F444126

General Info

Members Datasets Scaffolds Average Seq Length
439 207 417 256

Family's Representative Sequence

Representative Sequence 3300003762|Ga0055542_1000105|Ga0055542_10001058
Length 273
Sequence VPRFCARGWCCMNALHIQVEGIGLWSPQCADLDAFRRHLAGETASTSHARPNASALSANERRRAPESVLVAVEAASQAIAASGRGTDNLACVFTSAYGDQATTDYMCRVLAHAPTELSPTRFHNAVHNASAGYWTIATGCRAPSSAICAGRASFGAGLLEAAALACADDRAVLLVNSDTAGTGPLGELIGCTRVFGCALVLSPCTTTGMRLRLATTASSPRHSPMSAECQAWMQANPAAESLPLLIMLATGRGDCVLAVSEHLGLHVEMETNA

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
3 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
4 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
5 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
6 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
7 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
8 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
9 2734482264 Dyella sp. AD052 Isolate Unclassified
10 2738543009 Luteibacter sp. OK325 Isolate Unclassified
11 2739367700 Dyella sp. YR388 Isolate Unclassified
12 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
13 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
14 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
15 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
16 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
17 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
18 2919085039 Luteibacter sp. 1214 Isolate Unclassified
19 2919404418 Luteibacter sp. 3190 Isolate Unclassified
20 2928963466 Dyella japonica 1073 Isolate Unclassified
21 2941471342 Luteibacter sp. 621 Isolate Unclassified
22 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
23 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
24 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
25 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
26 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
27 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
28 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
29 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
30 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
31 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
32 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
33 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
34 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
35 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
36 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
37 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
38 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
39 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
40 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
75 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
76 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
91 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
125 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
126 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
127 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
128 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
129 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
130 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
131 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
135 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
136 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
145 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
146 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
147 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
150 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
151 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
152 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
153 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
154 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
157 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
158 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
159 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
162 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
167 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
168 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
169 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
170 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
180 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
181 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
191 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
205 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
206 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
207 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.31
Metatranscriptomes 0.68
Isolates 5.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.63
Nodule 0
Rhizoplane 2.96
Rhizosphere 61.73
Stem 0
Stem Tuber 0
Unclassified 18.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10001016 3300001989 Bacteria 10410
2 JGI24739J22299_10013061 3300001989 Bacteria 3038
3 JGI24735J21928_10001123 3300002067 Bacteria 9576
4 JGI24738J21930_10000769 3300002075 Bacteria 9191
5 JGI25156J39149_1000480 3300002705 Bacteria 24063
6 JGI25156J39149_1005245 3300002705 Bacteria 3789
7 JGI25162J39368_1000701 3300002737 Bacteria 23270
8 JGI25162J39368_1000906 3300002737 Bacteria 19185
9 JGI25157J39369_1000525 3300002741 Bacteria 23385
10 JGI25157J39369_1000943 3300002741 Bacteria 13711
11 JGI25157J39369_1002387 3300002741 Bacteria 4764
12 JGI25164J39214_1000112 3300002772 Bacteria 78116
13 JGI25164J39214_1000657 3300002772 Bacteria 14152
14 JGI25165J46597_1000229 3300003214 Bacteria 78116
15 JGI25165J46597_1000865 3300003214 Bacteria 21690
16 rootH1_10047629 3300003316 Bacteria 4590
17 rootH2_10044123 3300003320 Bacteria 20323
18 rootL2_10086489 3300003322 Bacteria 2597
19 Ga0006562J51391_1015751 3300003578 Bacteria 17060
20 Ga0006562J51391_1032265 3300003578 Bacteria 10720
21 Ga0055533_1000695 3300003756 Bacteria 11025
22 Ga0055525_1000082 3300003759 Bacteria 159396
23 Ga0055527_1000072 3300003760 Bacteria 83753
24 Ga0055527_1000080 3300003760 Bacteria 78211
25 Ga0055535_1000162 3300003761 Bacteria 71868
26 Ga0055535_1000189 3300003761 Bacteria 65570
27 Ga0055535_1000611 3300003761 Bacteria 29412
28 Ga0055535_1001129 3300003761 Bacteria 15988
29 Ga0055542_1000105 3300003762 Bacteria 113278
30 Ga0055542_1000163 3300003762 Bacteria 83753
31 Ga0055542_1000181 3300003762 Bacteria 78147
32 Ga0055542_1000188 3300003762 Bacteria 75366
33 Ga0055542_1000254 3300003762 Bacteria 60473
34 Ga0055529_1000205 3300003763 Bacteria 78219
35 Ga0055529_1000209 3300003763 Bacteria 77662
36 Ga0055529_1000336 3300003763 Bacteria 52511
37 Ga0055529_1004509 3300003763 Bacteria 2107
