F444230

General Info

Members Datasets Scaffolds Average Seq Length
439 214 432 132

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100051418|Ga0307408_1000514183
Length 142
Sequence MAGLPVVKPEDVVIPEDALSERFLAATGPGGQNVNKVATACQLRVDIYKLGLEPYAYERLKTVAGSKMTTGGELIITARRYRTQEANREDARRRLAEMIAQAHLVQAKRRPTKPSKAARARRVDEKKGRSAVKQGRGKVSWD

Samples

Sample ID Description Type Environment
1 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
2 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
3 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
4 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
5 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
6 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
7 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
8 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
116 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
137 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
138 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
139 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
140 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
145 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
146 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
147 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
148 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
149 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
154 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
157 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
158 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
190 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
191 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
192 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
193 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
194 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
195 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
196 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
197 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
198 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
203 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
211 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
212 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
213 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 0.23
Isolates 1.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.38
Nodule 0
Rhizoplane 1.59
Rhizosphere 90.43
Stem 0
Stem Tuber 0
Unclassified 1.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1006241 3300001977 Bacteria 1851
2 JGI24739J22299_10141884 3300001989 Bacteria 712
3 JGI24750J21931_1016139 3300002070 Bacteria 1013
4 JGI24751J29686_10090420 3300002459 Bacteria 637
5 Ga0055536_1001049 3300003781 Bacteria 17457
6 Ga0055536_1002000 3300003781 Bacteria 11700
7 Ga0055536_1003619 3300003781 Bacteria 8252
8 Ga0055534_1005318 3300003784 Bacteria 3473
9 Ga0055530_10000012 3300003791 Bacteria 164829
10 Ga0055530_10074593 3300003791 Bacteria 724
11 Ga0055531_10003131 3300003794 Bacteria 10666
12 Ga0055531_10018563 3300003794 Bacteria 2864
13 Ga0065715_10046227 3300005293 Bacteria 1216
14 Ga0065715_10120205 3300005293 Bacteria 2264
15 Ga0065715_10294806 3300005293 Bacteria 1055
16 Ga0065715_10594448 3300005293 Bacteria 712
17 Ga0065715_11136661 3300005293 Bacteria 512
18 Ga0070676_10010220 3300005328 Bacteria 5090
19 Ga0070683_100351873 3300005329 Bacteria 1403
20 Ga0070670_100069933 3300005331 Bacteria 3013
21 Ga0070670_100160130 3300005331 Bacteria 1951
22 Ga0070670_100420022 3300005331 Bacteria 1182
23 Ga0070670_100565271 3300005331 Bacteria 1015
24 Ga0070670_100975047 3300005331 Unclassified 770
25 Ga0070677_10003172 3300005333 Bacteria 5290
26 Ga0070677_10103343 3300005333 Bacteria 1260
27 Ga0070666_10465520 3300005335 Bacteria 914
28 Ga0070666_10511680 3300005335 Bacteria 871
29 Ga0070668_100068726 3300005347 Bacteria 2754
30 Ga0070668_100075371 3300005347 Bacteria 2634
31 Ga0070668_100254684 3300005347 Bacteria 1458
32 Ga0070668_101770964 3300005347 Bacteria 568
33 Ga0070669_100020178 3300005353 Bacteria 4759
34 Ga0070669_100938697 3300005353 Bacteria 740
35 Ga0070675_100024934 3300005354 Bacteria 4793
36 Ga0070675_101061307 3300005354 Bacteria 744
37 Ga0070671_100207194 3300005355 Bacteria 1663
38 Ga0070671_100228435 3300005355 Bacteria 1579
39 Ga0070674_100003218 3300005356 Bacteria 9110
40 Ga0070674_100308022 3300005356 Bacteria 1265
41 Ga0070674_101092934 3300005356 Bacteria 704
42 Ga0070673_100020586 3300005364 Bacteria 4759
43 Ga0070667_100263730 3300005367 Bacteria 1543
44 Ga0070667_100871434 3300005367 Bacteria 837
45 Ga0070663_100208210 3300005455 Bacteria 1530
46 Ga0070663_100275667 3300005455 Bacteria 1339
47 Ga0070678_100021074 3300005456 Bacteria 4290
48 Ga0070662_100016921 3300005457 Bacteria 4903
49 Ga0070662_100144277 3300005457 Bacteria 1848
50 Ga0070662_101308274 3300005457 Bacteria 624
51 Ga0070681_10258148 3300005458 Bacteria 1655
52 Ga0068867_100042621 3300005459 Bacteria 3321
53 Ga0070684_100498650 3300005535 Bacteria 1128
54 Ga0068853_100038308 3300005539 Bacteria 4083
55 Ga0068853_100603417 3300005539 Bacteria 1042
56 Ga0070672_100012476 3300005543 Bacteria 5968
57 Ga0070672_100013583 3300005543 Bacteria 5758
58 Ga0070686_100965745 3300005544 Bacteria 697
59 Ga0070686_101876371 3300005544 Bacteria 511
60 Ga0070693_101008793 3300005547 Bacteria 630
61 Ga0070664_100761480 3300005564 Bacteria 904
62 Ga0068857_100385050 3300005577 Bacteria 1303
63 Ga0068854_100167662 3300005578 Bacteria 1706
64 Ga0068852_100258893 3300005616 Bacteria 1670
65 Ga0068852_100361432 3300005616 Bacteria 1420
66 Ga0068859_100021937 3300005617 Bacteria 6403
67 Ga0068864_100451618 3300005618 Bacteria 1229
68 Ga0068864_100731129 3300005618 Bacteria 969
69 Ga0068861_100031129 3300005719 Bacteria 3916
70 Ga0068851_11037670 3300005834 Bacteria 518
71 Ga0068863_100256739 3300005841 Bacteria 1689
72 Ga0068860_100110957 3300005843 Bacteria 2622
73 Ga0068860_101542011 3300005843 Bacteria 686
74 Ga0068862_100088341 3300005844 Bacteria 2697
75 Ga0068862_100132358 3300005844 Bacteria 2207
76 Ga0068862_100372833 3300005844 Bacteria 1329
77 Ga0068862_100951127 3300005844 Bacteria 847
78 Ga0068862_101004490 3300005844 Bacteria 825
79 Ga0097621_100314345 3300006237 Bacteria 1386
80 Ga0097621_100871731 3300006237 Bacteria 837
81 Ga0068871_100022513 3300006358 Bacteria 4860
