F444082

General Info

Members Datasets Scaffolds Average Seq Length
438 288 418 148

Family's Representative Sequence

Representative Sequence 3300049579|Ga0501043_0590467|Ga0501043_0590467_187_699
Length 170
Sequence LDFGPFPDTLVSAMSKPTLRETGLVDVRFGRNVTVVQPANLYGCAIGDDCFIGPFVEIQRDVVIGARTRIQSHSFICELVRIGEDCMIAHGVMFTNDLFKDGGPARGNRSAWKSTQVGNRVSIGSNATLLPVRICDDVVIGAGSVVTKDITQPGVYAGNPARLLRTLPGK

Samples

Sample ID Description Type Environment
1 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
2 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
3 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
4 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
5 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
6 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
7 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
8 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
9 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
10 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
11 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
12 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
13 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
14 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
15 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
16 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
17 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
22 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
156 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
162 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
178 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
179 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
180 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
181 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
182 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
185 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
198 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
199 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
200 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
211 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
212 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
227 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
228 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
229 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
232 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
233 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
248 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
257 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
264 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
265 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
266 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
267 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
268 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
269 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
270 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
271 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
272 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
273 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
274 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
275 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
276 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
277 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
278 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
279 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
280 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
284 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
285 8005275841 Rhizobium sp. N4311 Isolate Nodule
286 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
287 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
288 8018176218 Rhizobium sp. N122 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.21
Metatranscriptomes 0
Isolates 4.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.96
Nodule 3.65
Rhizoplane 2.28
Rhizosphere 71.69
Stem 0
Stem Tuber 0
Unclassified 11.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000044 3300002987 Bacteria 60564
2 JGI25153J46596_10000744 3300003215 Bacteria 19896
3 rootL2_10120629 3300003322 Bacteria 1345
4 rootH1_10007743 3300003316 Bacteria 6031
5 rootH1_10007743 3300003323 Bacteria 19767
6 JGI25160J50197_1000206 3300003354 Bacteria 49083
7 JGI25161J50226_1000097 3300003374 Bacteria 72031
8 Ga0055524_1006179 3300003775 Bacteria 5230
9 Ga0055530_10003364 3300003791 Bacteria 9156
10 Ga0055543_1000056 3300004625 Bacteria 103704
11 Ga0065165_1000719 3300005262 Bacteria 46606
12 Ga0065704_10098741 3300005289 Bacteria 2341
13 Ga0065715_10003750 3300005293 Bacteria 6327
14 Ga0070676_10406023 3300005328 Bacteria 949
15 Ga0070683_100275566 3300005329 Bacteria 1600
16 Ga0070683_100512247 3300005329 Bacteria 1146
17 Ga0070670_100206532 3300005331 Bacteria 1707
18 Ga0070666_10385635 3300005335 Unclassified 1006
19 Ga0070666_10534151 3300005335 Bacteria 852
20 Ga0070680_100215403 3300005336 Bacteria 1621
21 Ga0068868_100172436 3300005338 Unclassified 1791
22 Ga0068868_100601143 3300005338 Bacteria 974
23 Ga0070660_100191480 3300005339 Bacteria 1657
24 Ga0070691_10184160 3300005341 Bacteria 1088
25 Ga0070687_100028037 3300005343 Unclassified 2727
26 Ga0070687_100980037 3300005343 Bacteria 611
27 Ga0070668_100250598 3300005347 Bacteria 1470
28 Ga0070675_100089511 3300005354 Bacteria 2577
29 Ga0070659_100097196 3300005366 Bacteria 2366
30 Ga0070659_101319565 3300005366 Bacteria 640
31 Ga0070667_100071921 3300005367 Bacteria 2946
32 Ga0070709_10264137 3300005434 Bacteria 1245
33 Ga0070713_100401479 3300005436 Bacteria 1280
34 Ga0070663_100449891 3300005455 Bacteria 1061
35 Ga0070678_100702484 3300005456 Bacteria 911
36 Ga0070662_100050620 3300005457 Bacteria 2996
37 Ga0070681_10093572 3300005458 Bacteria 2954
38 Ga0070681_10114783 3300005458 Bacteria 2631
39 Ga0070681_10222351 3300005458 Bacteria 1803
40 Ga0070706_100062307 3300005467 Bacteria 3446
41 Ga0070707_100617917 3300005468 Bacteria 1046
42 Ga0070699_100098442 3300005518 Bacteria 2563
43 Ga0070679_100405791 3300005530 Bacteria 1308
44 Ga0070679_100586175 3300005530 Bacteria 1058
45 Ga0070684_100323108 3300005535 Bacteria 1417
46 Ga0070684_100518682 3300005535 Bacteria 1104
47 Ga0070697_100000134 3300005536 Bacteria 59796
48 Ga0070697_100153736 3300005536 Bacteria 1941
49 Ga0068853_100128145 3300005539 Bacteria 2269
50 Ga0068853_101881990 3300005539 Bacteria 580
51 Ga0070696_100076931 3300005546 Bacteria 2357
52 Ga0068855_100215091 3300005563 Bacteria 2158
53 Ga0068855_100283789 3300005563 Bacteria 1838
54 Ga0068855_100593209 3300005563 Bacteria 1195
