006847 Ga0075431_100080398 Ga0075431_1000803983 121
12 3300006847 Ga0075431_100257746 Ga0075431_1002577462 121
13 3300006880 Ga0075429_100023765 Ga0075429_1000237653 121
14 3300006880 Ga0075429_100097135 Ga0075429_1000971353 121
15 3300009011 Ga0105251_10356789 Ga0105251_103567892 121
16 3300009147 Ga0114129_10041710 Ga0114129_100417105 121
17 3300009147 Ga0114129_12164942 Ga0114129_121649421 121
18 3300027866 Ga0209813_10336134 Ga0209813_103361341 121
19 3300037418 Ga0395900_1564525 Ga0395900_1564525_29_418 121
20 3300038443 Ga0395901_1493046 Ga0395901_1493046_176_565 121
21 3300042126 Ga0450888_044632 Ga0450888_044632_63_437 121
22 3300049573 Ga0501037_0162112 Ga0501037_0162112_120_515 121
23 3300050495 nmdc:mga04h51_371013_c1 nmdc:mga04h51_371013_c1_87_461 121
24 3300050507 nmdc:mga05p37_46100_c1 nmdc:mga05p37_46100_c1_3360_3749 121
25 3300050508 nmdc:mga09592_154626_c1 nmdc:mga09592_154626_c1_649_1038 121
26 3300050508 nmdc:mga09592_35808_c1 nmdc:mga09592_35808_c1_1640_2029 121
27 3300050508 nmdc:mga09592_953374_c1 nmdc:mga09592_953374_c1_312_701 121
28 3300050509 nmdc:mga0qj67_197226_c1 nmdc:mga0qj67_197226_c1_42_431 121
29 3300050510 nmdc:mga06r32_243420_c1 nmdc:mga06r32_243420_c1_472_861 121
30 3300050510 nmdc:mga06r32_279877_c1 nmdc:mga06r32_279877_c1_1165_1551 121
31 3300050510 nmdc:mga06r32_39227_c1 nmdc:mga06r32_39227_c1_1724_2113 121
32 3300031911 Ga0307412_11567482 Ga0307412_115674821 123
33 iso_pu_bacteria 2915358134 2915363330 124
34 iso_pu_bacteria 2868088558 2868090981 127
35 3300049574 Ga0501038_1291000 Ga0501038_1291000_105_497 128
36 3300005356 Ga0070674_100452738 Ga0070674_1004527382 129
37 3300005356 Ga0070674_101529275 Ga0070674_1015292751 129
38 3300005441 Ga0070700_100039737 Ga0070700_1000397371 129
39 3300005456 Ga0070678_101565283 Ga0070678_1015652831 129
40 3300006846 Ga0075430_100647925 Ga0075430_1006479251 129
41 3300009148 Ga0105243_10085439 Ga0105243_100854392 129
42 3300009148 Ga0105243_10337172 Ga0105243_103371721 129
43 3300013308 Ga0157375_10258831 Ga0157375_102588312 129
44 3300025901 Ga0207688_10283976 Ga0207688_102839762 129
45 3300025935 Ga0207709_10025857 Ga0207709_100258572 129
46 3300025937 Ga0207669_10536127 Ga0207669_105361272 129
47 3300025937 Ga0207669_11553622 Ga0207669_115536221 129
48 3300026075 Ga0207708_10447516 Ga0207708_104475162 129
49 3300031901 Ga0307406_10055933 Ga0307406_100559332 129
50 3300050509 nmdc:mga0qj67_1002635_c1 nmdc:mga0qj67_1002635_c1_157_549 129
51 3300001991 JGI24743J22301_10001115 JGI24743J22301_100011154 130
52 3300002077 JGI24744J21845_10006744 JGI24744J21845_100067442 130
53 3300002077 JGI24744J21845_10013870 JGI24744J21845_100138704 130
54 3300002239 JGI24034J26672_10039511 JGI24034J26672_100395112 130
55 3300002244 JGI24742J22300_10009813 JGI24742J22300_100098134 130
56 3300003373 JGI25407J50210_10000720 JGI25407J50210_100007205 130
57 3300003373 JGI25407J50210_10004238 JGI25407J50210_100042384 130
58 3300003373 JGI25407J50210_10009075 JGI25407J50210_100090751 130
59 3300003373 JGI25407J50210_10070226 JGI25407J50210_100702262 130
60 3300005328 Ga0070676_10061245 Ga0070676_100612453 130
61 3300005330 Ga0070690_100044212 Ga0070690_1000442124 130
62 3300005334 Ga0068869_100217337 Ga0068869_1002173372 130
63 3300005335 Ga0070666_10174932 Ga0070666_101749322 130
64 3300005335 Ga0070666_10290447 Ga0070666_102904473 130
65 3300005336 Ga0070680_100917521 Ga0070680_1009175211 130
66 3300005337 Ga0070682_100223232 Ga0070682_1002232322 130
67 3300005338 Ga0068868_100036734 Ga0068868_1000367343 130
68 3300005339 Ga0070660_100679475 Ga0070660_1006794751 130
69 3300005340 Ga0070689_100079297 Ga0070689_1000792972 130
70 3300005341 Ga0070691_10237465 Ga0070691_102374652 130