82 Ga0075428_100168096 3300006844 Bacteria 2379
83 Ga0075434_100821916 3300006871 Bacteria 945
84 Ga0075429_100954492 3300006880 Bacteria 750
85 Ga0097620_100021935 3300006931 Bacteria 6403
86 Ga0105250_10168585 3300009092 Bacteria 916
87 Ga0105240_11326936 3300009093 Bacteria 758
88 Ga0111539_10033494 3300009094 Bacteria 6237
89 Ga0111539_10278002 3300009094 Bacteria 1948
90 Ga0105245_10302192 3300009098 Bacteria 1570
91 Ga0105241_10809580 3300009174 Bacteria 864
92 Ga0105248_10048125 3300009177 Bacteria 4782
93 Ga0105248_10258765 3300009177 Bacteria 1959
94 Ga0105238_10049332 3300009551 Bacteria 4240
95 Ga0105249_10019669 3300009553 Bacteria 6026
96 Ga0105249_10119278 3300009553 Bacteria 2505
97 Ga0105249_11075021 3300009553 Bacteria 874
98 Ga0157373_10196734 3300013100 Bacteria 1421
99 Ga0157373_11211056 3300013100 Bacteria 569
100 Ga0157371_10053524 3300013102 Bacteria 2866
101 Ga0157371_10313543 3300013102 Bacteria 1137
102 Ga0157369_10582603 3300013105 Bacteria 1155
103 Ga0163162_10184532 3300013306 Bacteria 2213
104 Ga0157372_10135339 3300013307 Bacteria 2837
105 Ga0157372_11488562 3300013307 Bacteria 780
106 Ga0157372_12666044 3300013307 Bacteria 573
107 Ga0157375_10062446 3300013308 Bacteria 3702
108 Ga0157380_10004583 3300014326 Bacteria 9594
109 Ga0157380_10007020 3300014326 Bacteria 7969
110 Ga0157380_10238386 3300014326 Bacteria 1638
111 Ga0157380_10365624 3300014326 Bacteria 1355
112 Ga0163161_10017454 3300017792 Bacteria 5023
113 Ga0163161_11326941 3300017792 Bacteria 626
114 Ga0206356_10987455 3300020070 Bacteria 2466
115 Ga0209565_1038036 3300025263 Bacteria 908
116 Ga0209675_1000272 3300025291 Bacteria 49613
117 Ga0209676_1000359 3300025292 Bacteria 86410
118 Ga0209676_1000449 3300025292 Bacteria 69842
119 Ga0209676_1001894 3300025292 Bacteria 17064
120 Ga0209676_1111196 3300025292 Bacteria 565
121 Ga0209025_1014498 3300025294 Bacteria 4840
122 Ga0209025_1099728 3300025294 Bacteria 923
123 Ga0209758_1161944 3300025297 Bacteria 555
124 Ga0209050_1000067 3300025298 Bacteria 304206
125 Ga0209050_1016677 3300025298 Bacteria 2987
126 Ga0209257_1000113 3300025304 Bacteria 233523
127 Ga0209257_1000699 3300025304 Bacteria 51960
128 Ga0209257_1006597 3300025304 Bacteria 7399
129 Ga0207697_10005895 3300025315 Bacteria 5626
130 Ga0207697_10048364 3300025315 Bacteria 1754
131 Ga0207682_10005356 3300025893 Bacteria 5234
132 Ga0207688_11035998 3300025901 Bacteria 518
133 Ga0207645_10013319 3300025907 Bacteria 5548
134 Ga0207643_10585746 3300025908 Bacteria 717
135 Ga0207707_10427318 3300025912 Bacteria 1135
136 Ga0207681_10009365 3300025923 Bacteria 5982
137 Ga0207694_10731184 3300025924 Bacteria 835
138 Ga0207650_10126877 3300025925 Bacteria 1993
139 Ga0207650_10129489 3300025925 Bacteria 1973
140 Ga0207650_10460992 3300025925 Bacteria 1059
141 Ga0207659_10011223 3300025926 Bacteria 5654
142 Ga0207644_10156829 3300025931 Bacteria 1766
143 Ga0207644_10223524 3300025931 Bacteria 1493
144 Ga0207690_10092220 3300025932 Bacteria 2143
145 Ga0207706_10002358 3300025933 Bacteria 18447
146 Ga0207706_10180058 3300025933 Bacteria 1856
147 Ga0207706_10912574 3300025933 Bacteria 741
148 Ga0207709_10094263 3300025935 Bacteria 1965
149 Ga0207669_10007521 3300025937 Bacteria 5045
150 Ga0207691_10003298 3300025940 Bacteria 15733
151 Ga0207691_10128229 3300025940 Bacteria 2243
152 Ga0207711_10198678 3300025941 Bacteria 1829
153 Ga0207661_10146639 3300025944 Bacteria 2037
154 Ga0207679_10183869 3300025945 Bacteria 1731
155 Ga0207651_10499573 3300025960 Bacteria 1051
156 Ga0207712_10030587 3300025961 Bacteria 3621
157 Ga0207712_10184042 3300025961 Bacteria 1643
158 Ga0207668_10186024 3300025972 Bacteria 1642
159 Ga0207668_10828623 3300025972 Bacteria 820
160 Ga0207668_10838941 3300025972 Bacteria 815
161 Ga0207640_10541978 3300025981 Bacteria 976
162 Ga0207658_10070382 3300025986 Bacteria 2646
163 Ga0207639_10047147 3300026041 Bacteria 3255
164 Ga0207639_10151416 3300026041 Bacteria 1943
165 Ga0207639_11384780 3300026041 Bacteria 660
166 Ga0207678_10212974 3300026067 Bacteria 1653
167 Ga0207678_10257248 3300026067 Bacteria 1496
168 Ga0207641_10294048 3300026088 Bacteria 1532
169 Ga0207648_10390380 3300026089 Bacteria 1260
170 Ga0207676_10162406 3300026095 Bacteria 1937
171 Ga0207676_10346682 3300026095 Bacteria 1372
172 Ga0207676_10621104 3300026095 Bacteria 1040
173 Ga0207675_100035624 3300026118 Bacteria 4642
174 Ga0207675_100459357 3300026118 Bacteria 1263
175 Ga0207683_10019674 3300026121 Bacteria 5769
176 Ga0209974_10018759 3300027876 Bacteria 2295
177 Ga0209974_10059394 3300027876 Bacteria 1293
178 Ga0207428_10229291 3300027907 Bacteria 1390
179 Ga0207428_10276174 3300027907 Bacteria 1248
180 Ga0268265_10110718 3300028380 Bacteria 2241
181 Ga0268265_10136640 3300028380 Bacteria 2046
182 Ga0268265_10203291 3300028380 Bacteria 1720
183 Ga0268265_10219541 3300028380 Bacteria 1662
184 Ga0268264_11286895 3300028381 Bacteria 741
185 Ga0316178_1138680 3300030735 Bacteria 1173
186 Ga0316183_1076830 3300030742 Bacteria 1206
187 Ga0307408_100011817 3300031548 Bacteria 5776
188 Ga0307408_100023154 3300031548 Bacteria 4228
189 Ga0307408_100051418 3300031548 Bacteria 2967
190 Ga0307408_100078429 3300031548 Bacteria 2462
191 Ga0307408_100175611 3300031548 Bacteria 1714
192 Ga0307408_100220286 3300031548 Bacteria 1548
193 Ga0307408_100425999 3300031548 Bacteria 1145
194 Ga0307405_10006380 3300031731 Bacteria 5796
195 Ga0307405_10032550 3300031731 Bacteria 3083
196 Ga0307405_10136718 3300031731 Bacteria 1702
197 Ga0307405_10172487 3300031731 Bacteria 1544
198 Ga0307405_10214352 3300031731 Bacteria 1408
199 Ga0307405_10232327 3300031731 Bacteria 1360
200 Ga0307405_10284668 3300031731 Bacteria 1246
201 Ga0307405_11005797 3300031731 Bacteria 711
202 Ga0307413_10003428 3300031824 Bacteria 6668
203 Ga0307413_10028034 3300031824 Bacteria 3130
204 Ga0307413_10028621 3300031824 Bacteria 3106
205 Ga0307413_10034808 3300031824 Bacteria 2882
206 Ga0307413_10046265 3300031824 Bacteria 2585
207 Ga0307413_10060320 3300031824 Bacteria 2335
208 Ga0307413_10077324 3300031824 Bacteria 2119
209 Ga0307413_10084062 3300031824 Bacteria 2050
210 Ga0307413_10086947 3300031824 Bacteria 2023
211 Ga0307413_10143215 3300031824 Bacteria 1654
212 Ga0307413_10316643 3300031824 Bacteria 1190
213 Ga0307413_10360318 3300031824 Bacteria 1125
214 Ga0307413_10406590 3300031824 Bacteria 1068