55 Ga0070664_100369999 3300005564 Bacteria 1306
56 Ga0070664_100449783 3300005564 Bacteria 1182
57 Ga0068856_100122657 3300005614 Bacteria 2601
58 Ga0068856_100784016 3300005614 Bacteria 973
59 Ga0068856_102098395 3300005614 Bacteria 575
60 Ga0068859_100092134 3300005617 Bacteria 3082
61 Ga0068859_100284992 3300005617 Bacteria 1745
62 Ga0068859_101346876 3300005617 Bacteria 787
63 Ga0068864_100155175 3300005618 Bacteria 2077
64 Ga0068866_10189418 3300005718 Bacteria 1221
65 Ga0068866_10657254 3300005718 Bacteria 714
66 Ga0068861_100395959 3300005719 Bacteria 1224
67 Ga0068863_100011283 3300005841 Bacteria 8655
68 Ga0068863_100480615 3300005841 Bacteria 1222
69 Ga0068860_100000409 3300005843 Bacteria 55861
70 Ga0068860_100020727 3300005843 Bacteria 6368
71 Ga0075364_10346231 3300006051 Bacteria 1013
72 Ga0070712_100786730 3300006175 Bacteria 816
73 Ga0075369_10326383 3300006186 Unclassified 718
74 Ga0097621_100361991 3300006237 Unclassified 1292
75 Ga0097621_100672079 3300006237 Bacteria 952
76 Ga0075428_100068525 3300006844 Bacteria 3881
77 Ga0075428_100444189 3300006844 Bacteria 1389
78 Ga0075430_100002156 3300006846 Bacteria 16291
79 Ga0075430_100069277 3300006846 Bacteria 2959
80 Ga0075431_100003788 3300006847 Bacteria 14700
81 Ga0075431_100088376 3300006847 Bacteria 3198
82 Ga0075431_100152027 3300006847 Bacteria 2383
83 Ga0075434_100635935 3300006871 Unclassified 1085
84 Ga0075434_100943369 3300006871 Bacteria 877
85 Ga0075429_100027917 3300006880 Bacteria 4899
86 Ga0075429_100204718 3300006880 Bacteria 1729
87 Ga0097620_100092135 3300006931 Bacteria 3082
88 Ga0097620_100284978 3300006931 Bacteria 1745
89 Ga0097620_101346519 3300006931 Bacteria 787
90 Ga0105240_10000387 3300009093 Bacteria 82855
91 Ga0105240_10008582 3300009093 Bacteria 14603
92 Ga0105245_10578939 3300009098 Bacteria 1147
93 Ga0105245_10751215 3300009098 Bacteria 1011
94 Ga0105247_10049227 3300009101 Bacteria 2591
95 Ga0105247_10188226 3300009101 Bacteria 1381
96 Ga0105247_11200303 3300009101 Bacteria 604
97 Ga0114129_10056913 3300009147 Bacteria 5474
98 Ga0105243_11080613 3300009148 Bacteria 809
99 Ga0105248_10228063 3300009177 Bacteria 2097
100 Ga0105248_11654929 3300009177 Bacteria 725
101 Ga0105237_10000577 3300009545 Bacteria 51264
102 Ga0105237_10033764 3300009545 Bacteria 5183
103 Ga0105237_10093286 3300009545 Bacteria 3000
104 Ga0105237_10148544 3300009545 Bacteria 2339
105 Ga0105237_10218642 3300009545 Bacteria 1905
106 Ga0105237_11441750 3300009545 Bacteria 695
107 Ga0105237_11733418 3300009545 Bacteria 632
108 Ga0105238_10041626 3300009551 Bacteria 4653
109 Ga0105238_10249716 3300009551 Bacteria 1752
110 Ga0105238_10363295 3300009551 Bacteria 1437
111 Ga0105249_10483939 3300009553 Bacteria 1281
112 Ga0105249_10670202 3300009553 Bacteria 1096
113 Ga0105249_11193000 3300009553 Bacteria 832
114 Ga0105239_10006826 3300010375 Bacteria 13167
115 Ga0105239_10106769 3300010375 Bacteria 3102
116 Ga0105239_10192513 3300010375 Bacteria 2283
117 Ga0105239_10844787 3300010375 Bacteria 1050
118 Ga0105239_11529996 3300010375 Bacteria 771
119 Ga0105246_10272565 3300011119 Bacteria 1353
120 Ga0105246_10963522 3300011119 Bacteria 770
121 Ga0105246_11567946 3300011119 Unclassified 621
122 Ga0157371_10000970 3300013102 Bacteria 31856
123 Ga0157370_10005587 3300013104 Bacteria 14084
124 Ga0157369_10995326 3300013105 Bacteria 858