71 3300005345 Ga0070692_10122471 Ga0070692_101224712 130
72 3300005345 Ga0070692_10470039 Ga0070692_104700392 130
73 3300005347 Ga0070668_100008673 Ga0070668_1000086732 130
74 3300005347 Ga0070668_100047712 Ga0070668_1000477123 130
75 3300005353 Ga0070669_100070317 Ga0070669_1000703175 130
76 3300005353 Ga0070669_100222883 Ga0070669_1002228832 130
77 3300005354 Ga0070675_100387946 Ga0070675_1003879461 130
78 3300005354 Ga0070675_100451301 Ga0070675_1004513011 130
79 3300005355 Ga0070671_100226471 Ga0070671_1002264712 130
80 3300005356 Ga0070674_100006602 Ga0070674_1000066022 130
81 3300005356 Ga0070674_100062059 Ga0070674_1000620594 130
82 3300005364 Ga0070673_100360802 Ga0070673_1003608022 130
83 3300005365 Ga0070688_100082648 Ga0070688_1000826482 130
84 3300005367 Ga0070667_100270195 Ga0070667_1002701953 130
85 3300005435 Ga0070714_100819230 Ga0070714_1008192301 130
86 3300005437 Ga0070710_10001850 Ga0070710_1000185011 130
87 3300005437 Ga0070710_10010111 Ga0070710_100101113 130
88 3300005438 Ga0070701_10142827 Ga0070701_101428272 130
89 3300005439 Ga0070711_100033844 Ga0070711_1000338441 130
90 3300005440 Ga0070705_100057520 Ga0070705_1000575203 130
91 3300005440 Ga0070705_100417353 Ga0070705_1004173531 130
92 3300005441 Ga0070700_100045587 Ga0070700_1000455873 130
93 3300005444 Ga0070694_100055110 Ga0070694_1000551102 130
94 3300005444 Ga0070694_100116323 Ga0070694_1001163232 130
95 3300005445 Ga0070708_100497539 Ga0070708_1004975392 130
96 3300005455 Ga0070663_100007014 Ga0070663_1000070144 130
97 3300005456 Ga0070678_100000467 Ga0070678_10000046714 130
98 3300005456 Ga0070678_100112488 Ga0070678_1001124882 130
99 3300005457 Ga0070662_100018969 Ga0070662_1000189695 130
100 3300005459 Ga0068867_100004148 Ga0068867_1000041483 130
101 3300005459 Ga0068867_100165643 Ga0068867_1001656432 130
102 3300005466 Ga0070685_10069034 Ga0070685_100690342 130
103 3300005466 Ga0070685_10268378 Ga0070685_102683782 130
104 3300005530 Ga0070679_100212640 Ga0070679_1002126402 130
105 3300005539 Ga0068853_100051695 Ga0068853_1000516955 130
106 3300005539 Ga0068853_100123628 Ga0068853_1001236282 130
107 3300005543 Ga0070672_100595526 Ga0070672_1005955263 130
108 3300005545 Ga0070695_100102060 Ga0070695_1001020602 130
109 3300005546 Ga0070696_100142929 Ga0070696_1001429291 130
110 3300005548 Ga0070665_100219226 Ga0070665_1002192263 130
111 3300005548 Ga0070665_100495677 Ga0070665_1004956773 130
112 3300005549 Ga0070704_100000602 Ga0070704_10000060214 130
113 3300005549 Ga0070704_100010411 Ga0070704_1000104115 130
114 3300005578 Ga0068854_100000791 Ga0068854_10000079111 130
115 3300005578 Ga0068854_100359197 Ga0068854_1003591972 130
116 3300005614 Ga0068856_100754813 Ga0068856_1007548133 130
117 3300005615 Ga0070702_100056123 Ga0070702_1000561233 130
118 3300005615 Ga0070702_100058819 Ga0070702_1000588194 130
119 3300005616 Ga0068852_100003821 Ga0068852_1000038215 130
120 3300005617 Ga0068859_100041464 Ga0068859_1000414643 130
121 3300005617 Ga0068859_100124199 Ga0068859_1001241993 130
122 3300005618 Ga0068864_100607185 Ga0068864_1006071852 130
123 3300005719 Ga0068861_100049521 Ga0068861_1000495215 130
124 3300005841 Ga0068863_100784092 Ga0068863_1007840922 130
125 3300005842 Ga0068858_100007165 Ga0068858_1000071652 130
126 3300005843 Ga0068860_100007042 Ga0068860_1000070421 130
127 3300005843 Ga0068860_100021868 Ga0068860_1000218684 130
128 3300005844 Ga0068862_100014349 Ga0068862_1000143493 130
129 3300005981 Ga0081538_10000734 Ga0081538_1000073445 130
130 3300005981 Ga0081538_10000938 Ga0081538_1000093816 130
131 3300005981 Ga0081538_10001146 Ga0081538_1000114614 130
132 3300005981 Ga0081538_10001613 Ga0081538_1000161321 130
133 3300005981 Ga0081538_10011131 Ga0081538_100111311 130