215 Ga0307413_10407229 3300031824 Bacteria 1067
216 Ga0307413_11553751 3300031824 Bacteria 586
217 Ga0307410_10003471 3300031852 Bacteria 7910
218 Ga0307410_10009981 3300031852 Bacteria 5355
219 Ga0307410_10082967 3300031852 Bacteria 2255
220 Ga0307410_10088606 3300031852 Bacteria 2191
221 Ga0307410_10148677 3300031852 Bacteria 1741
222 Ga0307410_10170962 3300031852 Bacteria 1637
223 Ga0307410_10214384 3300031852 Bacteria 1477
224 Ga0307410_10934860 3300031852 Bacteria 744
225 Ga0307410_11062674 3300031852 Bacteria 700
226 Ga0307406_10014534 3300031901 Bacteria 4532
227 Ga0307406_10029531 3300031901 Bacteria 3321
228 Ga0307406_10075018 3300031901 Bacteria 2230
229 Ga0307406_10114197 3300031901 Bacteria 1865
230 Ga0307406_10130576 3300031901 Bacteria 1763
231 Ga0307406_10192384 3300031901 Bacteria 1494
232 Ga0307406_10683352 3300031901 Bacteria 855
233 Ga0307406_10977691 3300031901 Bacteria 725
234 Ga0307407_10002741 3300031903 Bacteria 7007
235 Ga0307407_10014822 3300031903 Bacteria 3830
236 Ga0307407_10023005 3300031903 Bacteria 3244
237 Ga0307407_10051459 3300031903 Bacteria 2361
238 Ga0307407_10091445 3300031903 Bacteria 1866
239 Ga0307407_10113249 3300031903 Bacteria 1707
240 Ga0307407_10119646 3300031903 Bacteria 1667
241 Ga0307407_10206499 3300031903 Bacteria 1320
242 Ga0307407_10625469 3300031903 Bacteria 804
243 Ga0307407_10708406 3300031903 Bacteria 759
244 Ga0307407_10738313 3300031903 Bacteria 744
245 Ga0307412_10027029 3300031911 Bacteria 3573
246 Ga0307412_10044408 3300031911 Bacteria 2899
247 Ga0307412_10072180 3300031911 Bacteria 2358
248 Ga0307412_10077752 3300031911 Bacteria 2283
249 Ga0307412_10096030 3300031911 Bacteria 2085
250 Ga0307412_10103984 3300031911 Bacteria 2014
251 Ga0307412_10110602 3300031911 Bacteria 1961
252 Ga0307412_10172231 3300031911 Bacteria 1619
253 Ga0307412_10770585 3300031911 Bacteria 832
254 Ga0307412_10893503 3300031911 Bacteria 778
255 Ga0307412_11926134 3300031911 Bacteria 546
256 Ga0307409_100005458 3300031995 Bacteria 7323
257 Ga0307409_100074429 3300031995 Bacteria 2714
258 Ga0307409_100095117 3300031995 Bacteria 2453
259 Ga0307409_100135554 3300031995 Bacteria 2112
260 Ga0307409_100188051 3300031995 Bacteria 1835
261 Ga0307409_100196298 3300031995 Bacteria 1801
262 Ga0307409_100217388 3300031995 Bacteria 1722
263 Ga0307409_100232454 3300031995 Bacteria 1672
264 Ga0307409_100397506 3300031995 Bacteria 1315
265 Ga0307409_100593907 3300031995 Bacteria 1093
266 Ga0307409_101108080 3300031995 Bacteria 813
267 Ga0307409_101567972 3300031995 Bacteria 686
268 Ga0307416_100038296 3300032002 Bacteria 3698
269 Ga0307416_100085769 3300032002 Bacteria 2681
270 Ga0307416_100087216 3300032002 Bacteria 2663
271 Ga0307416_100111780 3300032002 Bacteria 2409
272 Ga0307416_100160378 3300032002 Bacteria 2078
273 Ga0307416_100186277 3300032002 Bacteria 1951
274 Ga0307416_100375032 3300032002 Bacteria 1450
275 Ga0307416_100403209 3300032002 Bacteria 1406
276 Ga0307416_100839867 3300032002 Bacteria 1016
277 Ga0307416_101105393 3300032002 Bacteria 897
278 Ga0307416_101274457 3300032002 Bacteria 841
279 Ga0307416_101321546 3300032002 Bacteria 827
280 Ga0307416_101552991 3300032002 Bacteria 767
281 Ga0307414_10000107 3300032004 Bacteria 58717
282 Ga0307414_10006350 3300032004 Bacteria 6585
283 Ga0307414_10014099 3300032004 Bacteria 4777
284 Ga0307414_10017740 3300032004 Bacteria 4363
285 Ga0307414_10023198 3300032004 Bacteria 3930
286 Ga0307414_10026398 3300032004 Bacteria 3737
287 Ga0307414_10109931 3300032004 Bacteria 2095
288 Ga0307414_10123943 3300032004 Bacteria 1992
289 Ga0307414_10125817 3300032004 Bacteria 1980
290 Ga0307414_10127968 3300032004 Bacteria 1966
291 Ga0307414_10261539 3300032004 Bacteria 1444
292 Ga0307414_10290037 3300032004 Bacteria 1379
293 Ga0307414_10436242 3300032004 Bacteria 1145
294 Ga0307414_10474247 3300032004 Bacteria 1102
295 Ga0307414_10475608 3300032004 Bacteria 1101
296 Ga0307414_10627898 3300032004 Bacteria 966
297 Ga0307414_10771059 3300032004 Bacteria 875
298 Ga0307414_11194447 3300032004 Bacteria 704
299 Ga0307414_11256465 3300032004 Bacteria 686
300 Ga0307414_11312345 3300032004 Bacteria 671
301 Ga0307414_12301354 3300032004 Bacteria 503
302 Ga0307411_10011769 3300032005 Bacteria 4739
303 Ga0307411_10013955 3300032005 Bacteria 4454
304 Ga0307411_10021085 3300032005 Bacteria 3804
305 Ga0307411_10071054 3300032005 Bacteria 2357
306 Ga0307411_10181909 3300032005 Bacteria 1596
307 Ga0307411_10291545 3300032005 Bacteria 1304
308 Ga0307411_10403619 3300032005 Bacteria 1130
309 Ga0307411_10448780 3300032005 Bacteria 1078
310 Ga0307411_10595570 3300032005 Bacteria 950
311 Ga0307411_11027392 3300032005 Bacteria 739
312 Ga0307415_100029716 3300032126 Bacteria 3496
313 Ga0307415_100077298 3300032126 Bacteria 2363
314 Ga0307415_100079277 3300032126 Bacteria 2339
315 Ga0307415_100215376 3300032126 Bacteria 1535
316 Ga0307415_100281704 3300032126 Bacteria 1367
317 Ga0307415_100298215 3300032126 Bacteria 1334
318 Ga0307415_100320663 3300032126 Bacteria 1292
319 Ga0307415_100760897 3300032126 Bacteria 880
320 Ga0373937_0122949 3300036401 Bacteria 2420
321 Ga0395899_0238965 3300037312 Bacteria 1251
322 Ga0395900_0009343 3300037418 Bacteria 10053
323 Ga0395898_0084019 3300037466 Bacteria 3069
324 Ga0395905_0000412 3300037471 Bacteria 60157
325 Ga0395905_0806522 3300037471 Bacteria 842
326 Ga0395901_0005879 3300038443 Bacteria 12416
327 Ga0436363_1685783 3300039450 Bacteria 956
328 Ga0439453_0008955 3300041408 Bacteria 1621
329 Ga0451843_1759913 3300041509 Bacteria 574
330 Ga0439431_0195919 3300041997 Bacteria 587
331 Ga0439445_0000134 3300042004 Bacteria 12854
332 Ga0439464_0025634 3300042439 Bacteria 1633
333 Ga0466965_0094173 3300044683 Bacteria 1526
334 Ga0466970_0228358 3300044765 Bacteria 1040
335 Ga0495610_0131304 3300046512 Bacteria 1087
336 Ga0495643_0129135 3300046522 Bacteria 1270
337 Ga0495663_0055145 3300046525 Bacteria 1239
338 Ga0495663_0071387 3300046525 Bacteria 1106
339 Ga0495642_0131791 3300046528 Bacteria 1076
340 Ga0495642_0206167 3300046528 Bacteria 857
341 Ga0495654_0099636 3300046530 Bacteria 1339
342 Ga0495598_0013526 3300046537 Bacteria 2025
343 Ga0495598_0045912 3300046537 Bacteria 1297
344 Ga0495621_0000680 3300046539 Bacteria 8570
345 Ga0495621_0003225 3300046539 Bacteria 4480
346 Ga0495621_0007430 3300046539 Bacteria 3245
347 Ga0495621_0048888 3300046539 Bacteria 1507