125 Ga0157374_10248001 3300013296 Bacteria 1752
126 Ga0157374_10939559 3300013296 Bacteria 883
127 Ga0163162_10029156 3300013306 Bacteria 5460
128 Ga0163162_10157318 3300013306 Bacteria 2393
129 Ga0163162_10242894 3300013306 Bacteria 1932
130 Ga0163162_10558177 3300013306 Bacteria 1273
131 Ga0163162_10937889 3300013306 Bacteria 977
132 Ga0157372_10010192 3300013307 Bacteria 9980
133 Ga0157372_10040297 3300013307 Bacteria 5158
134 Ga0157372_10159637 3300013307 Bacteria 2605
135 Ga0157372_10221991 3300013307 Bacteria 2190
136 Ga0157375_11179334 3300013308 Bacteria 898
137 Ga0157375_11735739 3300013308 Unclassified 739
138 Ga0163163_10493502 3300014325 Bacteria 1286
139 Ga0157380_10310114 3300014326 Bacteria 1458
140 Ga0157376_10570137 3300014969 Bacteria 1123
141 Ga0213872_10041452 3300021361 Bacteria 2101
142 Ga0213875_10076308 3300021388 Bacteria 1564
143 Ga0209436_100008 3300025208 Bacteria 145772
144 Ga0209129_1006573 3300025258 Bacteria 3711
145 Ga0209233_1012021 3300025261 Bacteria 2525
146 Ga0209673_1005252 3300025273 Bacteria 6583
147 Ga0209130_1000019 3300025284 Bacteria 381993
148 Ga0209758_1000482 3300025297 Bacteria 65578
149 Ga0209758_1001785 3300025297 Bacteria 23762
150 Ga0209050_1000118 3300025298 Bacteria 202586
151 Ga0209256_1001370 3300025299 Bacteria 25604
152 Ga0207426_1000005 3300025302 Bacteria 1037188
153 Ga0209051_1045927 3300025303 Bacteria 1507
154 Ga0209051_1086351 3300025303 Bacteria 887
155 Ga0209257_1012202 3300025304 Bacteria 4011
156 Ga0209257_1025243 3300025304 Bacteria 2035
157 Ga0207692_10460619 3300025898 Bacteria 802
158 Ga0207710_10056563 3300025900 Bacteria 1770
159 Ga0207710_10134560 3300025900 Bacteria 1189
160 Ga0207680_10294643 3300025903 Bacteria 1130
161 Ga0207699_10199720 3300025906 Bacteria 1354
162 Ga0207645_10056934 3300025907 Bacteria 2496
163 Ga0207645_10080974 3300025907 Bacteria 2081
164 Ga0207684_10533340 3300025910 Unclassified 1005
165 Ga0207707_10073098 3300025912 Bacteria 2989
166 Ga0207695_10000510 3300025913 Bacteria 82650
167 Ga0207695_10013567 3300025913 Bacteria 9705
168 Ga0207695_11262181 3300025913 Bacteria 619
169 Ga0207671_10001317 3300025914 Bacteria 29052
170 Ga0207671_10110525 3300025914 Bacteria 2091
171 Ga0207671_10110669 3300025914 Bacteria 2089
172 Ga0207671_10144338 3300025914 Bacteria 1835
173 Ga0207671_10222457 3300025914 Bacteria 1479
174 Ga0207671_10255243 3300025914 Bacteria 1379
175 Ga0207671_11271100 3300025914 Bacteria 574
176 Ga0207662_10074683 3300025918 Bacteria 2058
177 Ga0207657_10127125 3300025919 Bacteria 2093
178 Ga0207652_10255302 3300025921 Bacteria 1581
179 Ga0207652_10368999 3300025921 Bacteria 1296
180 Ga0207646_10572368 3300025922 Bacteria 1015
181 Ga0207694_10030482 3300025924 Bacteria 4120
182 Ga0207694_10589468 3300025924 Unclassified 935
183 Ga0207694_10703147 3300025924 Bacteria 852
184 Ga0207650_10049831 3300025925 Bacteria 3094
185 Ga0207659_10008810 3300025926 Bacteria 6286
186 Ga0207687_10023885 3300025927 Bacteria 4079
187 Ga0207687_10524450 3300025927 Bacteria 991
188 Ga0207700_10295647 3300025928 Bacteria 1397
189 Ga0207700_11218538 3300025928 Bacteria 672
190 Ga0207690_10155829 3300025932 Bacteria 1698
191 Ga0207706_10708169 3300025933 Bacteria 860
192 Ga0207709_10504770 3300025935 Bacteria 944
193 Ga0207661_10376876 3300025944 Bacteria 1284
194 Ga0207661_11089643 3300025944 Bacteria 735