38 Ga0065165_1000204 3300005262 Bacteria 102828
39 Ga0065165_1003599 3300005262 Bacteria 10656
40 Ga0070670_100118414 3300005331 Bacteria 2284
41 Ga0070682_100030337 3300005337 Bacteria 3263
42 Ga0070682_100040535 3300005337 Bacteria 2866
43 Ga0070682_100048208 3300005337 Bacteria 2652
44 Ga0070660_100034454 3300005339 Bacteria 3826
45 Ga0070689_100015269 3300005340 Bacteria 5597
46 Ga0070661_100009643 3300005344 Bacteria 6692
47 Ga0070661_100060669 3300005344 Bacteria 2775
48 Ga0070659_100013371 3300005366 Bacteria 6107
49 Ga0070714_100064742 3300005435 Bacteria 3148
50 Ga0070711_100244789 3300005439 Bacteria 1404
51 Ga0070694_100291456 3300005444 Bacteria 1248
52 Ga0070663_100012618 3300005455 Bacteria 5355
53 Ga0070663_100015740 3300005455 Bacteria 4893
54 Ga0070663_100022836 3300005455 Bacteria 4186
55 Ga0070663_100419768 3300005455 Bacteria 1097
56 Ga0070681_10006507 3300005458 Bacteria 11370
57 Ga0070681_10059585 3300005458 Bacteria 3798
58 Ga0070685_10005610 3300005466 Bacteria 6365
59 Ga0068853_100028203 3300005539 Bacteria 4720
60 Ga0068855_100021370 3300005563 Bacteria 7761
61 Ga0068855_100079086 3300005563 Bacteria 3814
62 Ga0068857_100003150 3300005577 Bacteria 13665
63 Ga0068857_100138954 3300005577 Bacteria 2195
64 Ga0068854_100000995 3300005578 Bacteria 17056
65 Ga0068854_100031161 3300005578 Bacteria 3704
66 Ga0068856_100000132 3300005614 Bacteria 75819
67 Ga0068856_100015419 3300005614 Bacteria 7385
68 Ga0068852_100001289 3300005616 Bacteria 16736
69 Ga0068852_100009172 3300005616 Bacteria 7330
70 Ga0068852_100021418 3300005616 Bacteria 5162
71 Ga0068851_10001619 3300005834 Bacteria 9882
72 Ga0105240_10002735 3300009093 Bacteria 27967
73 Ga0105240_10002915 3300009093 Bacteria 26998
74 Ga0105240_10006605 3300009093 Bacteria 17024
75 Ga0105240_10007649 3300009093 Bacteria 15649
76 Ga0105240_10050891 3300009093 Bacteria 5218
77 Ga0105240_10310748 3300009093 Bacteria 1800
78 Ga0105247_10001176 3300009101 Bacteria 19464
79 Ga0105237_10000022 3300009545 Bacteria 228427
80 Ga0105237_10001731 3300009545 Bacteria 28209
81 Ga0105238_10052340 3300009551 Bacteria 4104
82 Ga0105238_10167708 3300009551 Bacteria 2172
83 Ga0105238_10293225 3300009551 Bacteria 1609
84 Ga0105239_10000192 3300010375 Bacteria 88793
85 Ga0105239_10007173 3300010375 Bacteria 12819
86 Ga0105239_10007665 3300010375 Bacteria 12364
87 Ga0157314_1000021 3300012500 Bacteria 15617
88 Ga0157371_10004926 3300013102 Bacteria 11474
89 Ga0157370_10001135 3300013104 Bacteria 33271
90 Ga0157370_10002691 3300013104 Bacteria 21303
91 Ga0157370_10002865 3300013104 Bacteria 20594
92 Ga0157370_10060951 3300013104 Bacteria 3581
93 Ga0157370_10378379 3300013104 Bacteria 1304
94 Ga0157369_10003238 3300013105 Bacteria 19409
95 Ga0157369_10046845 3300013105 Bacteria 4697
96 Ga0157378_10000052 3300013297 Bacteria 100769
97 Ga0182008_10001688 3300014497 Bacteria 14509
98 Ga0182008_10002133 3300014497 Bacteria 12610
99 Ga0182008_10023490 3300014497 Bacteria 3148
100 Ga0182008_10084781 3300014497 Bacteria 1560
101 Ga0182008_10147579 3300014497 Bacteria 1179
102 Ga0182006_1000065 3300015261 Bacteria 152292
103 Ga0182006_1007622 3300015261 Bacteria 4946
104 Ga0182006_1040061 3300015261 Bacteria 1845
105 Ga0182007_10004171 3300015262 Bacteria 6624
106 Ga0182007_10009490 3300015262 Bacteria 3918
107 Ga0182007_10050672 3300015262 Bacteria 1370
108 Ga0182007_10079636 3300015262 Bacteria 1074
109 Ga0182005_1000112 3300015265 Bacteria 58115
110 Ga0182005_1001350 3300015265 Bacteria 9986
111 Ga0182005_1013814 3300015265 Bacteria 2269
112 Ga0182005_1038435 3300015265 Bacteria 1301
113 Ga0183369_1004 3300015685 Bacteria 539301
114 Ga0183368_1002 3300015687 Bacteria 1865598
115 Ga0163161_10002008 3300017792 Bacteria 14718
116 Ga0163161_10102172 3300017792 Bacteria 2135
117 Ga0206354_10902515 3300020081 Bacteria 922
118 Ga0209566_103535 3300025225 Bacteria 2366
119 Ga0209674_100014 3300025226 Bacteria 704989
120 Ga0209674_100234 3300025226 Bacteria 48788
121 Ga0209674_100574 3300025226 Bacteria 14317
122 Ga0209672_100004 3300025228 Bacteria 1467504
123 Ga0209672_100008 3300025228 Bacteria 946876
124 Ga0209672_100089 3300025228 Bacteria 120658
125 Ga0209672_101624 3300025228 Bacteria 7453
126 Ga0209563_100097 3300025230 Bacteria 159453
127 Ga0207427_100051 3300025231 Bacteria 218792
128 Ga0207427_100240 3300025231 Bacteria 44187
129 Ga0207427_101957 3300025231 Bacteria 6310
130 Ga0209437_100152 3300025233 Bacteria 154551
131 Ga0209437_100279 3300025233 Bacteria 75208
132 Ga0209437_100529 3300025233 Bacteria 26489
133 Ga0209437_101294 3300025233 Bacteria 6737
134 Ga0209437_108342 3300025233 Bacteria 1660
135 Ga0209258_100003 3300025242 Bacteria 1467504
136 Ga0209258_100004 3300025242 Bacteria 1376422
137 Ga0209258_100008 3300025242 Bacteria 1009355
138 Ga0209258_100090 3300025242 Bacteria 232619
139 Ga0209258_100173 3300025242 Bacteria 144525
140 Ga0209258_100663 3300025242 Bacteria 24677
141 Ga0209258_102246 3300025242 Bacteria 5211
142 Ga0209646_1002725 3300025246 Bacteria 3765
143 Ga0209646_1006180 3300025246 Bacteria 2025
144 Ga0209026_1000064 3300025250 Bacteria 211303
145 Ga0209026_1000143 3300025250 Bacteria 113602
146 Ga0209026_1000445 3300025250 Bacteria 33284
147 Ga0209026_1000939 3300025250 Bacteria 14667
148 Ga0209026_1001638 3300025250 Bacteria 9523
149 Ga0209026_1012151 3300025250 Bacteria 1513
150 Ga0209677_101761 3300025253 Bacteria 8970
151 Ga0209148_1000002 3300025254 Bacteria 2399500
152 Ga0209148_1000016 3300025254 Bacteria 804369
153 Ga0209148_1000065 3300025254 Bacteria 344489
154 Ga0209148_1000079 3300025254 Bacteria 288992
155 Ga0209148_1000279 3300025254 Bacteria 79426
156 Ga0209148_1001321 3300025254 Bacteria 13172
157 Ga0209759_1000165 3300025256 Bacteria 113117
158 Ga0209759_1000762 3300025256 Bacteria 27542
159 Ga0209759_1004103 3300025256 Bacteria 5566
160 Ga0209759_1008643 3300025256 Bacteria 3156
161 Ga0209129_1000293 3300025258 Bacteria 47360
162 Ga0209233_1000099 3300025261 Bacteria 293995
163 Ga0209233_1000112 3300025261 Bacteria 258251
164 Ga0209233_1012302 3300025261 Bacteria 2486
165 Ga0209455_1000004 3300025272 Bacteria 1467504
166 Ga0209455_1000007 3300025272 Bacteria 1157983
167 Ga0209455_1000016 3300025272 Bacteria 753097
168 Ga0209455_1000333 3300025272 Bacteria 45288
169 Ga0209455_1008754 3300025272 Bacteria 2720
170 Ga0209455_1011238 3300025272 Bacteria 2218
171 Ga0209758_1000452 3300025297 Bacteria 68495
172 Ga0209758_1013978 3300025297 Bacteria 4317
173 Ga0209758_1014776 3300025297 Bacteria 4118
174 Ga0209051_1004124 3300025303 Bacteria 9098
175 Ga0207656_10002667 3300025321 Bacteria 6046
176 Ga0207692_10038498 3300025898 Bacteria 2346