348 Ga0495633_0208877 3300046558 Bacteria 895
349 Ga0495668_0000002 3300046616 Bacteria 763179
350 Ga0495625_0000430 3300046660 Bacteria 63143
351 Ga0495625_0205779 3300046660 Bacteria 1296
352 Ga0495659_0076999 3300046664 Bacteria 1259
353 Ga0495659_0135301 3300046664 Bacteria 980
354 Ga0495588_0578838 3300046674 Bacteria 588
355 Ga0495669_0020805 3300046684 Bacteria 2843
356 Ga0495669_0163973 3300046684 Bacteria 1055
357 Ga0495670_0043120 3300046691 Bacteria 2251
358 Ga0495670_0084820 3300046691 Bacteria 1616
359 Ga0495670_0704460 3300046691 Bacteria 551
360 Ga0495677_0083365 3300047445 Bacteria 1200
361 Ga0495677_0389028 3300047445 Bacteria 551
362 Ga0495681_0171084 3300047470 Bacteria 898
363 Ga0496103_0474645 3300048906 Bacteria 801
364 Ga0496107_0124349 3300048910 Bacteria 1901
365 Ga0496108_0118743 3300048911 Bacteria 2267
366 Ga0496109_0124057 3300048912 Bacteria 2407
367 Ga0496110_0046506 3300048913 Bacteria 3797
368 Ga0496114_0084772 3300048917 Bacteria 2683
369 Ga0496115_0446009 3300048918 Bacteria 1046
370 Ga0496125_0148433 3300048928 Bacteria 1616
371 Ga0496126_0209234 3300048929 Bacteria 1643
372 Ga0501031_0359341 3300049568 Bacteria 942
373 Ga0501032_0147606 3300049569 Bacteria 1547
374 Ga0501033_0223751 3300049570 Bacteria 1338
375 Ga0501034_0221663 3300049571 Bacteria 1843
376 Ga0501036_0052615 3300049572 Bacteria 3448
377 Ga0501036_0536410 3300049572 Bacteria 973
378 Ga0501037_0047393 3300049573 Bacteria 3149
379 Ga0501037_0131977 3300049573 Bacteria 1791
380 Ga0501038_0051819 3300049574 Bacteria 3539
381 Ga0501038_0464864 3300049574 Bacteria 971
382 Ga0501039_0034507 3300049575 Bacteria 3904
383 Ga0501039_0051948 3300049575 Bacteria 3172
384 Ga0501040_0493464 3300049576 Bacteria 883
385 Ga0501041_0376655 3300049577 Bacteria 898
386 Ga0501043_0321554 3300049579 Bacteria 1179
387 Ga0501046_0274469 3300049580 Bacteria 1236
388 Ga0501047_0121516 3300049581 Bacteria 2493
389 Ga0501047_0381654 3300049581 Bacteria 1243
390 Ga0501048_0257452 3300049582 Bacteria 1240
391 Ga0501071_0381884 3300049587 Bacteria 1074
392 Ga0501072_0261505 3300049588 Bacteria 1377
393 Ga0501073_0081445 3300049589 Bacteria 2252
394 Ga0501074_0061192 3300049590 Bacteria 2713
395 Ga0501075_0062335 3300049591 Bacteria 2810
396 Ga0501076_0340137 3300049592 Bacteria 1231
397 Ga0501077_0112139 3300049593 Bacteria 1729
398 Ga0501206_033877 3300049653 Bacteria 768
399 Ga0501209_270845 3300049656 Bacteria 532
400 Ga0501214_009638 3300049659 Bacteria 1043
401 Ga0501216_028621 3300049660 Bacteria 1017
402 Ga0501217_089499 3300049661 Bacteria 862
403 Ga0501235_012085 3300049669 Bacteria 1897
404 Ga0501257_106273 3300049686 Bacteria 741
405 Ga0501258_003068 3300049687 Bacteria 1509
406 Ga0501221_008385 3300049704 Bacteria 1795
407 Ga0501225_0117906 3300049705 Bacteria 787
408 Ga0501079_0080862 3300049741 Bacteria 2512
409 Ga0501079_0347204 3300049741 Bacteria 1162
410 Ga0501080_0438678 3300049742 Bacteria 1172
411 Ga0501081_0067888 3300049743 Bacteria 2481
412 Ga0501081_0246067 3300049743 Bacteria 1304
413 Ga0501268_012550 3300049765 Bacteria 1356
414 Ga0501270_005536 3300049767 Bacteria 1473
415 Ga0501035_0046470 3300049822 Bacteria 3905
416 Ga0501035_0061150 3300049822 Bacteria 3352
417 Ga0501044_0034002 3300049823 Bacteria 5350
418 Ga0501044_0312575 3300049823 Bacteria 1497
419 Ga0501045_0209309 3300049824 Bacteria 1453
420 Ga0501204_022671 3300049850 Bacteria 830
421 nmdc:mga09592_1275053_c1 3300050508 Bacteria 605
422 nmdc:mga08y16_138723_c1 3300050511 Bacteria 2528
423 nmdc:mga08y16_307009_c1 3300050511 Bacteria 1634
424 Ga0500592_021574 3300053116 Bacteria 1037
425 Ga0500658_0057822 3300053134 Bacteria 1604
426 Ga0500568_0004814 3300053139 Bacteria 7134
427 Ga0500568_0207688 3300053139 Bacteria 716
428 Ga0500627_0000058 3300053158 Bacteria 51946
429 Ga0500627_0173861 3300053158 Bacteria 970
430 Ga0501082_0011753 3300060353 Bacteria 7525
431 Ga0501082_1042166 3300060353 Bacteria 715
432 Ga0501082_1574097 3300060353 Bacteria 574

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014326 Ga0157380_10365624 Ga0157380_103656241 112
2 3300017792 Ga0163161_11326941 Ga0163161_113269412 113
3 3300046691 Ga0495670_0704460 Ga0495670_0704460_48_455 113
4 3300009094 Ga0111539_10278002 Ga0111539_102780022 114
5 3300027876 Ga0209974_10059394 Ga0209974_100593943 114
6 3300027907 Ga0207428_10229291 Ga0207428_102292911 114
7 3300005293 Ga0065715_10046227 Ga0065715_100462273 115
8 3300032004 Ga0307414_11194447 Ga0307414_111944472 116
9 3300005329 Ga0070683_100351873 Ga0070683_1003518733 117
10 3300005356 Ga0070674_101092934 Ga0070674_1010929341 117
11 3300005535 Ga0070684_100498650 Ga0070684_1004986501 117
12 3300005547 Ga0070693_101008793 Ga0070693_1010087931 117
13 3300005616 Ga0068852_100258893 Ga0068852_1002588932 117
14 3300005834 Ga0068851_11037670 Ga0068851_110376702 117
15 3300009093 Ga0105240_11326936 Ga0105240_113269362 117
16 3300009551 Ga0105238_10049332 Ga0105238_100493324 117
17 3300013307 Ga0157372_10135339 Ga0157372_101353392 117
18 3300020070 Ga0206356_10987455 Ga0206356_109874553 118
19 3300025924 Ga0207694_10731184 Ga0207694_107311842 118
20 3300025944 Ga0207661_10146639 Ga0207661_101466393 118
21 3300031901 Ga0307406_10977691 Ga0307406_109776912 119
22 3300031995 Ga0307409_101108080 Ga0307409_1011080802 119
23 3300032002 Ga0307416_100403209 Ga0307416_1004032093 119
24 3300032126 Ga0307415_100079277 Ga0307415_1000792772 119
25 3300049686 Ga0501257_106273 Ga0501257_106273_136_552 119
26 3300053139 Ga0500568_0207688 Ga0500568_0207688_103_504 119
27 3300001989 JGI24739J22299_10141884 JGI24739J22299_101418842 120
28 3300005331 Ga0070670_100160130 Ga0070670_1001601303 120
29 3300025925 Ga0207650_10126877 Ga0207650_101268773 120
30 3300031548 Ga0307408_100220286 Ga0307408_1002202863 120
31 3300031901 Ga0307406_10130576 Ga0307406_101305762 120
32 3300031903 Ga0307407_10738313 Ga0307407_107383132 120
33 3300031995 Ga0307409_100188051 Ga0307409_1001880514 120
34 3300032002 Ga0307416_101105393 Ga0307416_1011053932 120
35 3300032005 Ga0307411_10448780 Ga0307411_104487802 120
36 3300032126 Ga0307415_100760897 Ga0307415_1007608972 120
37 3300050511 nmdc:mga08y16_307009_c1 nmdc:mga08y16_307009_c1_1052_1462 122
38 3300032004 Ga0307414_10436242 Ga0307414_104362422 123
39 3300048928 Ga0496125_0148433 Ga0496125_0148433_1191_1592 123
40 3300026118 Ga0207675_100459357 Ga0207675_1004593572 124