134 3300005981 Ga0081538_10022056 Ga0081538_100220563 130
135 3300005981 Ga0081538_10046068 Ga0081538_100460685 130
136 3300005985 Ga0081539_10021668 Ga0081539_100216681 130
137 3300006048 Ga0075363_100464319 Ga0075363_1004643191 130
138 3300006051 Ga0075364_10413925 Ga0075364_104139252 130
139 3300006163 Ga0070715_10110957 Ga0070715_101109573 130
140 3300006173 Ga0070716_100008590 Ga0070716_1000085903 130
141 3300006175 Ga0070712_100069845 Ga0070712_1000698455 130
142 3300006195 Ga0075366_10306564 Ga0075366_103065641 130
143 3300006237 Ga0097621_100052835 Ga0097621_1000528353 130
144 3300006237 Ga0097621_100063534 Ga0097621_1000635343 130
145 3300006358 Ga0068871_100016121 Ga0068871_1000161214 130
146 3300006844 Ga0075428_100143967 Ga0075428_1001439672 130
147 3300006846 Ga0075430_100010232 Ga0075430_1000102325 130
148 3300006847 Ga0075431_100042397 Ga0075431_1000423972 130
149 3300006847 Ga0075431_100309824 Ga0075431_1003098242 130
150 3300006847 Ga0075431_101843422 Ga0075431_1018434222 130
151 3300006880 Ga0075429_100107235 Ga0075429_1001072352 130
152 3300006881 Ga0068865_100103169 Ga0068865_1001031693 130
153 3300006931 Ga0097620_100041464 Ga0097620_1000414643 130
154 3300006931 Ga0097620_100124193 Ga0097620_1001241933 130
155 3300007076 Ga0075435_100018857 Ga0075435_1000188573 130
156 3300009094 Ga0111539_10187033 Ga0111539_101870332 130
157 3300009094 Ga0111539_10529674 Ga0111539_105296744 130
158 3300009098 Ga0105245_10004967 Ga0105245_100049671 130
159 3300009098 Ga0105245_10097547 Ga0105245_100975473 130
160 3300009098 Ga0105245_10933566 Ga0105245_109335663 130
161 3300009101 Ga0105247_10025789 Ga0105247_100257895 130
162 3300009147 Ga0114129_10374484 Ga0114129_103744842 130
163 3300009147 Ga0114129_10811474 Ga0114129_108114742 130
164 3300009148 Ga0105243_10008681 Ga0105243_100086811 130
165 3300009148 Ga0105243_10110904 Ga0105243_101109044 130
166 3300009176 Ga0105242_10005121 Ga0105242_100051214 130
167 3300009176 Ga0105242_10153123 Ga0105242_101531232 130
168 3300009177 Ga0105248_10147711 Ga0105248_101477112 130
169 3300009177 Ga0105248_10718266 Ga0105248_107182662 130
170 3300009551 Ga0105238_10360668 Ga0105238_103606682 130
171 3300009553 Ga0105249_10134005 Ga0105249_101340052 130
172 3300009553 Ga0105249_11560162 Ga0105249_115601621 130
173 3300010375 Ga0105239_10022933 Ga0105239_100229338 130
174 3300010375 Ga0105239_10084185 Ga0105239_100841855 130
175 3300011119 Ga0105246_10055624 Ga0105246_100556243 130
176 3300013100 Ga0157373_11252243 Ga0157373_112522431 130
177 3300013105 Ga0157369_10277204 Ga0157369_102772043 130
178 3300013296 Ga0157374_10023187 Ga0157374_100231875 130
179 3300013297 Ga0157378_10004671 Ga0157378_1000467113 130
180 3300013306 Ga0163162_10104180 Ga0163162_101041804 130
181 3300013306 Ga0163162_10968782 Ga0163162_109687822 130
182 3300013307 Ga0157372_10008000 Ga0157372_100080005 130
183 3300013307 Ga0157372_10396861 Ga0157372_103968611 130
184 3300013308 Ga0157375_10002631 Ga0157375_1000263115 130
185 3300014326 Ga0157380_10026827 Ga0157380_100268273 130
186 3300014326 Ga0157380_10132784 Ga0157380_101327843 130
187 3300014745 Ga0157377_10005782 Ga0157377_100057825 130
188 3300014968 Ga0157379_10081649 Ga0157379_100816494 130
189 3300014968 Ga0157379_11262922 Ga0157379_112629222 130
190 3300014969 Ga0157376_10155131 Ga0157376_101551312 130
191 3300017792 Ga0163161_10000957 Ga0163161_100009571 130
192 3300017792 Ga0163161_10072226 Ga0163161_100722264 130
193 3300025321 Ga0207656_10051679 Ga0207656_100516794 130
194 3300025899 Ga0207642_10037207 Ga0207642_100372073 130
195 3300025899 Ga0207642_10124720 Ga0207642_101247202 130
196 3300025901 Ga0207688_10000638 Ga0207688_100006388 130
197 3300025901 Ga0207688_10002191 Ga0207688_100021918 130