177 Ga0207647_10000002 3300025904 Bacteria 400771
178 Ga0207647_10006054 3300025904 Bacteria 8818
179 Ga0207647_10011349 3300025904 Bacteria 6253
180 Ga0207707_10005170 3300025912 Bacteria 11434
181 Ga0207707_10011434 3300025912 Bacteria 7733
182 Ga0207695_10000291 3300025913 Bacteria 124555
183 Ga0207695_10000362 3300025913 Bacteria 104132
184 Ga0207695_10001147 3300025913 Bacteria 45960
185 Ga0207695_10012134 3300025913 Bacteria 10355
186 Ga0207695_10083977 3300025913 Bacteria 3216
187 Ga0207695_10201952 3300025913 Bacteria 1901
188 Ga0207671_10000009 3300025914 Bacteria 724862
189 Ga0207649_10111853 3300025920 Bacteria 1826
190 Ga0207649_10294072 3300025920 Bacteria 1185
191 Ga0207649_10529905 3300025920 Bacteria 899
192 Ga0207694_10536655 3300025924 Bacteria 981
193 Ga0207700_10055791 3300025928 Bacteria 2970
194 Ga0207664_10000509 3300025929 Bacteria 27685
195 Ga0207690_10002657 3300025932 Bacteria 10776
196 Ga0207690_10003120 3300025932 Bacteria 9979
197 Ga0207690_10020654 3300025932 Bacteria 4073
198 Ga0207706_10362309 3300025933 Bacteria 1259
199 Ga0207670_10009255 3300025936 Bacteria 5610
200 Ga0207667_10000262 3300025949 Bacteria 73170
201 Ga0207667_10000329 3300025949 Bacteria 65667
202 Ga0207667_10471794 3300025949 Bacteria 1274
203 Ga0207640_10000116 3300025981 Bacteria 60174
204 Ga0207640_10018054 3300025981 Bacteria 4140
205 Ga0207640_10109411 3300025981 Bacteria 1955
206 Ga0207639_10003448 3300026041 Bacteria 10642
207 Ga0207678_10008274 3300026067 Bacteria 9163
208 Ga0207678_10015791 3300026067 Bacteria 6638
209 Ga0207678_10018460 3300026067 Bacteria 6124
210 Ga0207678_10031125 3300026067 Bacteria 4656
211 Ga0207702_10000037 3300026078 Bacteria 153366
212 Ga0207702_10000960 3300026078 Bacteria 29644
213 Ga0207674_10002188 3300026116 Bacteria 24735
214 Ga0207674_10150461 3300026116 Bacteria 2285
215 Ga0207698_10004916 3300026142 Bacteria 8193
216 Ga0207698_10020738 3300026142 Bacteria 4530
217 Ga0207698_10026233 3300026142 Bacteria 4119
218 Ga0265332_10117755 3300031238 Bacteria 1116
219 Ga0307405_10065740 3300031731 Bacteria 2310
220 Ga0307412_10000714 3300031911 Bacteria 19169
221 Ga0395899_0000189 3300037312 Bacteria 90438
222 Ga0395899_0009297 3300037312 Bacteria 7547
223 Ga0395899_0017214 3300037312 Bacteria 5507
224 Ga0395899_0022542 3300037312 Bacteria 4772
225 Ga0395899_0144025 3300037312 Bacteria 1693
226 Ga0395900_0000011 3300037418 Bacteria 421926
227 Ga0395900_0004641 3300037418 Bacteria 14496
228 Ga0395900_0005136 3300037418 Bacteria 13749
229 Ga0395898_0000013 3300037466 Bacteria 458788
230 Ga0395898_0000058 3300037466 Bacteria 277701
231 Ga0395898_0012943 3300037466 Bacteria 8604
232 Ga0395898_0117403 3300037466 Bacteria 2549
233 Ga0395905_0453342 3300037471 Bacteria 1181
234 Ga0395901_0000201 3300038443 Bacteria 74798
235 Ga0395901_0000961 3300038443 Bacteria 31360
236 Ga0395901_0025934 3300038443 Bacteria 6018
237 Ga0395901_0067066 3300038443 Bacteria 3737
238 Ga0395901_0101837 3300038443 Bacteria 3013
239 Ga0395901_0135401 3300038443 Bacteria 2589
240 Ga0395901_0353405 3300038443 Bacteria 1516
241 Ga0439436_0000028 3300041404 Bacteria 51668
242 Ga0439436_0039500 3300041404 Bacteria 1355
243 Ga0439465_0000468 3300041413 Bacteria 11937
244 Ga0451795_1433423 3300041456 Bacteria 1255
245 Ga0450908_000073 3300042184 Bacteria 19907
246 Ga0466969_0027925 3300044656 Bacteria 2887
247 Ga0466975_0014627 3300044661 Bacteria 5080
248 Ga0466982_0000001 3300044672 Bacteria 514662
249 Ga0466965_0193112 3300044683 Bacteria 1077
250 Ga0466966_0001373 3300044684 Bacteria 15653
251 Ga0466966_0003183 3300044684 Bacteria 10801
252 Ga0466961_0000349 3300044693 Bacteria 30070
253 Ga0466961_0002690 3300044693 Bacteria 11033
254 Ga0466961_0007989 3300044693 Bacteria 6743
255 Ga0466961_0009916 3300044693 Bacteria 6069
256 Ga0466964_0008434 3300044706 Bacteria 3873
257 Ga0466971_0011258 3300044719 Bacteria 3918
258 Ga0466968_0000096 3300044735 Bacteria 26012
259 Ga0466968_0000863 3300044735 Bacteria 10622
260 Ga0466970_0002351 3300044765 Bacteria 9134
261 Ga0466957_0033153 3300044842 Bacteria 3097
262 Ga0466957_0106283 3300044842 Bacteria 1775
263 Ga0466957_0141487 3300044842 Bacteria 1550
264 Ga0466959_0000618 3300045049 Bacteria 20602
265 Ga0466959_0023980 3300045049 Bacteria 4517
266 Ga0466958_0000832 3300045836 Bacteria 13628
267 Ga0466958_0008412 3300045836 Bacteria 5722
268 Ga0466958_0015968 3300045836 Bacteria 4317
269 Ga0466967_0050823 3300045976 Bacteria 3631
270 Ga0495617_000605 3300046452 Bacteria 18145
271 Ga0495617_000926 3300046452 Bacteria 13659
272 Ga0495638_0000139 3300046460 Bacteria 114810
273 Ga0495638_0000389 3300046460 Bacteria 54061
274 Ga0495650_0001077 3300046471 Bacteria 30104
275 Ga0495650_0019469 3300046471 Bacteria 3339
276 Ga0495585_0000112 3300046492 Bacteria 87291
277 Ga0495585_0010140 3300046492 Bacteria 5627
278 Ga0495607_0000006 3300046501 Bacteria 281664
279 Ga0495607_0000131 3300046501 Bacteria 80259
280 Ga0495607_0002346 3300046501 Bacteria 15471
281 Ga0495607_0240148 3300046501 Bacteria 877
282 Ga0495583_0004839 3300046506 Bacteria 9421
283 Ga0495606_0000016 3300046507 Bacteria 284865
284 Ga0495606_0000248 3300046507 Bacteria 94934
285 Ga0495606_0000267 3300046507 Bacteria 92177
286 Ga0495606_0012900 3300046507 Bacteria 6650
287 Ga0495610_0002302 3300046512 Bacteria 16144
288 Ga0495610_0062524 3300046512 Bacteria 1765
289 Ga0495616_0000074 3300046513 Bacteria 84866
290 Ga0495620_0000929 3300046515 Bacteria 18005
291 Ga0495620_0003880 3300046515 Bacteria 8530
292 Ga0495631_0001190 3300046518 Bacteria 16053
293 Ga0495631_0001311 3300046518 Bacteria 15249
294 Ga0495632_0000279 3300046519 Bacteria 50089
295 Ga0495632_0005834 3300046519 Bacteria 8061
296 Ga0495632_0013377 3300046519 Bacteria 4685
297 Ga0495637_0002564 3300046520 Bacteria 9990
298 Ga0495648_0000820 3300046524 Bacteria 32800
299 Ga0495648_0004890 3300046524 Bacteria 11283
300 Ga0495609_0009368 3300046538 Bacteria 4741
301 Ga0495597_0008598 3300046542 Bacteria 5107
302 Ga0495622_0000731 3300046557 Bacteria 18602
303 Ga0495611_0000002 3300046648 Bacteria 705677
304 Ga0495611_0000051 3300046648 Bacteria 83900
305 Ga0495625_0000002 3300046660 Bacteria 813323
306 Ga0495625_0004981 3300046660 Bacteria 12336
307 Ga0495625_0029253 3300046660 Bacteria 4123
308 Ga0495625_0047321 3300046660 Bacteria 3101
309 Ga0495661_0001415 3300046665 Bacteria 20101
310 Ga0495661_0040586 3300046665 Bacteria 2885
311 Ga0495588_0084040 3300046674 Bacteria 1663
312 Ga0495670_0002126 3300046691 Bacteria 9783
313 Ga0495670_0002698 3300046691 Bacteria 8768
314 Ga0495670_0003854 3300046691 Bacteria 7366
315 Ga0495671_0003128 3300046692 Bacteria 10286