195 Ga0207679_10207497 3300025945 Bacteria 1641
196 Ga0207667_10193710 3300025949 Bacteria 2085
197 Ga0207667_10259506 3300025949 Bacteria 1777
198 Ga0207667_10630646 3300025949 Bacteria 1079
199 Ga0207712_11040755 3300025961 Bacteria 727
200 Ga0207668_10109172 3300025972 Bacteria 2072
201 Ga0207658_10373905 3300025986 Bacteria 1246
202 Ga0207677_10233552 3300026023 Bacteria 1483
203 Ga0207677_11113454 3300026023 Unclassified 720
204 Ga0207639_10693256 3300026041 Bacteria 945
205 Ga0207678_10218039 3300026067 Bacteria 1633
206 Ga0207678_10447323 3300026067 Bacteria 1123
207 Ga0207678_10912974 3300026067 Bacteria 777
208 Ga0207702_10879601 3300026078 Unclassified 887
209 Ga0207702_10972799 3300026078 Bacteria 842
210 Ga0207641_10302133 3300026088 Bacteria 1512
211 Ga0207641_10333409 3300026088 Bacteria 1442
212 Ga0207676_11251105 3300026095 Bacteria 736
213 Ga0207676_12160954 3300026095 Unclassified 555
214 Ga0207675_100109235 3300026118 Bacteria 2609
215 Ga0207683_10041344 3300026121 Bacteria 4025
216 Ga0207698_10430595 3300026142 Bacteria 1268
217 Ga0207428_10710994 3300027907 Bacteria 718
218 Ga0268266_10053276 3300028379 Bacteria 3475
219 Ga0268265_10297667 3300028380 Bacteria 1451
220 Ga0268264_10000020 3300028381 Bacteria 483593
221 Ga0268264_10018924 3300028381 Bacteria 5630
222 Ga0268264_10157935 3300028381 Bacteria 2040
223 Ga0265338_10768052 3300028800 Unclassified 662
224 Ga0307511_10122791 3300030521 Bacteria 1598
225 Ga0265340_10055886 3300031247 Bacteria 1900
226 Ga0265340_10197525 3300031247 Bacteria 905
227 Ga0265339_10004757 3300031249 Bacteria 9201
228 Ga0265327_10000700 3300031251 Bacteria 53289
229 Ga0265327_10008846 3300031251 Bacteria 7405
230 Ga0265316_10392689 3300031344 Bacteria 1000
231 Ga0307508_10002697 3300031616 Bacteria 18577
232 Ga0307508_10050769 3300031616 Bacteria 3689
233 Ga0307516_10109930 3300031730 Bacteria 2561
234 Ga0307516_10302747 3300031730 Bacteria 1274
235 Ga0307410_10315337 3300031852 Bacteria 1239
236 Ga0307410_10733271 3300031852 Bacteria 835
237 Ga0307406_10150611 3300031901 Bacteria 1659
238 Ga0307412_10877670 3300031911 Bacteria 784
239 Ga0307414_10237059 3300032004 Bacteria 1508
240 Ga0307414_10258490 3300032004 Bacteria 1452
241 Ga0307507_10037052 3300033179 Bacteria 4969
242 Ga0373934_0428774 3300035086 Bacteria 554
243 Ga0373923_0054514 3300035111 Bacteria 1683
244 Ga0373939_0275544 3300035114 Bacteria 663
245 Ga0373954_0226881 3300035118 Bacteria 919
246 Ga0373935_0442052 3300035692 Bacteria 938
247 Ga0373927_0026021 3300035695 Bacteria 3825
248 Ga0373927_0961661 3300035695 Bacteria 563
249 Ga0373933_0209009 3300035724 Bacteria 1250
250 Ga0373937_0167001 3300036401 Bacteria 2064
251 Ga0373925_0326716 3300037068 Bacteria 1242
252 Ga0395900_0446094 3300037418 Bacteria 1251
253 Ga0395898_0281014 3300037466 Bacteria 1588
254 Ga0395898_0292757 3300037466 Bacteria 1553
255 Ga0395898_0737097 3300037466 Bacteria 927
256 Ga0395905_0304386 3300037471 Bacteria 1482
257 Ga0436364_0175813 3300037853 Bacteria 7662
258 Ga0436364_0714717 3300037853 Unclassified 2107
259 Ga0400490_44737 3300038726 Bacteria 17097
260 Ga0436365_1354402 3300039437 Bacteria 1642
261 Ga0436365_1604306 3300039437 Bacteria 1211
262 Ga0451833_0229023 3300041491 Bacteria 2597
263 Ga0451833_0840808 3300041491 Bacteria 6215
264 Ga0451833_0878483 3300041491 Bacteria 2744
265 Ga0451837_0108500 3300041494 Bacteria 1480