198 3300025903 Ga0207680_10169510 Ga0207680_101695103 130
199 3300025904 Ga0207647_10017746 Ga0207647_100177463 130
200 3300025905 Ga0207685_10057516 Ga0207685_100575162 130
201 3300025906 Ga0207699_10092573 Ga0207699_100925733 130
202 3300025907 Ga0207645_10016691 Ga0207645_100166915 130
203 3300025907 Ga0207645_10186381 Ga0207645_101863812 130
204 3300025908 Ga0207643_10148299 Ga0207643_101482992 130
205 3300025914 Ga0207671_10157368 Ga0207671_101573684 130
206 3300025915 Ga0207693_10000776 Ga0207693_1000077618 130
207 3300025915 Ga0207693_10003141 Ga0207693_100031416 130
208 3300025916 Ga0207663_10047571 Ga0207663_100475712 130
209 3300025919 Ga0207657_10172761 Ga0207657_101727614 130
210 3300025923 Ga0207681_10028655 Ga0207681_100286552 130
211 3300025923 Ga0207681_10454626 Ga0207681_104546262 130
212 3300025924 Ga0207694_10615035 Ga0207694_106150352 130
213 3300025926 Ga0207659_10088101 Ga0207659_100881012 130
214 3300025927 Ga0207687_10072514 Ga0207687_100725145 130
215 3300025931 Ga0207644_11004161 Ga0207644_110041613 130
216 3300025932 Ga0207690_10053557 Ga0207690_100535572 130
217 3300025933 Ga0207706_10004169 Ga0207706_100041693 130
218 3300025933 Ga0207706_10006010 Ga0207706_100060108 130
219 3300025935 Ga0207709_10033423 Ga0207709_100334234 130
220 3300025938 Ga0207704_10056547 Ga0207704_100565472 130
221 3300025938 Ga0207704_10131069 Ga0207704_101310692 130
222 3300025939 Ga0207665_10011883 Ga0207665_100118834 130
223 3300025940 Ga0207691_10168263 Ga0207691_101682632 130
224 3300025941 Ga0207711_10227588 Ga0207711_102275883 130
225 3300025941 Ga0207711_11504496 Ga0207711_115044962 130
226 3300025942 Ga0207689_10154459 Ga0207689_101544592 130
227 3300025949 Ga0207667_10274139 Ga0207667_102741391 130
228 3300025949 Ga0207667_11752929 Ga0207667_117529292 130
229 3300025961 Ga0207712_10004248 Ga0207712_100042483 130
230 3300025961 Ga0207712_10049103 Ga0207712_100491035 130
231 3300025972 Ga0207668_10574952 Ga0207668_105749521 130
232 3300025972 Ga0207668_10771228 Ga0207668_107712281 130
233 3300025986 Ga0207658_10042022 Ga0207658_100420223 130
234 3300026023 Ga0207677_10024865 Ga0207677_100248655 130
235 3300026023 Ga0207677_10225077 Ga0207677_102250771 130
236 3300026035 Ga0207703_10182737 Ga0207703_101827373 130
237 3300026041 Ga0207639_10042335 Ga0207639_100423355 130
238 3300026067 Ga0207678_10004074 Ga0207678_1000407410 130
239 3300026078 Ga0207702_10476909 Ga0207702_104769092 130
240 3300026088 Ga0207641_10195589 Ga0207641_101955893 130
241 3300026089 Ga0207648_10000538 Ga0207648_1000053834 130
242 3300026089 Ga0207648_10009863 Ga0207648_100098638 130
243 3300026095 Ga0207676_10692652 Ga0207676_106926522 130
244 3300026118 Ga0207675_100000834 Ga0207675_10000083417 130
245 3300026118 Ga0207675_100022473 Ga0207675_1000224733 130
246 3300026121 Ga0207683_10002401 Ga0207683_100024013 130
247 3300026121 Ga0207683_10969530 Ga0207683_109695301 130
248 3300026142 Ga0207698_10591141 Ga0207698_105911412 130
249 3300027907 Ga0207428_10581116 Ga0207428_105811163 130
250 3300028379 Ga0268266_10291641 Ga0268266_102916412 130
251 3300028379 Ga0268266_10915942 Ga0268266_109159422 130
252 3300028381 Ga0268264_10072266 Ga0268264_100722663 130
253 3300031548 Ga0307408_100150694 Ga0307408_1001506943 130
254 3300031731 Ga0307405_10024964 Ga0307405_100249646 130
255 3300031731 Ga0307405_10028034 Ga0307405_100280343 130
256 3300031824 Ga0307413_11438135 Ga0307413_114381351 130
257 3300031852 Ga0307410_10046505 Ga0307410_100465053 130
258 3300031852 Ga0307410_10126430 Ga0307410_101264302 130
259 3300031852 Ga0307410_11759404 Ga0307410_117594041 130
260 3300031901 Ga0307406_10126771 Ga0307406_101267712 130
261 3300031901 Ga0307406_10316402 Ga0307406_103164022 130