316 Ga0495649_0002014 3300046694 Bacteria 14721
317 Ga0495649_0008537 3300046694 Bacteria 6157
318 Ga0495589_0000338 3300046794 Bacteria 36651
319 Ga0495660_0001000 3300046810 Bacteria 20576
320 Ga0495660_0001047 3300046810 Bacteria 20046
321 Ga0495683_0001700 3300047323 Bacteria 13989
322 Ga0495679_000003 3300047446 Bacteria 787868
323 Ga0495673_0000004 3300047469 Bacteria 1354526
324 Ga0495673_0000062 3300047469 Bacteria 226461
325 Ga0495673_0003601 3300047469 Bacteria 10150
326 Ga0495673_0036861 3300047469 Bacteria 2239
327 Ga0495686_0000024 3300047472 Bacteria 400343
328 Ga0495686_0000287 3300047472 Bacteria 88733
329 Ga0495686_0008124 3300047472 Bacteria 7760
330 Ga0495686_0010412 3300047472 Bacteria 6617
331 Ga0495686_0022365 3300047472 Bacteria 4184
332 Ga0496100_0004453 3300048903 Bacteria 7431
333 Ga0496100_0072313 3300048903 Bacteria 2305
334 Ga0496101_0000514 3300048904 Bacteria 24187
335 Ga0496101_0168828 3300048904 Bacteria 1681
336 Ga0496105_0000393 3300048908 Bacteria 28693
337 Ga0496106_0000344 3300048909 Bacteria 32816
338 Ga0496106_0024978 3300048909 Bacteria 4445
339 Ga0496112_0342625 3300048915 Bacteria 1438
340 Ga0496113_0023674 3300048916 Bacteria 4357
341 Ga0496115_0000124 3300048918 Bacteria 70162
342 Ga0496115_0000466 3300048918 Bacteria 32209
343 Ga0496115_0009270 3300048918 Bacteria 7314
344 Ga0496116_0014055 3300048919 Bacteria 6412
345 Ga0496116_0076205 3300048919 Bacteria 2102
346 Ga0496116_0108660 3300048919 Bacteria 1637
347 Ga0496117_0003423 3300048920 Bacteria 18456
348 Ga0496117_0006140 3300048920 Bacteria 12285
349 Ga0496117_0009370 3300048920 Bacteria 9118
350 Ga0496117_0015354 3300048920 Bacteria 6534
351 Ga0496118_0001207 3300048921 Bacteria 39788
352 Ga0496118_0003686 3300048921 Bacteria 18984
353 Ga0496118_0006118 3300048921 Bacteria 13378
354 Ga0496118_0006362 3300048921 Bacteria 13016
355 Ga0496119_0001094 3300048922 Bacteria 34131
356 Ga0496119_0004086 3300048922 Bacteria 14712
357 Ga0496119_0005914 3300048922 Bacteria 11528
358 Ga0496120_0000409 3300048923 Bacteria 68984
359 Ga0496120_0004992 3300048923 Bacteria 10776
360 Ga0496120_0033218 3300048923 Bacteria 3102
361 Ga0496121_0000116 3300048924 Bacteria 177260
362 Ga0496121_0000327 3300048924 Bacteria 99562
363 Ga0496121_0000450 3300048924 Bacteria 81062
364 Ga0496121_0003549 3300048924 Bacteria 22082
365 Ga0496121_0004443 3300048924 Bacteria 18847
366 Ga0496121_0008925 3300048924 Bacteria 11637
367 Ga0496121_0016342 3300048924 Bacteria 7669
368 Ga0496122_0023510 3300048925 Bacteria 5430
369 Ga0496122_0046794 3300048925 Bacteria 3346
370 Ga0496122_0089491 3300048925 Bacteria 2104
371 Ga0496123_0023163 3300048926 Bacteria 4760
372 Ga0496123_0025412 3300048926 Bacteria 4466
373 Ga0496124_0024034 3300048927 Bacteria 5548
374 Ga0496124_0154650 3300048927 Bacteria 1795
375 Ga0496125_0000088 3300048928 Bacteria 214942
376 Ga0496125_0001818 3300048928 Bacteria 29469
377 Ga0496126_0001255 3300048929 Bacteria 40994
378 Ga0496126_0013445 3300048929 Bacteria 8322
379 Ga0496126_0024487 3300048929 Bacteria 5828
380 Ga0496126_0025745 3300048929 Bacteria 5654
381 Ga0496126_0125403 3300048929 Bacteria 2223
382 Ga0495678_000717 3300049459 Bacteria 30162
383 Ga0495678_010779 3300049459 Bacteria 4415
384 Ga0495682_0002206 3300049460 Bacteria 9418
385 Ga0495682_0014908 3300049460 Bacteria 2945
386 Ga0495682_0052785 3300049460 Bacteria 1476
387 Ga0501032_0004995 3300049569 Bacteria 9919
388 Ga0501033_0145391 3300049570 Bacteria 1712
389 Ga0501034_0266418 3300049571 Bacteria 1655
390 Ga0501034_0472319 3300049571 Bacteria 1170
391 Ga0501036_0129936 3300049572 Bacteria 2127
392 Ga0501036_0175194 3300049572 Bacteria 1806
393 Ga0501037_0411537 3300049573 Bacteria 926
394 Ga0501038_0109110 3300049574 Bacteria 2294
395 Ga0501043_0004117 3300049579 Bacteria 11874
396 Ga0501043_0041699 3300049579 Bacteria 3606
397 Ga0501046_0016170 3300049580 Bacteria 6255
398 Ga0501046_0126725 3300049580 Bacteria 1939
399 Ga0501047_0007960 3300049581 Bacteria 9994
400 Ga0501047_0018930 3300049581 Bacteria 6603
401 Ga0501047_0059004 3300049581 Bacteria 3706
402 Ga0501047_0507346 3300049581 Bacteria 1033
403 Ga0501070_0293263 3300049586 Bacteria 1326
404 Ga0501035_0001890 3300049822 Bacteria 21069
405 Ga0501035_0017047 3300049822 Bacteria 6693
406 Ga0501035_0255019 3300049822 Bacteria 1488
407 Ga0501044_0020328 3300049823 Bacteria 7087
408 Ga0501044_0097194 3300049823 Bacteria 2966
409 Ga0501044_0359531 3300049823 Bacteria 1374
410 Ga0501044_0379275 3300049823 Bacteria 1329
411 Ga0501044_0392254 3300049823 Bacteria 1302
412 Ga0500643_000031 3300053087 Bacteria 204488
413 Ga0500555_004105 3300053103 Bacteria 4139
414 Ga0500645_001837 3300053730 Bacteria 10177
415 Ga0466962_0002476 3300061719 Bacteria 8752
416 Ga0466962_0019360 3300061719 Bacteria 3271
417 Ga0466962_0039258 3300061719 Bacteria 2267

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0507346 Ga0501047_0507346_43_669 208
2 3300048927 Ga0496124_0024034 Ga0496124_0024034_1226_2029 214
3 3300048927 Ga0496124_0154650 Ga0496124_0154650_299_1099 219
4 3300048924 Ga0496121_0016342 Ga0496121_0016342_2706_3368 220
5 3300025226 Ga0209674_100574 Ga0209674_10057414 221
6 3300025233 Ga0209437_101294 Ga0209437_1012943 221
7 3300025254 Ga0209148_1001321 Ga0209148_100132111 221
8 3300003578 Ga0006562J51391_1032265 Ga0006562J51391_10322655 222
9 3300048903 Ga0496100_0004453 Ga0496100_0004453_3435_4232 224
10 3300048904 Ga0496101_0000514 Ga0496101_0000514_8372_9169 224
11 3300017792 Ga0163161_10102172 Ga0163161_101021722 225
12 3300048925 Ga0496122_0046794 Ga0496122_0046794_1503_2300 225
13 3300005455 Ga0070663_100012618 Ga0070663_1000126185 226
14 3300017792 Ga0163161_10002008 Ga0163161_100020084 226
15 3300025929 Ga0207664_10000509 Ga0207664_1000050918 226
16 3300046507 Ga0495606_0000248 Ga0495606_0000248_81509_82309 226
17 3300046660 Ga0495625_0004981 Ga0495625_0004981_6030_6830 226
18 3300047472 Ga0495686_0022365 Ga0495686_0022365_456_1256 226
19 3300048922 Ga0496119_0005914 Ga0496119_0005914_5502_6302 230
20 3300048923 Ga0496120_0004992 Ga0496120_0004992_5637_6437 230
21 3300048929 Ga0496126_0024487 Ga0496126_0024487_4053_4853 230
22 3300002737 JGI25162J39368_1000701 JGI25162J39368_100070117 233
23 3300002772 JGI25164J39214_1000657 JGI25164J39214_10006579 233
24 3300003214 JGI25165J46597_1000865 JGI25165J46597_100086511 233
25 3300025231 Ga0207427_100240 Ga0207427_10024029 233
26 3300025233 Ga0209437_100529 Ga0209437_10052915 233
27 3300025261 Ga0209233_1000112 Ga0209233_1000112208 233
28 3300049569 Ga0501032_0004995 Ga0501032_0004995_2448_3239 233
29 3300049571 Ga0501034_0266418 Ga0501034_0266418_586_1377 233
30 3300049573 Ga0501037_0411537 Ga0501037_0411537_25_816 233