266 Ga0451841_0858756 3300041498 Bacteria 837
267 Ga0451849_1220883 3300041505 Bacteria 1124
268 Ga0451851_1279256 3300041507 Bacteria 943
269 Ga0451843_0546128 3300041509 Bacteria 4688
270 Ga0451853_0183479 3300041512 Bacteria 8539
271 Ga0451853_0299950 3300041512 Bacteria 8155
272 Ga0451853_3672779 3300041512 Bacteria 702
273 Ga0439457_049868 3300042014 Unclassified 939
274 Ga0466972_0000047 3300044658 Bacteria 122901
275 Ga0466966_0069528 3300044684 Bacteria 2209
276 Ga0466961_0112628 3300044693 Bacteria 1711
277 Ga0453684_0682643 3300044712 Bacteria 1118
278 Ga0453684_1100977 3300044712 Unclassified 839
279 Ga0466957_0095656 3300044842 Bacteria 1866
280 Ga0466959_0007439 3300045049 Bacteria 7683
281 Ga0451576_0035399 3300045051 Bacteria 5297
282 Ga0451576_1293796 3300045051 Bacteria 760
283 Ga0466967_0489605 3300045976 Bacteria 1206
284 Ga0466967_0511721 3300045976 Bacteria 1179
285 Ga0495629_0835838 3300046459 Bacteria 606
286 Ga0495662_0291173 3300046476 Bacteria 804
287 Ga0495616_0093175 3300046513 Bacteria 1423
288 Ga0495630_0152626 3300046517 Bacteria 1758
289 Ga0495643_0015619 3300046522 Bacteria 4481
290 Ga0495643_0147890 3300046522 Bacteria 1166
291 Ga0495643_0309863 3300046522 Bacteria 717
292 Ga0495648_0008505 3300046524 Bacteria 8067
293 Ga0495666_0185131 3300046526 Bacteria 961
294 Ga0495642_0018271 3300046528 Bacteria 2744
295 Ga0495652_0690557 3300046529 Bacteria 688
296 Ga0495622_0176958 3300046557 Bacteria 958
297 Ga0495656_0088073 3300046615 Bacteria 1415
298 Ga0495656_0125281 3300046615 Bacteria 1217
299 Ga0495634_0053809 3300046642 Bacteria 2695
300 Ga0495611_0204606 3300046648 Bacteria 920
301 Ga0495625_0194401 3300046660 Bacteria 1342
302 Ga0495635_1064523 3300046663 Bacteria 513
303 Ga0495658_0217567 3300046683 Bacteria 1195
304 Ga0495669_0261732 3300046684 Bacteria 831
305 Ga0495624_0102393 3300046690 Bacteria 1763
306 Ga0495671_0500014 3300046692 Unclassified 580
307 Ga0495649_0021712 3300046694 Bacteria 3596
308 Ga0495649_0028845 3300046694 Bacteria 3076
309 Ga0495581_0083441 3300047315 Bacteria 1851
310 Ga0495674_0057245 3300047319 Bacteria 3412
311 Ga0495672_0007947 3300047320 Bacteria 7909
312 Ga0495684_0286848 3300047471 Bacteria 1186
313 Ga0495686_0504089 3300047472 Bacteria 637
314 Ga0496101_0751151 3300048904 Bacteria 770
315 Ga0496102_0044391 3300048905 Bacteria 4034
316 Ga0496102_0064999 3300048905 Bacteria 3343
317 Ga0496103_0018310 3300048906 Bacteria 4201
318 Ga0496106_0001723 3300048909 Bacteria 16311
319 Ga0496106_1323987 3300048909 Bacteria 559
320 Ga0496107_1115896 3300048910 Bacteria 569
321 Ga0496109_0400683 3300048912 Bacteria 1296
322 Ga0496112_0324861 3300048915 Bacteria 1483
323 Ga0496113_0485009 3300048916 Bacteria 993
324 Ga0496116_0011406 3300048919 Bacteria 7361
325 Ga0496117_0016688 3300048920 Bacteria 6178
326 Ga0496118_0013737 3300048921 Bacteria 7637
327 Ga0496120_0103203 3300048923 Bacteria 1503
328 Ga0496120_0206782 3300048923 Bacteria 947
329 Ga0496121_0001584 3300048924 Bacteria 37864
330 Ga0496121_0003087 3300048924 Bacteria 24109
331 Ga0496121_0004902 3300048924 Bacteria 17563
332 Ga0496121_0111065 3300048924 Bacteria 2091
333 Ga0496121_0176191 3300048924 Bacteria 1548
334 Ga0496121_0226789 3300048924 Bacteria 1311
335 Ga0496122_0134578 3300048925 Bacteria 1561
336 Ga0496124_0008891 3300048927 Bacteria 10417