41 3300031903 Ga0307407_10119646 Ga0307407_101196462 124
42 3300039450 Ga0436363_1685783 Ga0436363_1685783_217_642 124
43 3300046537 Ga0495598_0045912 Ga0495598_0045912_309_719 124
44 3300046539 Ga0495621_0003225 Ga0495621_0003225_2700_3110 124
45 3300046664 Ga0495659_0135301 Ga0495659_0135301_352_762 124
46 3300046691 Ga0495670_0084820 Ga0495670_0084820_434_844 124
47 3300047445 Ga0495677_0389028 Ga0495677_0389028_36_446 124
48 3300005844 Ga0068862_100951127 Ga0068862_1009511272 125
49 3300031824 Ga0307413_10406590 Ga0307413_104065902 125
50 3300031852 Ga0307410_10003471 Ga0307410_100034714 125
51 3300031903 Ga0307407_10113249 Ga0307407_101132492 125
52 3300031995 Ga0307409_100593907 Ga0307409_1005939073 125
53 3300032004 Ga0307414_10261539 Ga0307414_102615392 125
54 3300032004 Ga0307414_12301354 Ga0307414_123013542 125
55 3300032005 Ga0307411_10181909 Ga0307411_101819092 125
56 3300036401 Ga0373937_0122949 Ga0373937_0122949_1771_2175 125
57 3300049569 Ga0501032_0147606 Ga0501032_0147606_615_1013 125
58 3300049570 Ga0501033_0223751 Ga0501033_0223751_683_1081 125
59 3300049571 Ga0501034_0221663 Ga0501034_0221663_773_1171 125
60 3300049572 Ga0501036_0052615 Ga0501036_0052615_693_1091 125
61 3300049573 Ga0501037_0047393 Ga0501037_0047393_2101_2499 125
62 3300049574 Ga0501038_0051819 Ga0501038_0051819_2853_3251 125
63 3300049575 Ga0501039_0034507 Ga0501039_0034507_1393_1791 125
64 3300049579 Ga0501043_0321554 Ga0501043_0321554_597_995 125
65 3300049580 Ga0501046_0274469 Ga0501046_0274469_470_868 125
66 3300049581 Ga0501047_0381654 Ga0501047_0381654_630_1028 125
67 3300049582 Ga0501048_0257452 Ga0501048_0257452_516_914 125
68 3300049822 Ga0501035_0046470 Ga0501035_0046470_3281_3679 125
69 3300049823 Ga0501044_0034002 Ga0501044_0034002_4099_4497 125
70 3300005333 Ga0070677_10103343 Ga0070677_101033433 127
71 3300005353 Ga0070669_100938697 Ga0070669_1009386972 127
72 3300005356 Ga0070674_100308022 Ga0070674_1003080222 127
73 3300014326 Ga0157380_10004583 Ga0157380_100045837 127
74 3300031824 Ga0307413_10060320 Ga0307413_100603203 127
75 3300032004 Ga0307414_11256465 Ga0307414_112564652 127
76 3300046525 Ga0495663_0055145 Ga0495663_0055145_762_1172 127
77 3300046528 Ga0495642_0206167 Ga0495642_0206167_99_509 127
78 3300046664 Ga0495659_0076999 Ga0495659_0076999_591_1001 127
79 3300046684 Ga0495669_0163973 Ga0495669_0163973_396_806 127
80 3300049568 Ga0501031_0359341 Ga0501031_0359341_364_762 127
81 3300049573 Ga0501037_0131977 Ga0501037_0131977_135_533 127
82 3300049581 Ga0501047_0121516 Ga0501047_0121516_630_1028 127
83 3300049822 Ga0501035_0061150 Ga0501035_0061150_2204_2602 127
84 3300049823 Ga0501044_0312575 Ga0501044_0312575_1082_1480 127
85 3300006844 Ga0075428_100168096 Ga0075428_1001680962 128
86 3300006871 Ga0075434_100821916 Ga0075434_1008219162 128
87 3300013307 Ga0157372_12666044 Ga0157372_126660441 128
88 3300031731 Ga0307405_10232327 Ga0307405_102323272 128
89 3300031824 Ga0307413_10034808 Ga0307413_100348082 128
90 3300031995 Ga0307409_101567972 Ga0307409_1015679722 128
91 3300032004 Ga0307414_10627898 Ga0307414_106278982 128
92 3300049742 Ga0501080_0438678 Ga0501080_0438678_379_780 128
93 iso_pu_bacteria 2643221560 2643820748 128
94 iso_pu_bacteria 2643221563 2643833102 128
95 iso_pu_bacteria 2643221608 2644053103 128
96 iso_pu_bacteria 2830075706 2830077295 128
97 iso_pu_bacteria 2852653556 2852654144 128
98 iso_pu_bacteria 2852680915 2852684172 128
99 3300005458 Ga0070681_10258148 Ga0070681_102581482 129
100 3300013100 Ga0157373_10196734 Ga0157373_101967342 129
101 3300025912 Ga0207707_10427318 Ga0207707_104273182 129
102 3300025932 Ga0207690_10092220 Ga0207690_100922203 129
103 3300030735 Ga0316178_1138680 Ga0316178_11386803 129
104 3300030742 Ga0316183_1076830 Ga0316183_10768302 129
105 3300031548 Ga0307408_100023154 Ga0307408_1000231542 129
106 3300031548 Ga0307408_100078429 Ga0307408_1000784292 129
107 3300031731 Ga0307405_10284668 Ga0307405_102846682 129
108 3300031824 Ga0307413_10028034 Ga0307413_100280344 129
109 3300031824 Ga0307413_10077324 Ga0307413_100773243 129
110 3300031824 Ga0307413_10086947 Ga0307413_100869474 129
111 3300031852 Ga0307410_10148677 Ga0307410_101486773 129
112 3300031852 Ga0307410_10214384 Ga0307410_102143842 129
113 3300031901 Ga0307406_10192384 Ga0307406_101923842 129
114 3300031903 Ga0307407_10091445 Ga0307407_100914452 129
115 3300031903 Ga0307407_10708406 Ga0307407_107084062 129
116 3300031911 Ga0307412_10077752 Ga0307412_100777523 129
117 3300031911 Ga0307412_10172231 Ga0307412_101722312 129
118 3300032002 Ga0307416_100038296 Ga0307416_1000382964 129
119 3300032002 Ga0307416_100160378 Ga0307416_1001603783 129
120 3300032004 Ga0307414_10006350 Ga0307414_100063503 129
121 3300032004 Ga0307414_10290037 Ga0307414_102900373 129
122 3300032126 Ga0307415_100029716 Ga0307415_1000297164 129
123 3300005331 Ga0070670_100420022 Ga0070670_1004200222 130
124 3300005844 Ga0068862_100132358 Ga0068862_1001323582 130
125 3300009553 Ga0105249_11075021 Ga0105249_110750212 130
126 3300014326 Ga0157380_10238386 Ga0157380_102383862 130
127 3300025925 Ga0207650_10460992 Ga0207650_104609922 130
128 3300028380 Ga0268265_10110718 Ga0268265_101107182 130
129 3300031911 Ga0307412_10096030 Ga0307412_100960303 130
130 3300032002 Ga0307416_100839867 Ga0307416_1008398672 130
131 3300032126 Ga0307415_100077298 Ga0307415_1000772983 130
132 3300049660 Ga0501216_028621 Ga0501216_028621_276_722 131
133 3300003781 Ga0055536_1001049 Ga0055536_100104916 132
134 3300003781 Ga0055536_1002000 Ga0055536_10020005 132
135 3300003781 Ga0055536_1003619 Ga0055536_100361910 132
136 3300003784 Ga0055534_1005318 Ga0055534_10053186 132
137 3300003791 Ga0055530_10000012 Ga0055530_1000001215 132
138 3300003791 Ga0055530_10074593 Ga0055530_100745932 132
139 3300003794 Ga0055531_10003131 Ga0055531_100031318 132
140 3300003794 Ga0055531_10018563 Ga0055531_100185635 132
141 3300025263 Ga0209565_1038036 Ga0209565_10380362 132
142 3300025291 Ga0209675_1000272 Ga0209675_10002727 132
143 3300025292 Ga0209676_1000359 Ga0209676_100035917 132
144 3300025292 Ga0209676_1000449 Ga0209676_100044969 132
145 3300025292 Ga0209676_1001894 Ga0209676_100189418 132
146 3300025292 Ga0209676_1111196 Ga0209676_11111961 132
147 3300025294 Ga0209025_1014498 Ga0209025_10144986 132
148 3300025294 Ga0209025_1099728 Ga0209025_10997282 132