31 3300049574 Ga0501038_0109110 Ga0501038_0109110_550_1341 233
32 3300049579 Ga0501043_0041699 Ga0501043_0041699_2802_3593 233
33 3300049580 Ga0501046_0016170 Ga0501046_0016170_3022_3813 233
34 3300015262 Ga0182007_10050672 Ga0182007_100506721 234
35 3300010375 Ga0105239_10007173 Ga0105239_100071738 235
36 3300044735 Ga0466968_0000096 Ga0466968_0000096_16053_16853 235
37 3300044842 Ga0466957_0141487 Ga0466957_0141487_259_1059 237
38 3300005262 Ga0065165_1000204 Ga0065165_100020453 239
39 3300015265 Ga0182005_1038435 Ga0182005_10384352 239
40 3300046471 Ga0495650_0001077 Ga0495650_0001077_9907_10707 240
41 3300046512 Ga0495610_0062524 Ga0495610_0062524_291_1091 240
42 3300046515 Ga0495620_0003880 Ga0495620_0003880_1766_2566 240
43 3300046518 Ga0495631_0001190 Ga0495631_0001190_9288_10088 240
44 3300046524 Ga0495648_0004890 Ga0495648_0004890_10290_11090 240
45 3300046648 Ga0495611_0000051 Ga0495611_0000051_9596_10396 240
46 3300046660 Ga0495625_0047321 Ga0495625_0047321_1789_2589 240
47 3300047469 Ga0495673_0000062 Ga0495673_0000062_53308_54108 240
48 3300047472 Ga0495686_0010412 Ga0495686_0010412_1265_2065 240
49 3300013104 Ga0157370_10378379 Ga0157370_103783792 241
50 3300013105 Ga0157369_10003238 Ga0157369_1000323814 241
51 3300025904 Ga0207647_10000002 Ga0207647_1000000241 241
52 3300048909 Ga0496106_0000344 Ga0496106_0000344_29835_30635 241
53 3300048926 Ga0496123_0025412 Ga0496123_0025412_1845_2645 241
54 3300048928 Ga0496125_0001818 Ga0496125_0001818_8896_9696 241
55 3300015685 Ga0183369_1004 Ga0183369_1004383 242
56 3300044683 Ga0466965_0193112 Ga0466965_0193112_157_954 242
57 3300044719 Ga0466971_0011258 Ga0466971_0011258_1174_1971 242
58 3300046492 Ga0495585_0000112 Ga0495585_0000112_75113_75913 242
59 3300046518 Ga0495631_0001311 Ga0495631_0001311_5753_6553 242
60 3300046524 Ga0495648_0000820 Ga0495648_0000820_8530_9330 242
61 3300046665 Ga0495661_0001415 Ga0495661_0001415_9237_10037 242
62 3300049460 Ga0495682_0002206 Ga0495682_0002206_1411_2211 242
63 3300049823 Ga0501044_0392254 Ga0501044_0392254_497_1291 242
64 3300053730 Ga0500645_001837 Ga0500645_001837_8672_9472 242
65 3300061719 Ga0466962_0039258 Ga0466962_0039258_491_1288 242
66 3300005344 Ga0070661_100009643 Ga0070661_1000096434 243
67 3300025258 Ga0209129_1000293 Ga0209129_100029318 243
68 3300025297 Ga0209758_1013978 Ga0209758_10139782 243
69 3300047472 Ga0495686_0000287 Ga0495686_0000287_9465_10265 243
70 3300049581 Ga0501047_0059004 Ga0501047_0059004_601_1392 243
71 3300044672 Ga0466982_0000001 Ga0466982_0000001_392994_393791 244
72 3300044684 Ga0466966_0003183 Ga0466966_0003183_5347_6144 244
73 3300044735 Ga0466968_0000863 Ga0466968_0000863_8801_9598 244
74 3300044842 Ga0466957_0106283 Ga0466957_0106283_919_1716 244
75 3300048908 Ga0496105_0000393 Ga0496105_0000393_7406_8191 244
76 3300048919 Ga0496116_0014055 Ga0496116_0014055_139_924 244
77 3300048920 Ga0496117_0003423 Ga0496117_0003423_2026_2811 244
78 3300048921 Ga0496118_0001207 Ga0496118_0001207_23150_23935 244
79 3300048922 Ga0496119_0001094 Ga0496119_0001094_23651_24436 244
80 3300048923 Ga0496120_0000409 Ga0496120_0000409_9683_10468 244
81 3300005435 Ga0070714_100064742 Ga0070714_1000647423 245
82 3300005439 Ga0070711_100244789 Ga0070711_1002447892 245
83 3300013104 Ga0157370_10002865 Ga0157370_100028656 245
84 3300014497 Ga0182008_10023490 Ga0182008_100234903 245
85 3300015262 Ga0182007_10009490 Ga0182007_100094904 245
86 3300025250 Ga0209026_1000143 Ga0209026_100014344 245
87 3300025898 Ga0207692_10038498 Ga0207692_100384983 245
88 3300025928 Ga0207700_10055791 Ga0207700_100557913 245
89 3300046507 Ga0495606_0012900 Ga0495606_0012900_5592_6392 245
90 3300046674 Ga0495588_0084040 Ga0495588_0084040_321_1109 245
91 3300048919 Ga0496116_0108660 Ga0496116_0108660_280_1080 245
92 3300049460 Ga0495682_0014908 Ga0495682_0014908_1457_2254 245
93 3300005337 Ga0070682_100030337 Ga0070682_1000303373 246
94 3300005578 Ga0068854_100031161 Ga0068854_1000311613 246
95 3300005614 Ga0068856_100000132 Ga0068856_1000001327 246
96 3300009093 Ga0105240_10002915 Ga0105240_100029158 246
97 3300009551 Ga0105238_10167708 Ga0105238_101677082 246
98 3300009551 Ga0105238_10293225 Ga0105238_102932252 246
99 3300013104 Ga0157370_10001135 Ga0157370_1000113527 246
100 3300013104 Ga0157370_10002691 Ga0157370_100026915 246
101 3300013105 Ga0157369_10046845 Ga0157369_100468455 246
102 3300015265 Ga0182005_1000112 Ga0182005_100011213 246
103 3300025913 Ga0207695_10001147 Ga0207695_1000114716 246
104 3300025924 Ga0207694_10536655 Ga0207694_105366551 246
105 3300025981 Ga0207640_10018054 Ga0207640_100180543 246
106 3300026078 Ga0207702_10000037 Ga0207702_10000037110 246
107 3300046501 Ga0495607_0000006 Ga0495607_0000006_208265_209065 246
108 3300046501 Ga0495607_0002346 Ga0495607_0002346_8778_9578 246
109 3300009101 Ga0105247_10001176 Ga0105247_100011767 247
110 3300014497 Ga0182008_10002133 Ga0182008_100021337 247
111 3300015261 Ga0182006_1000065 Ga0182006_100006516 247
112 3300015262 Ga0182007_10004171 Ga0182007_100041717 247
113 3300015265 Ga0182005_1013814 Ga0182005_10138143 247
114 3300025303 Ga0209051_1004124 Ga0209051_10041242 247
115 3300025920 Ga0207649_10529905 Ga0207649_105299051 247
116 3300046810 Ga0495660_0001047 Ga0495660_0001047_6115_6915 247
117 3300047469 Ga0495673_0000004 Ga0495673_0000004_1223786_1224586 247
118 3300048909 Ga0496106_0024978 Ga0496106_0024978_2982_3782 247
119 3300048915 Ga0496112_0342625 Ga0496112_0342625_523_1320 247
120 3300048916 Ga0496113_0023674 Ga0496113_0023674_1990_2787 247
121 3300048919 Ga0496116_0076205 Ga0496116_0076205_1107_1907 247
122 3300048920 Ga0496117_0015354 Ga0496117_0015354_1869_2669 247
123 3300048921 Ga0496118_0003686 Ga0496118_0003686_8636_9436 247
124 3300048924 Ga0496121_0000116 Ga0496121_0000116_121345_122145 247
125 3300048924 Ga0496121_0004443 Ga0496121_0004443_11958_12758 247
126 3300048925 Ga0496122_0089491 Ga0496122_0089491_19_819 247
127 3300048929 Ga0496126_0013445 Ga0496126_0013445_100_900 247
128 3300048929 Ga0496126_0125403 Ga0496126_0125403_906_1706 247
129 3300049822 Ga0501035_0017047 Ga0501035_0017047_4351_5142 247
130 3300049823 Ga0501044_0097194 Ga0501044_0097194_42_833 247
131 3300005331 Ga0070670_100118414 Ga0070670_1001184142 248
132 3300005577 Ga0068857_100138954 Ga0068857_1001389542 248
133 3300026116 Ga0207674_10150461 Ga0207674_101504612 248
134 3300046452 Ga0495617_000605 Ga0495617_000605_11428_12228 248
135 3300046501 Ga0495607_0240148 Ga0495607_0240148_15_815 248
136 3300046515 Ga0495620_0000929 Ga0495620_0000929_5993_6793 248
137 3300048925 Ga0496122_0023510 Ga0496122_0023510_2533_3336 248