337 Ga0496124_0067575 3300048927 Bacteria 2974
338 Ga0496125_0039879 3300048928 Bacteria 4036
339 Ga0496125_0046312 3300048928 Bacteria 3649
340 Ga0496126_0005136 3300048929 Bacteria 15157
341 Ga0496126_0025679 3300048929 Bacteria 5662
342 Ga0496126_0295263 3300048929 Bacteria 1339
343 Ga0496126_0332095 3300048929 Bacteria 1247
344 Ga0496126_0513151 3300048929 Bacteria 956
345 Ga0496126_0696739 3300048929 Bacteria 790
346 Ga0501033_0001075 3300049570 Bacteria 24806
347 Ga0501034_0144985 3300049571 Bacteria 2352
348 Ga0501034_0663545 3300049571 Bacteria 944
349 Ga0501038_0935536 3300049574 Bacteria 639
350 Ga0501040_0150605 3300049576 Bacteria 1641
351 Ga0501043_0590467 3300049579 Bacteria 821
352 Ga0501046_0062135 3300049580 Bacteria 2919
353 Ga0501046_0195495 3300049580 Bacteria 1507
354 Ga0501047_0013983 3300049581 Bacteria 7626
355 Ga0501047_0022387 3300049581 Bacteria 6069
356 Ga0501070_0047520 3300049586 Bacteria 3566
357 Ga0501073_0025069 3300049589 Bacteria 4281
358 Ga0501073_0387319 3300049589 Bacteria 966
359 Ga0501075_0058038 3300049591 Bacteria 2915
360 Ga0501075_0326563 3300049591 Unclassified 1169
361 Ga0501076_0215328 3300049592 Bacteria 1570
362 Ga0501077_0074983 3300049593 Unclassified 2142
363 Ga0501077_0239540 3300049593 Bacteria 1153
364 Ga0501243_000169 3300049675 Bacteria 7631
365 Ga0501225_0000857 3300049705 Bacteria 9446
366 Ga0501079_0139066 3300049741 Bacteria 1891
367 Ga0501080_0033362 3300049742 Bacteria 4804
368 Ga0501080_0109716 3300049742 Bacteria 2558
369 Ga0501080_0387404 3300049742 Bacteria 1259
370 Ga0501080_0473225 3300049742 Bacteria 1121
371 Ga0501080_0675289 3300049742 Bacteria 913
372 Ga0501081_0104577 3300049743 Unclassified 2005
373 Ga0501035_0263938 3300049822 Bacteria 1459
374 Ga0501044_0000106 3300049823 Bacteria 101709
375 Ga0501044_0037681 3300049823 Bacteria 5053
376 Ga0501044_0055787 3300049823 Bacteria 4057
377 Ga0501044_0261420 3300049823 Bacteria 1669
378 Ga0501045_0215420 3300049824 Bacteria 1430
379 nmdc:mga0k408_49682_c1 3300050493 Unclassified 2428
380 nmdc:mga04h51_234906_c1 3300050495 Bacteria 730
381 nmdc:mga07m45_268022_c1 3300050496 Bacteria 993
382 nmdc:mga05p37_99563_c1 3300050507 Bacteria 3580
383 nmdc:mga09592_144384_c1 3300050508 Bacteria 2052
384 nmdc:mga09592_58055_c2 3300050508 Bacteria 1760
385 nmdc:mga09592_738854_c1 3300050508 Bacteria 836
386 nmdc:mga0qj67_11370_c1 3300050509 Bacteria 6669
387 nmdc:mga0qj67_12709_c1 3300050509 Bacteria 6350
388 nmdc:mga0qj67_4133_c1 3300050509 Bacteria 10522
389 nmdc:mga06r32_182978_c1 3300050510 Bacteria 2082
390 nmdc:mga06r32_39668_c1 3300050510 Bacteria 4469
391 nmdc:mga06r32_910_c1 3300050510 Bacteria 26293
392 nmdc:mga08y16_118761_c1 3300050511 Bacteria 2752
393 nmdc:mga0sz30_298689_c1 3300050516 Unclassified 718
394 Ga0500578_0023317 3300053086 Bacteria 3974
395 Ga0500646_0000534 3300053090 Bacteria 11120
396 Ga0500566_0098815 3300053094 Bacteria 1603
397 Ga0500556_0090495 3300053104 Bacteria 1168
398 Ga0500557_000007 3300053105 Bacteria 136781
399 Ga0500572_209464 3300053111 Bacteria 638
400 Ga0500592_038011 3300053116 Unclassified 778
401 Ga0500595_021265 3300053119 Bacteria 2319
402 Ga0500658_0210204 3300053134 Bacteria 891
403 Ga0500658_0536082 3300053134 Bacteria 528
404 Ga0500568_0000217 3300053139 Bacteria 49245
405 Ga0500590_137740 3300053148 Bacteria 1120