262 3300031903 Ga0307407_10034775 Ga0307407_100347752 130
263 3300031903 Ga0307407_10244261 Ga0307407_102442612 130
264 3300031903 Ga0307407_10944153 Ga0307407_109441531 130
265 3300031911 Ga0307412_10059764 Ga0307412_100597645 130
266 3300031995 Ga0307409_100011673 Ga0307409_1000116736 130
267 3300031995 Ga0307409_100105971 Ga0307409_1001059712 130
268 3300031995 Ga0307409_100168938 Ga0307409_1001689381 130
269 3300031995 Ga0307409_100518060 Ga0307409_1005180601 130
270 3300032002 Ga0307416_100043758 Ga0307416_1000437582 130
271 3300032004 Ga0307414_10035149 Ga0307414_100351493 130
272 3300032004 Ga0307414_10295830 Ga0307414_102958301 130
273 3300032005 Ga0307411_10238553 Ga0307411_102385532 130
274 3300032005 Ga0307411_11015295 Ga0307411_110152952 130
275 3300032126 Ga0307415_100030670 Ga0307415_1000306703 130
276 3300032126 Ga0307415_100086618 Ga0307415_1000866181 130
277 3300032126 Ga0307415_100144340 Ga0307415_1001443403 130
278 3300032126 Ga0307415_100163979 Ga0307415_1001639792 130
279 3300032126 Ga0307415_100219860 Ga0307415_1002198602 130
280 3300034819 Ga0373958_0139878 Ga0373958_0139878_82_477 130
281 3300034957 Ga0373938_0048832 Ga0373938_0048832_401_796 130
282 3300035092 Ga0373952_0032100 Ga0373952_0032100_63_458 130
283 3300035115 Ga0373941_0427278 Ga0373941_0427278_74_469 130
284 3300035691 Ga0373931_0898457 Ga0373931_0898457_23_418 130
285 3300037466 Ga0395898_0323239 Ga0395898_0323239_778_1179 130
286 3300037471 Ga0395905_0214093 Ga0395905_0214093_651_1052 130
287 3300038443 Ga0395901_0329335 Ga0395901_0329335_553_954 130
288 3300041405 Ga0439438_057921 Ga0439438_057921_130_522 130
289 3300042005 Ga0439448_0034950 Ga0439448_0034950_206_607 130
290 3300042008 Ga0439450_029468 Ga0439450_029468_210_611 130
291 3300042016 Ga0439463_032430 Ga0439463_032430_140_541 130
292 3300042125 Ga0450923_045900 Ga0450923_045900_143_547 130
293 3300042142 Ga0450905_020956 Ga0450905_020956_355_756 130
294 3300042439 Ga0439464_0015062 Ga0439464_0015062_788_1189 130
295 3300042461 Ga0439460_0009786 Ga0439460_0009786_1223_1624 130
296 3300042530 Ga0450916_004771 Ga0450916_004771_885_1286 130
297 3300042993 Ga0439440_0015696 Ga0439440_0015696_1131_1532 130
298 3300042993 Ga0439440_0174310 Ga0439440_0174310_108_509 130
299 3300048903 Ga0496100_0007603 Ga0496100_0007603_1999_2394 130
300 3300048904 Ga0496101_0139442 Ga0496101_0139442_1288_1683 130
301 3300048905 Ga0496102_0016631 Ga0496102_0016631_739_1134 130
302 3300048905 Ga0496102_0021643 Ga0496102_0021643_1923_2318 130
303 3300048906 Ga0496103_0046524 Ga0496103_0046524_492_887 130
304 3300048906 Ga0496103_0379316 Ga0496103_0379316_164_559 130
305 3300048908 Ga0496105_0102303 Ga0496105_0102303_740_1135 130
306 3300048909 Ga0496106_0014262 Ga0496106_0014262_5427_5822 130
307 3300048909 Ga0496106_0979871 Ga0496106_0979871_135_530 130
308 3300048910 Ga0496107_0050690 Ga0496107_0050690_1320_1715 130
309 3300048910 Ga0496107_0209484 Ga0496107_0209484_232_627 130
310 3300048911 Ga0496108_0000230 Ga0496108_0000230_48074_48469 130
311 3300048911 Ga0496108_0448563 Ga0496108_0448563_223_618 130
312 3300048912 Ga0496109_0000990 Ga0496109_0000990_10245_10640 130
313 3300048912 Ga0496109_0208040 Ga0496109_0208040_129_524 130
314 3300048913 Ga0496110_0354142 Ga0496110_0354142_116_511 130
315 3300048913 Ga0496110_0483425 Ga0496110_0483425_71_466 130
316 3300048914 Ga0496111_0281097 Ga0496111_0281097_216_611 130
317 3300048915 Ga0496112_0055705 Ga0496112_0055705_1673_2068 130
318 3300048916 Ga0496113_0150793 Ga0496113_0150793_95_490 130
319 3300048916 Ga0496113_0589874 Ga0496113_0589874_24_419 130
320 3300048918 Ga0496115_0087670 Ga0496115_0087670_1336_1731 130
321 3300048918 Ga0496115_0355510 Ga0496115_0355510_91_486 130