138 3300048926 Ga0496123_0023163 Ga0496123_0023163_2902_3705 248
139 3300049570 Ga0501033_0145391 Ga0501033_0145391_142_939 248
140 3300049572 Ga0501036_0175194 Ga0501036_0175194_594_1391 248
141 3300049579 Ga0501043_0004117 Ga0501043_0004117_8548_9345 248
142 3300049581 Ga0501047_0018930 Ga0501047_0018930_2570_3367 248
143 3300049586 Ga0501070_0293263 Ga0501070_0293263_224_1021 248
144 3300049822 Ga0501035_0001890 Ga0501035_0001890_12281_13078 248
145 3300049823 Ga0501044_0020328 Ga0501044_0020328_3801_4598 248
146 3300009093 Ga0105240_10002735 Ga0105240_1000273518 249
147 3300010375 Ga0105239_10000192 Ga0105239_1000019245 249
148 3300025913 Ga0207695_10000291 Ga0207695_1000029180 249
149 3300014497 Ga0182008_10147579 Ga0182008_101475791 251
150 3300015261 Ga0182006_1040061 Ga0182006_10400612 251
151 3300002705 JGI25156J39149_1000480 JGI25156J39149_100048010 254
152 3300002741 JGI25157J39369_1000943 JGI25157J39369_100094310 254
153 3300003761 Ga0055535_1001129 Ga0055535_100112917 254
154 3300003762 Ga0055542_1000188 Ga0055542_100018810 254
155 3300003763 Ga0055529_1000209 Ga0055529_100020912 254
156 3300005458 Ga0070681_10059585 Ga0070681_100595852 254
157 3300025228 Ga0209672_100089 Ga0209672_10008974 254
158 3300025242 Ga0209258_100173 Ga0209258_100173120 254
159 3300025246 Ga0209646_1002725 Ga0209646_10027252 254
160 3300025250 Ga0209026_1000939 Ga0209026_10009399 254
161 3300025254 Ga0209148_1000079 Ga0209148_1000079197 254
162 3300025256 Ga0209759_1000165 Ga0209759_100016554 254
163 3300025272 Ga0209455_1000016 Ga0209455_1000016198 254
164 3300025912 Ga0207707_10011434 Ga0207707_100114343 254
165 3300049580 Ga0501046_0126725 Ga0501046_0126725_1060_1857 254
166 3300005340 Ga0070689_100015269 Ga0070689_1000152695 255
167 3300009551 Ga0105238_10052340 Ga0105238_100523404 255
168 3300014497 Ga0182008_10084781 Ga0182008_100847812 255
169 3300025920 Ga0207649_10294072 Ga0207649_102940722 255
170 3300025936 Ga0207670_10009255 Ga0207670_100092552 255
171 3300026067 Ga0207678_10015791 Ga0207678_100157913 255
172 3300041456 Ga0451795_1433423 Ga0451795_1433423_127_927 255
173 3300046507 Ga0495606_0000267 Ga0495606_0000267_9685_10485 255
174 3300047323 Ga0495683_0001700 Ga0495683_0001700_3740_4540 255
175 3300047472 Ga0495686_0008124 Ga0495686_0008124_3037_3837 255
176 3300048924 Ga0496121_0000450 Ga0496121_0000450_9292_10092 255
177 3300005455 Ga0070663_100022836 Ga0070663_1000228365 256
178 3300009545 Ga0105237_10001731 Ga0105237_1000173123 256
179 3300013104 Ga0157370_10060951 Ga0157370_100609512 256
180 3300026067 Ga0207678_10008274 Ga0207678_100082742 256
181 3300042184 Ga0450908_000073 Ga0450908_000073_7765_8565 256
182 3300046691 Ga0495670_0003854 Ga0495670_0003854_3132_3932 256
183 3300053087 Ga0500643_000031 Ga0500643_000031_11433_12233 256
184 3300037312 Ga0395899_0017214 Ga0395899_0017214_971_1768 257
185 3300038443 Ga0395901_0025934 Ga0395901_0025934_5139_5936 257
186 3300037312 Ga0395899_0009297 Ga0395899_0009297_1735_2532 258
187 3300037418 Ga0395900_0005136 Ga0395900_0005136_5470_6267 258
188 3300038443 Ga0395901_0135401 Ga0395901_0135401_117_914 258
189 3300003760 Ga0055527_1000080 Ga0055527_100008012 259
190 3300003761 Ga0055535_1000189 Ga0055535_100018953 259
191 3300003762 Ga0055542_1000181 Ga0055542_100018161 259
192 3300003763 Ga0055529_1000205 Ga0055529_100020561 259
193 3300005614 Ga0068856_100015419 Ga0068856_1000154197 259
194 3300025225 Ga0209566_103535 Ga0209566_1035353 259
195 3300025226 Ga0209674_100234 Ga0209674_10023435 259
196 3300025228 Ga0209672_100008 Ga0209672_100008328 259
197 3300025242 Ga0209258_100004 Ga0209258_100004862 259
198 3300025242 Ga0209258_100008 Ga0209258_100008487 259
199 3300025253 Ga0209677_101761 Ga0209677_10176110 259
200 3300025254 Ga0209148_1000279 Ga0209148_100027913 259
201 3300025256 Ga0209759_1004103 Ga0209759_10041033 259
202 3300025272 Ga0209455_1000007 Ga0209455_1000007607 259
203 3300026078 Ga0207702_10000960 Ga0207702_1000096024 259
204 3300047472 Ga0495686_0000024 Ga0495686_0000024_9274_10074 259
205 iso_pu_bacteria 2537561836 2538833501 259
206 iso_pu_bacteria 2643221562 2643831829 259
207 iso_pu_bacteria 2643221577 2643896140 259
208 iso_pu_bacteria 2643221685 2644478349 259
209 iso_pu_bacteria 2895395659 2895395875 259
210 iso_pu_bacteria 2687453130 2687584803 260
211 3300013297 Ga0157378_10000052 Ga0157378_1000005264 261
212 iso_pu_bacteria 2593339238 2595448915 261
213 iso_pu_bacteria 2593339239 2595452991 261
214 iso_pu_bacteria 2718218334 2721025524 261
215 iso_pu_bacteria 2734482264 2735834505 261
216 iso_pu_bacteria 2738543009 2739225956 261
217 iso_pu_bacteria 2739367700 2739733201 261
218 iso_pu_bacteria 2818991440 2819564829 261
219 iso_pu_bacteria 2842914999 2842915692 261
220 iso_pu_bacteria 2842918807 2842920921 261
221 iso_pu_bacteria 2884338543 2884338865 261
222 iso_pu_bacteria 2904463128 2904465651 261
223 iso_pu_bacteria 2919085039 2919086441 261
224 iso_pu_bacteria 2919404418 2919407631 261
225 iso_pu_bacteria 2928963466 2928966914 261
226 iso_pu_bacteria 2941471342 2941472003 261
227 iso_pu_bacteria 2953994433 2953996192 261
228 3300002737 JGI25162J39368_1000906 JGI25162J39368_100090612 262
229 3300002741 JGI25157J39369_1000525 JGI25157J39369_100052519 262
230 3300002772 JGI25164J39214_1000112 JGI25164J39214_100011260 262
231 3300003214 JGI25165J46597_1000229 JGI25165J46597_100022960 262
232 3300003759 Ga0055525_1000082 Ga0055525_100008280 262
233 3300003760 Ga0055527_1000072 Ga0055527_100007262 262
234 3300003761 Ga0055535_1000162 Ga0055535_100016257 262
235 3300003761 Ga0055535_1000611 Ga0055535_10006112 262
236 3300003762 Ga0055542_1000105 Ga0055542_10001058 262
237 3300003762 Ga0055542_1000163 Ga0055542_100016312 262
238 3300003763 Ga0055529_1000336 Ga0055529_100033614 262
239 3300005539 Ga0068853_100028203 Ga0068853_1000282033 262
240 3300005616 Ga0068852_100009172 Ga0068852_1000091727 262
241 3300025228 Ga0209672_100004 Ga0209672_100004429 262
242 3300025230 Ga0209563_100097 Ga0209563_10009782 262
243 3300025231 Ga0207427_100051 Ga0207427_100051137 262
244 3300025233 Ga0209437_100152 Ga0209437_10015285 262
245 3300025242 Ga0209258_100003 Ga0209258_100003429 262
246 3300025242 Ga0209258_100090 Ga0209258_100090118 262
247 3300025250 Ga0209026_1000064 Ga0209026_100006484 262
248 3300025254 Ga0209148_1000016 Ga0209148_1000016429 262
249 3300025254 Ga0209148_1000065 Ga0209148_1000065118 262
250 3300025256 Ga0209759_1000762 Ga0209759_10007624 262
251 3300025261 Ga0209233_1000099 Ga0209233_1000099201 262
252 3300025272 Ga0209455_1000004 Ga0209455_1000004429 262
253 3300025272 Ga0209455_1011238 Ga0209455_10112382 262
254 3300026041 Ga0207639_10003448 Ga0207639_100034482 262