149 3300025297 Ga0209758_1161944 Ga0209758_11619442 132
150 3300025298 Ga0209050_1000067 Ga0209050_1000067237 132
151 3300025298 Ga0209050_1016677 Ga0209050_10166773 132
152 3300025304 Ga0209257_1000113 Ga0209257_1000113202 132
153 3300025304 Ga0209257_1000699 Ga0209257_100069946 132
154 3300025304 Ga0209257_1006597 Ga0209257_10065974 132
155 3300031824 Ga0307413_10316643 Ga0307413_103166432 132
156 3300031901 Ga0307406_10075018 Ga0307406_100750183 132
157 3300031911 Ga0307412_10072180 Ga0307412_100721803 132
158 3300031911 Ga0307412_10110602 Ga0307412_101106023 132
159 3300031911 Ga0307412_10770585 Ga0307412_107705852 132
160 3300032004 Ga0307414_10000107 Ga0307414_1000010741 132
161 3300032004 Ga0307414_10017740 Ga0307414_100177405 132
162 3300032004 Ga0307414_10125817 Ga0307414_101258173 132
163 3300032004 Ga0307414_10475608 Ga0307414_104756082 132
164 3300041509 Ga0451843_1759913 Ga0451843_1759913_142_540 132
165 3300046512 Ga0495610_0131304 Ga0495610_0131304_450_851 132
166 3300046522 Ga0495643_0129135 Ga0495643_0129135_480_881 132
167 3300046525 Ga0495663_0071387 Ga0495663_0071387_22_423 132
168 3300046530 Ga0495654_0099636 Ga0495654_0099636_14_415 132
169 3300046616 Ga0495668_0000002 Ga0495668_0000002_672247_672648 132
170 3300046660 Ga0495625_0000430 Ga0495625_0000430_36772_37173 132
171 3300046660 Ga0495625_0205779 Ga0495625_0205779_204_605 132
172 3300047470 Ga0495681_0171084 Ga0495681_0171084_92_493 132
173 3300048929 Ga0496126_0209234 Ga0496126_0209234_433_834 132
174 3300049572 Ga0501036_0536410 Ga0501036_0536410_80_481 132
175 3300049574 Ga0501038_0464864 Ga0501038_0464864_376_777 132
176 3300049575 Ga0501039_0051948 Ga0501039_0051948_1477_1878 132
177 3300049576 Ga0501040_0493464 Ga0501040_0493464_174_575 132
178 3300049577 Ga0501041_0376655 Ga0501041_0376655_114_515 132
179 3300049587 Ga0501071_0381884 Ga0501071_0381884_472_873 132
180 3300049588 Ga0501072_0261505 Ga0501072_0261505_20_421 132
181 3300049589 Ga0501073_0081445 Ga0501073_0081445_1115_1516 132
182 3300049590 Ga0501074_0061192 Ga0501074_0061192_307_708 132
183 3300049591 Ga0501075_0062335 Ga0501075_0062335_1663_2064 132
184 3300049592 Ga0501076_0340137 Ga0501076_0340137_547_948 132
185 3300049593 Ga0501077_0112139 Ga0501077_0112139_1077_1478 132
186 3300049741 Ga0501079_0080862 Ga0501079_0080862_275_676 132
187 3300049741 Ga0501079_0347204 Ga0501079_0347204_111_512 132
188 3300049743 Ga0501081_0067888 Ga0501081_0067888_1854_2255 132
189 3300049743 Ga0501081_0246067 Ga0501081_0246067_409_810 132
190 3300049824 Ga0501045_0209309 Ga0501045_0209309_793_1194 132
191 3300053116 Ga0500592_021574 Ga0500592_021574_341_742 132
192 3300053134 Ga0500658_0057822 Ga0500658_0057822_779_1180 132
193 3300053139 Ga0500568_0004814 Ga0500568_0004814_2100_2501 132
194 3300053158 Ga0500627_0000058 Ga0500627_0000058_27517_27918 132
195 3300053158 Ga0500627_0173861 Ga0500627_0173861_76_477 132
196 3300060353 Ga0501082_0011753 Ga0501082_0011753_5316_5717 132
197 3300060353 Ga0501082_1042166 Ga0501082_1042166_263_664 132
198 3300060353 Ga0501082_1574097 Ga0501082_1574097_146_547 132
199 3300005539 Ga0068853_100603417 Ga0068853_1006034172 133
200 3300009098 Ga0105245_10302192 Ga0105245_103021921 133
201 3300026041 Ga0207639_10151416 Ga0207639_101514162 133
202 3300031852 Ga0307410_10934860 Ga0307410_109348601 133
203 3300031911 Ga0307412_10103984 Ga0307412_101039842 133
204 3300032004 Ga0307414_11312345 Ga0307414_113123451 133
205 3300005347 Ga0070668_100075371 Ga0070668_1000753712 134
206 3300005564 Ga0070664_100761480 Ga0070664_1007614802 134
207 3300005618 Ga0068864_100451618 Ga0068864_1004516182 134
208 3300026095 Ga0207676_10162406 Ga0207676_101624063 134
209 3300031548 Ga0307408_100175611 Ga0307408_1001756113 134
210 3300031824 Ga0307413_10407229 Ga0307413_104072292 134
211 3300031903 Ga0307407_10206499 Ga0307407_102064992 134
212 3300031911 Ga0307412_10893503 Ga0307412_108935032 134
213 3300031911 Ga0307412_11926134 Ga0307412_119261342 134
214 3300031995 Ga0307409_100196298 Ga0307409_1001962982 134
215 3300031995 Ga0307409_100397506 Ga0307409_1003975063 134
216 3300032002 Ga0307416_100375032 Ga0307416_1003750323 134
217 3300032002 Ga0307416_101274457 Ga0307416_1012744571 134
218 3300032002 Ga0307416_101552991 Ga0307416_1015529912 134
219 3300032004 Ga0307414_10109931 Ga0307414_101099313 134
220 3300032004 Ga0307414_10127968 Ga0307414_101279682 134
221 3300032005 Ga0307411_10291545 Ga0307411_102915452 134
222 3300032005 Ga0307411_10595570 Ga0307411_105955702 134
223 3300037471 Ga0395905_0806522 Ga0395905_0806522_193_600 134
224 3300041408 Ga0439453_0008955 Ga0439453_0008955_586_993 134
225 3300041997 Ga0439431_0195919 Ga0439431_0195919_13_420 134
226 3300042004 Ga0439445_0000134 Ga0439445_0000134_12390_12797 134
227 3300046537 Ga0495598_0013526 Ga0495598_0013526_778_1185 134
228 3300046539 Ga0495621_0007430 Ga0495621_0007430_939_1346 134
229 3300005293 Ga0065715_10294806 Ga0065715_102948062 135
230 3300005843 Ga0068860_100110957 Ga0068860_1001109573 135
231 3300006880 Ga0075429_100954492 Ga0075429_1009544921 135
232 3300009174 Ga0105241_10809580 Ga0105241_108095802 135
233 3300009553 Ga0105249_10119278 Ga0105249_101192782 135
234 3300013102 Ga0157371_10313543 Ga0157371_103135432 135
235 3300013307 Ga0157372_11488562 Ga0157372_114885622 135
236 3300025933 Ga0207706_10912574 Ga0207706_109125742 135
237 3300025961 Ga0207712_10184042 Ga0207712_101840422 135
238 3300025972 Ga0207668_10838941 Ga0207668_108389411 135
239 3300026041 Ga0207639_11384780 Ga0207639_113847801 135
240 3300031731 Ga0307405_10214352 Ga0307405_102143522 135
241 3300031824 Ga0307413_10003428 Ga0307413_100034287 135
242 3300031824 Ga0307413_10084062 Ga0307413_100840623 135
243 3300031852 Ga0307410_10009981 Ga0307410_100099816 135
244 3300031903 Ga0307407_10014822 Ga0307407_100148222 135
245 3300032004 Ga0307414_10014099 Ga0307414_100140994 135
246 3300032004 Ga0307414_10474247 Ga0307414_104742472 135
247 3300032005 Ga0307411_10021085 Ga0307411_100210854 135
248 3300032005 Ga0307411_10403619 Ga0307411_104036192 135
249 3300032005 Ga0307411_11027392 Ga0307411_110273922 135
250 3300042439 Ga0439464_0025634 Ga0439464_0025634_170_580 135
251 3300050508 nmdc:mga09592_1275053_c1 nmdc:mga09592_1275053_c1_47_457 135
252 3300001977 JGI24746J21847_1006241 JGI24746J21847_10062414 136
253 3300002070 JGI24750J21931_1016139 JGI24750J21931_10161391 136