322 3300049581 Ga0501047_1424702 Ga0501047_1424702_70_465 130
323 3300049588 Ga0501072_0225125 Ga0501072_0225125_376_771 130
324 3300049588 Ga0501072_1024673 Ga0501072_1024673_81_473 130
325 3300050490 nmdc:mga03n38_955875_c1 nmdc:mga03n38_955875_c1_85_477 130
326 3300050491 nmdc:mga00v17_431881_c1 nmdc:mga00v17_431881_c1_402_797 130
327 3300050493 nmdc:mga0k408_314945_c1 nmdc:mga0k408_314945_c1_295_687 130
328 3300050507 nmdc:mga05p37_121420_c1 nmdc:mga05p37_121420_c1_2163_2564 130
329 3300050508 nmdc:mga09592_104669_c1 nmdc:mga09592_104669_c1_1081_1488 130
330 3300050509 nmdc:mga0qj67_20684_c1 nmdc:mga0qj67_20684_c1_3964_4365 130
331 3300050510 nmdc:mga06r32_15681_c1 nmdc:mga06r32_15681_c1_3307_3714 130
332 3300050510 nmdc:mga06r32_55054_c1 nmdc:mga06r32_55054_c1_500_901 130
333 3300050511 nmdc:mga08y16_1169905_c1 nmdc:mga08y16_1169905_c1_36_431 130
334 3300050511 nmdc:mga08y16_146697_c1 nmdc:mga08y16_146697_c1_1223_1624 130
335 3300050512 nmdc:mga0n895_16711_c1 nmdc:mga0n895_16711_c1_4016_4408 130
336 3300050513 nmdc:mga0rr50_22764_c1 nmdc:mga0rr50_22764_c1_1471_1863 130
337 3300001990 JGI24737J22298_10112659 JGI24737J22298_101126592 131
338 3300003911 JGI25405J52794_10027329 JGI25405J52794_100273293 131
339 3300005338 Ga0068868_100597967 Ga0068868_1005979672 131
340 3300005457 Ga0070662_101659508 Ga0070662_1016595081 131
341 3300005548 Ga0070665_101564365 Ga0070665_1015643652 131
342 3300005937 Ga0081455_10006480 Ga0081455_1000648011 131
343 3300005981 Ga0081538_10005254 Ga0081538_100052546 131
344 3300005981 Ga0081538_10009073 Ga0081538_100090733 131
345 3300006038 Ga0075365_10128868 Ga0075365_101288681 131
346 3300006844 Ga0075428_100527455 Ga0075428_1005274552 131
347 3300006852 Ga0075433_10558343 Ga0075433_105583432 131
348 3300006880 Ga0075429_100944503 Ga0075429_1009445032 131
349 3300006881 Ga0068865_100523317 Ga0068865_1005233172 131
350 3300009094 Ga0111539_10455001 Ga0111539_104550011 131
351 3300009098 Ga0105245_10522032 Ga0105245_105220322 131
352 3300009147 Ga0114129_10205482 Ga0114129_102054825 131
353 3300009147 Ga0114129_10333986 Ga0114129_103339862 131
354 3300009553 Ga0105249_10077184 Ga0105249_100771845 131
355 3300009553 Ga0105249_11274787 Ga0105249_112747871 131
356 3300011119 Ga0105246_10170648 Ga0105246_101706483 131
357 3300013306 Ga0163162_11205680 Ga0163162_112056801 131
358 3300026078 Ga0207702_11498307 Ga0207702_114983071 131
359 3300027907 Ga0207428_10090538 Ga0207428_100905381 131
360 3300028379 Ga0268266_11340925 Ga0268266_113409252 131
361 3300030521 Ga0307511_10000186 Ga0307511_1000018614 131
362 3300030522 Ga0307512_10000766 Ga0307512_1000076639 131
363 3300031456 Ga0307513_10051761 Ga0307513_100517612 131
364 3300031507 Ga0307509_10015244 Ga0307509_100152446 131
365 3300031548 Ga0307408_100991602 Ga0307408_1009916022 131
366 3300031548 Ga0307408_101207717 Ga0307408_1012077172 131
367 3300031616 Ga0307508_10040268 Ga0307508_100402682 131
368 3300031649 Ga0307514_10197219 Ga0307514_101972191 131
369 3300031730 Ga0307516_10871040 Ga0307516_108710401 131
370 3300031824 Ga0307413_10101201 Ga0307413_101012013 131
371 3300031824 Ga0307413_10466503 Ga0307413_104665032 131
372 3300031838 Ga0307518_10040819 Ga0307518_100408192 131
373 3300031838 Ga0307518_10056229 Ga0307518_100562293 131
374 3300031852 Ga0307410_10076394 Ga0307410_100763944 131
375 3300031852 Ga0307410_10142093 Ga0307410_101420932 131
376 3300031901 Ga0307406_10301503 Ga0307406_103015031 131
377 3300031901 Ga0307406_10883494 Ga0307406_108834941 131
378 3300031903 Ga0307407_10024683 Ga0307407_100246832 131
379 3300031903 Ga0307407_10067839 Ga0307407_100678392 131
380 3300031903 Ga0307407_10111381 Ga0307407_101113812 131