255 3300026142 Ga0207698_10026233 Ga0207698_100262332 262
256 3300031238 Ga0265332_10117755 Ga0265332_101177551 262
257 3300037312 Ga0395899_0000189 Ga0395899_0000189_81164_81952 262
258 3300037312 Ga0395899_0022542 Ga0395899_0022542_2000_2788 262
259 3300037418 Ga0395900_0000011 Ga0395900_0000011_49643_50431 262
260 3300037466 Ga0395898_0000013 Ga0395898_0000013_50441_51229 262
261 3300037466 Ga0395898_0000058 Ga0395898_0000058_54964_55752 262
262 3300037471 Ga0395905_0453342 Ga0395905_0453342_139_927 262
263 3300038443 Ga0395901_0101837 Ga0395901_0101837_2206_2994 262
264 3300038443 Ga0395901_0353405 Ga0395901_0353405_20_808 262
265 3300044656 Ga0466969_0027925 Ga0466969_0027925_1555_2343 262
266 3300044661 Ga0466975_0014627 Ga0466975_0014627_1981_2769 262
267 3300044684 Ga0466966_0001373 Ga0466966_0001373_3861_4649 262
268 3300044693 Ga0466961_0000349 Ga0466961_0000349_5164_5952 262
269 3300044693 Ga0466961_0002690 Ga0466961_0002690_7837_8625 262
270 3300044693 Ga0466961_0007989 Ga0466961_0007989_3613_4401 262
271 3300044693 Ga0466961_0009916 Ga0466961_0009916_5061_5849 262
272 3300044706 Ga0466964_0008434 Ga0466964_0008434_1234_2022 262
273 3300044765 Ga0466970_0002351 Ga0466970_0002351_5305_6093 262
274 3300044842 Ga0466957_0033153 Ga0466957_0033153_1596_2384 262
275 3300045049 Ga0466959_0000618 Ga0466959_0000618_12859_13647 262
276 3300045049 Ga0466959_0023980 Ga0466959_0023980_1622_2410 262
277 3300045836 Ga0466958_0000832 Ga0466958_0000832_8806_9594 262
278 3300045836 Ga0466958_0008412 Ga0466958_0008412_2444_3232 262
279 3300045836 Ga0466958_0015968 Ga0466958_0015968_702_1490 262
280 3300045976 Ga0466967_0050823 Ga0466967_0050823_882_1670 262
281 3300061719 Ga0466962_0002476 Ga0466962_0002476_4975_5763 262
282 3300061719 Ga0466962_0019360 Ga0466962_0019360_415_1203 262
283 3300002705 JGI25156J39149_1005245 JGI25156J39149_10052452 263
284 3300002741 JGI25157J39369_1002387 JGI25157J39369_10023872 263
285 3300003763 Ga0055529_1004509 Ga0055529_10045092 263
286 3300005337 Ga0070682_100040535 Ga0070682_1000405352 263
287 3300005337 Ga0070682_100048208 Ga0070682_1000482082 263
288 3300005339 Ga0070660_100034454 Ga0070660_1000344542 263
289 3300005366 Ga0070659_100013371 Ga0070659_1000133713 263
290 3300005444 Ga0070694_100291456 Ga0070694_1002914562 263
291 3300005455 Ga0070663_100419768 Ga0070663_1004197682 263
292 3300005458 Ga0070681_10006507 Ga0070681_100065072 263
293 3300005563 Ga0068855_100079086 Ga0068855_1000790865 263
294 3300005616 Ga0068852_100001289 Ga0068852_1000012893 263
295 3300009093 Ga0105240_10007649 Ga0105240_100076497 263
296 3300013102 Ga0157371_10004926 Ga0157371_100049267 263
297 3300020081 Ga0206354_10902515 Ga0206354_109025151 263
298 3300025250 Ga0209026_1000445 Ga0209026_100044525 263
299 3300025256 Ga0209759_1008643 Ga0209759_10086433 263
300 3300025272 Ga0209455_1000333 Ga0209455_100033320 263
301 3300025904 Ga0207647_10011349 Ga0207647_100113493 263
302 3300025912 Ga0207707_10005170 Ga0207707_100051702 263
303 3300025913 Ga0207695_10012134 Ga0207695_1001213410 263
304 3300025932 Ga0207690_10002657 Ga0207690_1000265711 263
305 3300025932 Ga0207690_10003120 Ga0207690_100031202 263
306 3300025932 Ga0207690_10020654 Ga0207690_100206544 263
307 3300025949 Ga0207667_10471794 Ga0207667_104717942 263
308 3300025981 Ga0207640_10109411 Ga0207640_101094112 263
309 3300026142 Ga0207698_10004916 Ga0207698_100049163 263
310 3300038443 Ga0395901_0000201 Ga0395901_0000201_14435_15226 263
311 3300002075 JGI24738J21930_10000769 JGI24738J21930_100007697 264
312 3300005262 Ga0065165_1003599 Ga0065165_10035992 264
313 3300005466 Ga0070685_10005610 Ga0070685_100056105 264
314 3300005563 Ga0068855_100021370 Ga0068855_1000213704 264
315 3300005578 Ga0068854_100000995 Ga0068854_10000099513 264
316 3300009093 Ga0105240_10050891 Ga0105240_100508912 264
317 3300009093 Ga0105240_10310748 Ga0105240_103107482 264
318 3300014497 Ga0182008_10001688 Ga0182008_1000168810 264
319 3300015261 Ga0182006_1007622 Ga0182006_10076223 264
320 3300015262 Ga0182007_10079636 Ga0182007_100796362 264
321 3300015265 Ga0182005_1001350 Ga0182005_100135010 264
322 3300025250 Ga0209026_1012151 Ga0209026_10121512 264
323 3300025297 Ga0209758_1014776 Ga0209758_10147762 264
324 3300025913 Ga0207695_10083977 Ga0207695_100839774 264
325 3300025913 Ga0207695_10201952 Ga0207695_102019522 264
326 3300025949 Ga0207667_10000262 Ga0207667_1000026219 264
327 3300025981 Ga0207640_10000116 Ga0207640_1000011614 264
328 3300031731 Ga0307405_10065740 Ga0307405_100657402 264
329 3300031911 Ga0307412_10000714 Ga0307412_100007148 264
330 3300041404 Ga0439436_0000028 Ga0439436_0000028_38434_39234 264
331 3300041404 Ga0439436_0039500 Ga0439436_0039500_370_1170 264
332 3300041413 Ga0439465_0000468 Ga0439465_0000468_3941_4741 264
333 3300046452 Ga0495617_000926 Ga0495617_000926_5960_6760 264
334 3300046460 Ga0495638_0000139 Ga0495638_0000139_17092_17892 264
335 3300046471 Ga0495650_0019469 Ga0495650_0019469_744_1544 264
336 3300046492 Ga0495585_0010140 Ga0495585_0010140_965_1765 264
337 3300046501 Ga0495607_0000131 Ga0495607_0000131_28020_28820 264
338 3300046506 Ga0495583_0004839 Ga0495583_0004839_4043_4843 264
339 3300046512 Ga0495610_0002302 Ga0495610_0002302_3249_4049 264
340 3300046513 Ga0495616_0000074 Ga0495616_0000074_71051_71851 264
341 3300046519 Ga0495632_0000279 Ga0495632_0000279_29471_30271 264
342 3300046519 Ga0495632_0005834 Ga0495632_0005834_3789_4589 264
343 3300046519 Ga0495632_0013377 Ga0495632_0013377_1047_1847 264
344 3300046520 Ga0495637_0002564 Ga0495637_0002564_636_1436 264
345 3300046538 Ga0495609_0009368 Ga0495609_0009368_3554_4354 264
346 3300046648 Ga0495611_0000002 Ga0495611_0000002_517159_517959 264
347 3300046660 Ga0495625_0000002 Ga0495625_0000002_521644_522444 264
348 3300046665 Ga0495661_0040586 Ga0495661_0040586_981_1781 264
349 3300046691 Ga0495670_0002126 Ga0495670_0002126_7729_8529 264
350 3300046691 Ga0495670_0002698 Ga0495670_0002698_1555_2355 264
351 3300046692 Ga0495671_0003128 Ga0495671_0003128_3416_4216 264
352 3300046694 Ga0495649_0008537 Ga0495649_0008537_1988_2788 264
353 3300046794 Ga0495589_0000338 Ga0495589_0000338_3832_4632 264
354 3300046810 Ga0495660_0001000 Ga0495660_0001000_6192_6992 264
355 3300047446 Ga0495679_000003 Ga0495679_000003_277959_278759 264
356 3300047469 Ga0495673_0003601 Ga0495673_0003601_6034_6834 264
357 3300047469 Ga0495673_0036861 Ga0495673_0036861_970_1770 264
358 3300048918 Ga0496115_0009270 Ga0496115_0009270_5616_6413 264
359 3300048920 Ga0496117_0006140 Ga0496117_0006140_7582_8382 264
360 3300048920 Ga0496117_0009370 Ga0496117_0009370_3296_4093 264
361 3300048921 Ga0496118_0006118 Ga0496118_0006118_7155_7952 264