254 3300002459 JGI24751J29686_10090420 JGI24751J29686_100904202 136
255 3300005293 Ga0065715_10120205 Ga0065715_101202054 136
256 3300005293 Ga0065715_10594448 Ga0065715_105944482 136
257 3300005293 Ga0065715_11136661 Ga0065715_111366611 136
258 3300005328 Ga0070676_10010220 Ga0070676_100102206 136
259 3300005331 Ga0070670_100069933 Ga0070670_1000699332 136
260 3300005331 Ga0070670_100565271 Ga0070670_1005652712 136
261 3300005331 Ga0070670_100975047 Ga0070670_1009750471 136
262 3300005333 Ga0070677_10003172 Ga0070677_100031727 136
263 3300005335 Ga0070666_10465520 Ga0070666_104655202 136
264 3300005335 Ga0070666_10511680 Ga0070666_105116802 136
265 3300005347 Ga0070668_100068726 Ga0070668_1000687262 136
266 3300005347 Ga0070668_100254684 Ga0070668_1002546842 136
267 3300005347 Ga0070668_101770964 Ga0070668_1017709641 136
268 3300005353 Ga0070669_100020178 Ga0070669_1000201787 136
269 3300005354 Ga0070675_100024934 Ga0070675_1000249346 136
270 3300005354 Ga0070675_101061307 Ga0070675_1010613072 136
271 3300005355 Ga0070671_100207194 Ga0070671_1002071943 136
272 3300005355 Ga0070671_100228435 Ga0070671_1002284353 136
273 3300005356 Ga0070674_100003218 Ga0070674_1000032189 136
274 3300005364 Ga0070673_100020586 Ga0070673_1000205862 136
275 3300005367 Ga0070667_100263730 Ga0070667_1002637302 136
276 3300005367 Ga0070667_100871434 Ga0070667_1008714342 136
277 3300005455 Ga0070663_100208210 Ga0070663_1002082102 136
278 3300005455 Ga0070663_100275667 Ga0070663_1002756673 136
279 3300005456 Ga0070678_100021074 Ga0070678_1000210748 136
280 3300005457 Ga0070662_100016921 Ga0070662_1000169212 136
281 3300005457 Ga0070662_100144277 Ga0070662_1001442772 136
282 3300005457 Ga0070662_101308274 Ga0070662_1013082741 136
283 3300005459 Ga0068867_100042621 Ga0068867_1000426213 136
284 3300005539 Ga0068853_100038308 Ga0068853_1000383082 136
285 3300005543 Ga0070672_100012476 Ga0070672_1000124767 136
286 3300005543 Ga0070672_100013583 Ga0070672_1000135833 136
287 3300005544 Ga0070686_100965745 Ga0070686_1009657451 136
288 3300005544 Ga0070686_101876371 Ga0070686_1018763711 136
289 3300005577 Ga0068857_100385050 Ga0068857_1003850503 136
290 3300005578 Ga0068854_100167662 Ga0068854_1001676623 136
291 3300005616 Ga0068852_100361432 Ga0068852_1003614323 136
292 3300005617 Ga0068859_100021937 Ga0068859_1000219372 136
293 3300005618 Ga0068864_100731129 Ga0068864_1007311292 136
294 3300005719 Ga0068861_100031129 Ga0068861_1000311292 136
295 3300005841 Ga0068863_100256739 Ga0068863_1002567392 136
296 3300005843 Ga0068860_101542011 Ga0068860_1015420112 136
297 3300005844 Ga0068862_100088341 Ga0068862_1000883413 136
298 3300005844 Ga0068862_100372833 Ga0068862_1003728332 136
299 3300005844 Ga0068862_101004490 Ga0068862_1010044902 136
300 3300006237 Ga0097621_100314345 Ga0097621_1003143452 136
301 3300006237 Ga0097621_100871731 Ga0097621_1008717312 136
302 3300006358 Ga0068871_100022513 Ga0068871_1000225133 136
303 3300006931 Ga0097620_100021935 Ga0097620_1000219352 136
304 3300009092 Ga0105250_10168585 Ga0105250_101685851 136
305 3300009094 Ga0111539_10033494 Ga0111539_100334943 136
306 3300009177 Ga0105248_10048125 Ga0105248_100481257 136
307 3300009177 Ga0105248_10258765 Ga0105248_102587653 136
308 3300009553 Ga0105249_10019669 Ga0105249_100196692 136
309 3300013100 Ga0157373_11211056 Ga0157373_112110562 136
310 3300013102 Ga0157371_10053524 Ga0157371_100535244 136
311 3300013105 Ga0157369_10582603 Ga0157369_105826032 136
312 3300013306 Ga0163162_10184532 Ga0163162_101845323 136
313 3300013308 Ga0157375_10062446 Ga0157375_100624467 136
314 3300014326 Ga0157380_10007020 Ga0157380_100070208 136
315 3300017792 Ga0163161_10017454 Ga0163161_100174547 136
316 3300025315 Ga0207697_10005895 Ga0207697_100058953 136
317 3300025315 Ga0207697_10048364 Ga0207697_100483643 136
318 3300025893 Ga0207682_10005356 Ga0207682_100053567 136
319 3300025901 Ga0207688_11035998 Ga0207688_110359982 136
320 3300025907 Ga0207645_10013319 Ga0207645_100133197 136
321 3300025908 Ga0207643_10585746 Ga0207643_105857462 136
322 3300025923 Ga0207681_10009365 Ga0207681_100093657 136
323 3300025925 Ga0207650_10129489 Ga0207650_101294892 136
324 3300025926 Ga0207659_10011223 Ga0207659_100112233 136
325 3300025931 Ga0207644_10156829 Ga0207644_101568292 136
326 3300025931 Ga0207644_10223524 Ga0207644_102235243 136
327 3300025933 Ga0207706_10002358 Ga0207706_1000235820 136
328 3300025933 Ga0207706_10180058 Ga0207706_101800583 136
329 3300025935 Ga0207709_10094263 Ga0207709_100942632 136
330 3300025937 Ga0207669_10007521 Ga0207669_100075217 136
331 3300025940 Ga0207691_10003298 Ga0207691_1000329820 136
332 3300025940 Ga0207691_10128229 Ga0207691_101282292 136
333 3300025941 Ga0207711_10198678 Ga0207711_101986782 136
334 3300025945 Ga0207679_10183869 Ga0207679_101838693 136
335 3300025960 Ga0207651_10499573 Ga0207651_104995732 136
336 3300025961 Ga0207712_10030587 Ga0207712_100305876 136
337 3300025972 Ga0207668_10186024 Ga0207668_101860242 136
338 3300025972 Ga0207668_10828623 Ga0207668_108286232 136
339 3300025981 Ga0207640_10541978 Ga0207640_105419782 136
340 3300025986 Ga0207658_10070382 Ga0207658_100703823 136
341 3300026041 Ga0207639_10047147 Ga0207639_100471472 136
342 3300026067 Ga0207678_10212974 Ga0207678_102129742 136
343 3300026067 Ga0207678_10257248 Ga0207678_102572482 136
344 3300026088 Ga0207641_10294048 Ga0207641_102940483 136
345 3300026089 Ga0207648_10390380 Ga0207648_103903801 136
346 3300026095 Ga0207676_10346682 Ga0207676_103466821 136
347 3300026095 Ga0207676_10621104 Ga0207676_106211042 136
348 3300026118 Ga0207675_100035624 Ga0207675_1000356242 136
349 3300026121 Ga0207683_10019674 Ga0207683_100196747 136
350 3300027876 Ga0209974_10018759 Ga0209974_100187593 136
351 3300027907 Ga0207428_10276174 Ga0207428_102761742 136
352 3300028380 Ga0268265_10136640 Ga0268265_101366404 136
353 3300028380 Ga0268265_10203291 Ga0268265_102032912 136
354 3300028380 Ga0268265_10219541 Ga0268265_102195414 136
355 3300028381 Ga0268264_11286895 Ga0268264_112868952 136
356 3300031548 Ga0307408_100011817 Ga0307408_1000118177 136
357 3300031548 Ga0307408_100051418 Ga0307408_1000514183 136
358 3300031548 Ga0307408_100425999 Ga0307408_1004259993 136
359 3300031731 Ga0307405_10006380 Ga0307405_100063804 136
360 3300031731 Ga0307405_10032550 Ga0307405_100325504 136
361 3300031731 Ga0307405_10136718 Ga0307405_101367182 136