381 3300031903 Ga0307407_10272394 Ga0307407_102723942 131
382 3300031903 Ga0307407_10526129 Ga0307407_105261292 131
383 3300031995 Ga0307409_101060545 Ga0307409_1010605452 131
384 3300032002 Ga0307416_100023486 Ga0307416_1000234866 131
385 3300032002 Ga0307416_100099475 Ga0307416_1000994754 131
386 3300032002 Ga0307416_100368294 Ga0307416_1003682942 131
387 3300032002 Ga0307416_100815784 Ga0307416_1008157842 131
388 3300032005 Ga0307411_10059673 Ga0307411_100596733 131
389 3300032005 Ga0307411_11209254 Ga0307411_112092541 131
390 3300032126 Ga0307415_100182748 Ga0307415_1001827482 131
391 3300032126 Ga0307415_100546202 Ga0307415_1005462021 131
392 3300032126 Ga0307415_100883508 Ga0307415_1008835082 131
393 3300033179 Ga0307507_10118318 Ga0307507_101183183 131
394 3300033180 Ga0307510_10058155 Ga0307510_100581553 131
395 3300041494 Ga0451837_0078867 Ga0451837_0078867_121_519 131
396 3300041498 Ga0451841_0173632 Ga0451841_0173632_85_510 131
397 3300041509 Ga0451843_0187215 Ga0451843_0187215_219_632 131
398 3300042012 Ga0439455_0027522 Ga0439455_0027522_950_1348 131
399 3300042012 Ga0439455_0070995 Ga0439455_0070995_464_895 131
400 3300042016 Ga0439463_099352 Ga0439463_099352_122_580 131
401 3300042439 Ga0439464_0205808 Ga0439464_0205808_122_520 131
402 3300042993 Ga0439440_0076327 Ga0439440_0076327_14_412 131
403 3300046520 Ga0495637_0343015 Ga0495637_0343015_105_503 131
404 3300046525 Ga0495663_0165542 Ga0495663_0165542_312_710 131
405 3300046683 Ga0495658_0250084 Ga0495658_0250084_672_1067 131
406 3300046683 Ga0495658_0427027 Ga0495658_0427027_392_805 131
407 3300046689 Ga0495613_0134384 Ga0495613_0134384_1230_1625 131
408 3300046689 Ga0495613_0147511 Ga0495613_0147511_340_735 131
409 3300047322 Ga0495680_0871163 Ga0495680_0871163_27_464 131
410 3300047443 Ga0495687_002242 Ga0495687_002242_9990_10385 131
411 3300047472 Ga0495686_0030207 Ga0495686_0030207_1591_1986 131
412 3300048908 Ga0496105_0363875 Ga0496105_0363875_653_1090 131
413 3300048911 Ga0496108_0075511 Ga0496108_0075511_910_1323 131
414 3300048912 Ga0496109_0053635 Ga0496109_0053635_1061_1474 131
415 3300048913 Ga0496110_0170807 Ga0496110_0170807_1122_1535 131
416 3300049568 Ga0501031_0578786 Ga0501031_0578786_18_416 131
417 3300049574 Ga0501038_0022278 Ga0501038_0022278_2444_2839 131
418 3300049576 Ga0501040_1404540 Ga0501040_1404540_56_454 131
419 3300049578 Ga0501042_0593159 Ga0501042_0593159_47_448 131
420 3300049586 Ga0501070_0787007 Ga0501070_0787007_191_586 131
421 3300049587 Ga0501071_0594330 Ga0501071_0594330_235_633 131
422 3300049743 Ga0501081_1312481 Ga0501081_1312481_113_511 131
423 3300049824 Ga0501045_0132540 Ga0501045_0132540_244_642 131
424 3300050492 nmdc:mga0yw44_76594_c1 nmdc:mga0yw44_76594_c1_1255_1668 131
425 3300050494 nmdc:mga06z11_7799_c1 nmdc:mga06z11_7799_c1_2312_2725 131
426 3300050508 nmdc:mga09592_1665333_c1 nmdc:mga09592_1665333_c1_66_464 131
427 3300050509 nmdc:mga0qj67_1097890_c1 nmdc:mga0qj67_1097890_c1_144_542 131
428 3300050511 nmdc:mga08y16_427099_c1 nmdc:mga08y16_427099_c1_849_1247 131
429 3300050515 nmdc:mga0a205_221332_c1 nmdc:mga0a205_221332_c1_74_472 131
430 3300050516 nmdc:mga0sz30_399371_c1 nmdc:mga0sz30_399371_c1_184_597 131
431 3300053086 Ga0500578_0210665 Ga0500578_0210665_466_861 131
432 3300053096 Ga0500641_0318154 Ga0500641_0318154_142_537 131
433 3300054114 Ga0501084_1311171 Ga0501084_1311171_14_409 131
434 3300059421 Ga0590071_010051 Ga0590071_010051_1212_1619 131
435 3300059421 Ga0590071_108781 Ga0590071_108781_172_573 131
436 3300059424 Ga0590075_006808 Ga0590075_006808_549_956 131
437 3300060353 Ga0501082_0583848 Ga0501082_0583848_326_724 131
438 3300061734 Ga0530510_1164417 Ga0530510_1164417_81_479 131
439 iso_pu_bacteria 2862281513 2862283847 131