362 3300048921 Ga0496118_0006362 Ga0496118_0006362_5481_6281 264
363 3300048922 Ga0496119_0004086 Ga0496119_0004086_2710_3510 264
364 3300048923 Ga0496120_0033218 Ga0496120_0033218_1538_2338 264
365 3300048924 Ga0496121_0003549 Ga0496121_0003549_2558_3355 264
366 3300048929 Ga0496126_0001255 Ga0496126_0001255_32539_33336 264
367 3300049459 Ga0495678_000717 Ga0495678_000717_25932_26732 264
368 3300049460 Ga0495682_0052785 Ga0495682_0052785_637_1437 264
369 3300049822 Ga0501035_0255019 Ga0501035_0255019_561_1355 264
370 3300049823 Ga0501044_0379275 Ga0501044_0379275_348_1142 264
371 3300053103 Ga0500555_004105 Ga0500555_004105_3153_3953 264
372 3300001989 JGI24739J22299_10013061 JGI24739J22299_100130613 265
373 3300002067 JGI24735J21928_10001123 JGI24735J21928_100011235 265
374 3300003316 rootH1_10047629 rootH1_100476293 265
375 3300003320 rootH2_10044123 rootH2_1004412311 265
376 3300003322 rootL2_10086489 rootL2_100864894 265
377 3300003756 Ga0055533_1000695 Ga0055533_10006957 265
378 3300003762 Ga0055542_1000254 Ga0055542_100025416 265
379 3300015687 Ga0183368_1002 Ga0183368_10021332 265
380 3300025226 Ga0209674_100014 Ga0209674_100014129 265
381 3300025228 Ga0209672_101624 Ga0209672_1016243 265
382 3300025231 Ga0207427_101957 Ga0207427_1019572 265
383 3300025233 Ga0209437_100279 Ga0209437_10027952 265
384 3300025233 Ga0209437_108342 Ga0209437_1083422 265
385 3300025242 Ga0209258_100663 Ga0209258_10066316 265
386 3300025242 Ga0209258_102246 Ga0209258_1022465 265
387 3300025246 Ga0209646_1006180 Ga0209646_10061802 265
388 3300025250 Ga0209026_1001638 Ga0209026_10016387 265
389 3300025254 Ga0209148_1000002 Ga0209148_1000002290 265
390 3300025261 Ga0209233_1012302 Ga0209233_10123022 265
391 3300025272 Ga0209455_1008754 Ga0209455_10087543 265
392 3300026067 Ga0207678_10031125 Ga0207678_100311253 265
393 3300037312 Ga0395899_0144025 Ga0395899_0144025_284_1081 265
394 3300037418 Ga0395900_0004641 Ga0395900_0004641_3422_4219 265
395 3300037466 Ga0395898_0012943 Ga0395898_0012943_5908_6705 265
396 3300037466 Ga0395898_0117403 Ga0395898_0117403_755_1552 265
397 3300038443 Ga0395901_0000961 Ga0395901_0000961_8141_8938 265
398 3300038443 Ga0395901_0067066 Ga0395901_0067066_198_995 265
399 3300046460 Ga0495638_0000389 Ga0495638_0000389_40025_40822 265
400 3300046507 Ga0495606_0000016 Ga0495606_0000016_18736_19533 265
401 3300046542 Ga0495597_0008598 Ga0495597_0008598_332_1129 265
402 3300046557 Ga0495622_0000731 Ga0495622_0000731_15560_16357 265
403 3300046660 Ga0495625_0029253 Ga0495625_0029253_3273_4070 265
404 3300046694 Ga0495649_0002014 Ga0495649_0002014_9500_10297 265
405 3300048903 Ga0496100_0072313 Ga0496100_0072313_226_1026 265
406 3300048904 Ga0496101_0168828 Ga0496101_0168828_197_997 265
407 3300048918 Ga0496115_0000124 Ga0496115_0000124_58325_59122 265
408 3300048918 Ga0496115_0000466 Ga0496115_0000466_12619_13416 265
409 3300048924 Ga0496121_0000327 Ga0496121_0000327_75207_76007 265
410 3300048929 Ga0496126_0025745 Ga0496126_0025745_3129_3926 265
411 3300049459 Ga0495678_010779 Ga0495678_010779_508_1305 265
412 3300049571 Ga0501034_0472319 Ga0501034_0472319_256_1053 265
413 3300049572 Ga0501036_0129936 Ga0501036_0129936_59_856 265
414 3300049581 Ga0501047_0007960 Ga0501047_0007960_7953_8750 265
415 3300049823 Ga0501044_0359531 Ga0501044_0359531_442_1239 265
416 3300001989 JGI24739J22299_10001016 JGI24739J22299_100010164 266
417 3300003578 Ga0006562J51391_1015751 Ga0006562J51391_10157518 266
418 3300005344 Ga0070661_100060669 Ga0070661_1000606693 266
419 3300005455 Ga0070663_100015740 Ga0070663_1000157404 266
420 3300005577 Ga0068857_100003150 Ga0068857_10000315011 266
421 3300005616 Ga0068852_100021418 Ga0068852_1000214185 266
422 3300005834 Ga0068851_10001619 Ga0068851_100016199 266
423 3300009093 Ga0105240_10006605 Ga0105240_100066059 266
424 3300009545 Ga0105237_10000022 Ga0105237_10000022203 266
425 3300010375 Ga0105239_10007665 Ga0105239_100076654 266
426 3300012500 Ga0157314_1000021 Ga0157314_10000216 266
427 3300025297 Ga0209758_1000452 Ga0209758_100045255 266
428 3300025321 Ga0207656_10002667 Ga0207656_100026676 266
429 3300025904 Ga0207647_10006054 Ga0207647_1000605410 266
430 3300025913 Ga0207695_10000362 Ga0207695_1000036216 266
431 3300025914 Ga0207671_10000009 Ga0207671_10000009428 266
432 3300025920 Ga0207649_10111853 Ga0207649_101118531 266
433 3300025933 Ga0207706_10362309 Ga0207706_103623092 266
434 3300025949 Ga0207667_10000329 Ga0207667_1000032914 266
435 3300026067 Ga0207678_10018460 Ga0207678_100184604 266
436 3300026116 Ga0207674_10002188 Ga0207674_1000218814 266
437 3300026142 Ga0207698_10020738 Ga0207698_100207384 266
438 3300048924 Ga0496121_0008925 Ga0496121_0008925_9306_10106 266
439 3300048928 Ga0496125_0000088 Ga0496125_0000088_98006_98806 266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13723

Ketoacyl-synt_2

Beta-ketoacyl synthase, N-terminal domain

36

262

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qsp-assembly1.cif.gz_B ketosynthase (apeo) in complex with its chain length factor (apec) from xenorhabdus doucetiae 0.7415 4 261
7f28-assembly2.cif.gz_C crystal structure of a bacterial ketosynthase 0.7347 4 193
6qsp-assembly1.cif.gz_B ketosynthase (apeo) in complex with its chain length factor (apec) from xenorhabdus doucetiae 0.7332 4 261
6smp-assembly4.cif.gz_L antde:antf (holo): type ii pks acyl-carrier protein in complex with its ketosynthase bound to the hexaketide 0.7325 4 208
7f28-assembly1.cif.gz_A crystal structure of a bacterial ketosynthase 0.727 4 211
ID Description Score Start End Superfamily
af_I1N0K0_10_263_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.7374 6 195 3.40.47.10
4f32A01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.7266 8 194 3.40.47.10
af_B9FEC8_18_216_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.7235 57 177 3.40.47.10
af_A0A1D6QKV3_1_181_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.7146 56 167 3.40.47.10
af_Q69UB7_33_233_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.7132 57 198 3.40.47.10
ID Description Score Start End GO Terms
AF-I4W2M8-F1-model_v4 Beta-ketoacyl synthase-like N-terminal domain-containing protein 0.9227 1 266 GO:0016746
AF-I4W2M8-F1-model_v4 Beta-ketoacyl synthase-like N-terminal domain-containing protein 0.9193 1 266 GO:0016746
AF-I4WB35-F1-model_v4 Beta-ketoacyl synthase-like N-terminal domain-containing protein 0.9062 53 266 GO:0016746
AF-A0A7W6KYN0-F1-model_v4 Beta-ketoacyl synthase-like N-terminal domain-containing protein 0.9057 4 264 GO:0016746
AF-A0A1E7TXG4-F1-model_v4 deleted 0.9049 1 266

Feature Viewer

pLDDT pTM Quality
88.37 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map