362 3300031731 Ga0307405_10172487 Ga0307405_101724872 136
363 3300031731 Ga0307405_11005797 Ga0307405_110057972 136
364 3300031824 Ga0307413_10028621 Ga0307413_100286214 136
365 3300031824 Ga0307413_10046265 Ga0307413_100462652 136
366 3300031824 Ga0307413_10143215 Ga0307413_101432153 136
367 3300031824 Ga0307413_10360318 Ga0307413_103603181 136
368 3300031824 Ga0307413_11553751 Ga0307413_115537511 136
369 3300031852 Ga0307410_10082967 Ga0307410_100829672 136
370 3300031852 Ga0307410_10088606 Ga0307410_100886062 136
371 3300031852 Ga0307410_10170962 Ga0307410_101709622 136
372 3300031852 Ga0307410_11062674 Ga0307410_110626741 136
373 3300031901 Ga0307406_10014534 Ga0307406_100145344 136
374 3300031901 Ga0307406_10029531 Ga0307406_100295312 136
375 3300031901 Ga0307406_10114197 Ga0307406_101141972 136
376 3300031901 Ga0307406_10683352 Ga0307406_106833522 136
377 3300031903 Ga0307407_10002741 Ga0307407_100027416 136
378 3300031903 Ga0307407_10023005 Ga0307407_100230054 136
379 3300031903 Ga0307407_10051459 Ga0307407_100514593 136
380 3300031903 Ga0307407_10625469 Ga0307407_106254691 136
381 3300031911 Ga0307412_10027029 Ga0307412_100270292 136
382 3300031911 Ga0307412_10044408 Ga0307412_100444084 136
383 3300031995 Ga0307409_100005458 Ga0307409_1000054584 136
384 3300031995 Ga0307409_100074429 Ga0307409_1000744294 136
385 3300031995 Ga0307409_100095117 Ga0307409_1000951174 136
386 3300031995 Ga0307409_100135554 Ga0307409_1001355543 136
387 3300031995 Ga0307409_100217388 Ga0307409_1002173882 136
388 3300031995 Ga0307409_100232454 Ga0307409_1002324542 136
389 3300032002 Ga0307416_100085769 Ga0307416_1000857694 136
390 3300032002 Ga0307416_100087216 Ga0307416_1000872164 136
391 3300032002 Ga0307416_100111780 Ga0307416_1001117804 136
392 3300032002 Ga0307416_100186277 Ga0307416_1001862772 136
393 3300032002 Ga0307416_101321546 Ga0307416_1013215462 136
394 3300032004 Ga0307414_10023198 Ga0307414_100231984 136
395 3300032004 Ga0307414_10026398 Ga0307414_100263984 136
396 3300032004 Ga0307414_10123943 Ga0307414_101239433 136
397 3300032004 Ga0307414_10771059 Ga0307414_107710592 136
398 3300032005 Ga0307411_10011769 Ga0307411_100117697 136
399 3300032005 Ga0307411_10013955 Ga0307411_100139554 136
400 3300032005 Ga0307411_10071054 Ga0307411_100710543 136
401 3300032126 Ga0307415_100215376 Ga0307415_1002153763 136
402 3300032126 Ga0307415_100281704 Ga0307415_1002817043 136
403 3300032126 Ga0307415_100298215 Ga0307415_1002982152 136
404 3300032126 Ga0307415_100320663 Ga0307415_1003206633 136
405 3300037312 Ga0395899_0238965 Ga0395899_0238965_635_1045 136
406 3300037418 Ga0395900_0009343 Ga0395900_0009343_9562_9972 136
407 3300037466 Ga0395898_0084019 Ga0395898_0084019_1356_1766 136
408 3300037471 Ga0395905_0000412 Ga0395905_0000412_49846_50256 136
409 3300038443 Ga0395901_0005879 Ga0395901_0005879_1411_1821 136
410 3300044683 Ga0466965_0094173 Ga0466965_0094173_170_580 136
411 3300044765 Ga0466970_0228358 Ga0466970_0228358_40_450 136
412 3300046528 Ga0495642_0131791 Ga0495642_0131791_238_648 136
413 3300046539 Ga0495621_0000680 Ga0495621_0000680_1047_1457 136
414 3300046539 Ga0495621_0048888 Ga0495621_0048888_421_831 136
415 3300046558 Ga0495633_0208877 Ga0495633_0208877_240_650 136
416 3300046674 Ga0495588_0578838 Ga0495588_0578838_33_443 136
417 3300046684 Ga0495669_0020805 Ga0495669_0020805_384_794 136
418 3300046691 Ga0495670_0043120 Ga0495670_0043120_1141_1551 136
419 3300047445 Ga0495677_0083365 Ga0495677_0083365_462_872 136
420 3300048906 Ga0496103_0474645 Ga0496103_0474645_346_762 136
421 3300048910 Ga0496107_0124349 Ga0496107_0124349_1019_1429 136
422 3300048911 Ga0496108_0118743 Ga0496108_0118743_547_957 136
423 3300048912 Ga0496109_0124057 Ga0496109_0124057_794_1204 136
424 3300048913 Ga0496110_0046506 Ga0496110_0046506_2587_2997 136
425 3300048917 Ga0496114_0084772 Ga0496114_0084772_1382_1792 136
426 3300048918 Ga0496115_0446009 Ga0496115_0446009_16_426 136
427 3300049653 Ga0501206_033877 Ga0501206_033877_289_717 136
428 3300049656 Ga0501209_270845 Ga0501209_270845_52_480 136
429 3300049659 Ga0501214_009638 Ga0501214_009638_182_610 136
430 3300049661 Ga0501217_089499 Ga0501217_089499_29_457 136
431 3300049669 Ga0501235_012085 Ga0501235_012085_1435_1863 136
432 3300049687 Ga0501258_003068 Ga0501258_003068_400_810 136
433 3300049704 Ga0501221_008385 Ga0501221_008385_198_626 136
434 3300049705 Ga0501225_0117906 Ga0501225_0117906_149_559 136
435 3300049765 Ga0501268_012550 Ga0501268_012550_157_585 136
436 3300049767 Ga0501270_005536 Ga0501270_005536_224_652 136
437 3300049850 Ga0501204_022671 Ga0501204_022671_97_525 136
438 3300050511 nmdc:mga08y16_138723_c1 nmdc:mga08y16_138723_c1_1194_1604 136
439 iso_pu_bacteria 2896429255 2896431144 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00472

RF-1

RF-1 domain

8

140

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3j7y-assembly1.cif.gz_p structure of the large ribosomal subunit from human mitochondria 0.8467 7 98
3j7y-assembly1.cif.gz_p structure of the large ribosomal subunit from human mitochondria 0.8374 7 98
7oi6-assembly1.cif.gz_p cryo-em structure of late human 39s mitoribosome assembly intermediates, state 1 0.8238 6 98
7jt1-assembly1.cif.gz_9 70s ribosome stalled on long mrna with arfb-1 and arfb-2 bound (+9-iii) 0.7947 45 96
1j26-assembly1.cif.gz_A solution structure of a putative peptidyl-trna hydrolase domain in a mouse hypothetical protein 0.7887 8 99
ID Description Score Start End Superfamily
af_A0A0R0GKX2_1_61_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9039 38 95 3.30.160.20
af_A0A0R0GKX2_1_61_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8512 38 95 3.30.160.20
3j7yp00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8467 7 98 3.30.160.20
3j7yp00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8374 7 98 3.30.160.20
1j26A01 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7937 14 96 3.30.160.20
ID Description Score Start End GO Terms
AF-A0A3L7PRW9-F1-model_v4 Aminoacyl-tRNA hydrolase 0.8876 8 96 GO:0004045
GO:0016150
AF-A0A352HBL5-F1-model_v4 deleted 0.8813 11 96
AF-A0A2E7U4D1-F1-model_v4 deleted 0.8793 7 98
AF-A0A357ZK82-F1-model_v4 Aminoacyl-tRNA hydrolase 0.8736 8 96 GO:0003747
GO:0004045
GO:0043022
GO:0072344
AF-A0A149U9B0-F1-model_v4 deleted 0.8729 6 107

Feature Viewer

pLDDT pTM Quality
86.2 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map