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13474

SnoaL_3

SnoaL-like domain

26

149

0.92

PF12680

SnoaL_2

SnoaL-like domain

30

140

0.85

PF14534

DUF4440

Domain of unknown function (DUF4440)

26

139

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f7s-assembly1.cif.gz_A-2 crystal structure of a ntf2-like protein of unknown function (pp_4556) from pseudomonas putida kt2440 at 2.11 a resolution 0.9034 1 131
3e9d-assembly1.cif.gz_A structure of full-length tigar from danio rerio 0.8816 103 128
3f7s-assembly1.cif.gz_A-2 crystal structure of a ntf2-like protein of unknown function (pp_4556) from pseudomonas putida kt2440 at 2.11 a resolution 0.8775 1 131
3e9c-assembly1.cif.gz_A structure of a tryptic core fragment of tigar from danio rerio 0.8377 103 128
3gve-assembly1.cif.gz_A crystal structure of calcineurin-like phosphoesterase yfkn from bacillus subtilis 0.8306 104 128
ID Description Score Start End Superfamily
af_G5ECA7_6_124_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8464 3 127 3.10.450.50
3f7sA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8435 1 125 3.10.450.50
af_G5ECA7_6_124_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8399 3 127 3.10.450.50
af_Q7KPV8_5_124_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8375 1 127 3.10.450.50
af_Q7KPV8_5_124_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8312 1 127 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A238UQN3-F1-model_v4 SnoaL-like domain-containing protein 0.9912 3 130
AF-A0A4R7HC07-F1-model_v4 deleted 0.9898 2 130
AF-A0A7T1TDD7-F1-model_v4 SgcJ/EcaC family oxidoreductase 0.987 1 131
AF-A0A2T7KJN4-F1-model_v4 DUF4440 domain-containing protein 0.987 3 130
AF-D6B1H3-F1-model_v4 deleted 0.9857 1 130

Feature Viewer

pLDDT pTM Quality
90.74 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map