406 Ga0500616_0050233 3300053153 Unclassified 2203
407 Ga0500622_0000092 3300053156 Bacteria 92830
408 Ga0500622_0032206 3300053156 Bacteria 2748
409 Ga0500633_0000096 3300053160 Bacteria 12355
410 Ga0500633_0305871 3300053160 Unclassified 584
411 Ga0500637_0017173 3300053178 Bacteria 3871
412 Ga0500625_006466 3300053729 Bacteria 4995
413 Ga0500601_024969 3300053737 Bacteria 696
414 Ga0501084_0003367 3300054114 Bacteria 12948
415 Ga0501084_0743456 3300054114 Unclassified 827
416 Ga0501082_0084620 3300060353 Unclassified 2735
417 Ga0501082_1231908 3300060353 Unclassified 654
418 Ga0530510_1066525 3300061734 Unclassified 619

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035114 Ga0373939_0275544 Ga0373939_0275544_251_649 122
2 3300050508 nmdc:mga09592_738854_c1 nmdc:mga09592_738854_c1_372_782 124
3 3300013307 Ga0157372_10159637 Ga0157372_101596372 126
4 3300005289 Ga0065704_10098741 Ga0065704_100987413 129
5 3300013102 Ga0157371_10000970 Ga0157371_100009708 129
6 3300013104 Ga0157370_10005587 Ga0157370_1000558711 129
7 3300025928 Ga0207700_10295647 Ga0207700_102956472 132
8 3300048915 Ga0496112_0324861 Ga0496112_0324861_252_797 133
9 3300025303 Ga0209051_1086351 Ga0209051_10863512 135
10 3300041491 Ga0451833_0229023 Ga0451833_0229023_1776_2261 135
11 3300041491 Ga0451833_0840808 Ga0451833_0840808_4862_5347 135
12 3300041498 Ga0451841_0858756 Ga0451841_0858756_161_646 135
13 3300041507 Ga0451851_1279256 Ga0451851_1279256_156_641 135
14 3300041512 Ga0451853_0183479 Ga0451853_0183479_1056_1541 135
15 3300041512 Ga0451853_0299950 Ga0451853_0299950_1595_2080 135
16 3300031730 Ga0307516_10109930 Ga0307516_101099302 136
17 3300053134 Ga0500658_0536082 Ga0500658_0536082_52_516 136
18 3300013307 Ga0157372_10010192 Ga0157372_100101923 137
19 3300049574 Ga0501038_0935536 Ga0501038_0935536_156_608 137
20 3300049742 Ga0501080_0109716 Ga0501080_0109716_52_504 137
21 3300049742 Ga0501080_0387404 Ga0501080_0387404_591_1043 137
22 3300049823 Ga0501044_0261420 Ga0501044_0261420_902_1354 137
23 3300005564 Ga0070664_100449783 Ga0070664_1004497832 138
24 3300010375 Ga0105239_10844787 Ga0105239_108447872 138
25 3300041509 Ga0451843_0546128 Ga0451843_0546128_2411_2878 138
26 3300049571 Ga0501034_0144985 Ga0501034_0144985_1543_1995 138
27 3300049823 Ga0501044_0055787 Ga0501044_0055787_3349_3801 138
28 3300035692 Ga0373935_0442052 Ga0373935_0442052_225_677 141
29 3300035695 Ga0373927_0026021 Ga0373927_0026021_1620_2072 141
30 3300042014 Ga0439457_049868 Ga0439457_049868_460_921 141
31 3300046557 Ga0495622_0176958 Ga0495622_0176958_205_657 141
32 3300048909 Ga0496106_0001723 Ga0496106_0001723_11087_11539 141
33 3300048920 Ga0496117_0016688 Ga0496117_0016688_656_1108 141
34 3300048921 Ga0496118_0013737 Ga0496118_0013737_7136_7588 141
35 3300048923 Ga0496120_0206782 Ga0496120_0206782_243_695 141
36 3300048924 Ga0496121_0003087 Ga0496121_0003087_4800_5252 141
37 3300048927 Ga0496124_0008891 Ga0496124_0008891_3422_3874 141
38 3300048928 Ga0496125_0039879 Ga0496125_0039879_2025_2477 141
39 3300048929 Ga0496126_0005136 Ga0496126_0005136_3103_3555 141
40 3300049705 Ga0501225_0000857 Ga0501225_0000857_6790_7251 141
41 3300053094 Ga0500566_0098815 Ga0500566_0098815_827_1279 141
42 3300053119 Ga0500595_021265 Ga0500595_021265_100_552 141
43 3300053148 Ga0500590_137740 Ga0500590_137740_595_1047 141
44 3300053178 Ga0500637_0017173 Ga0500637_0017173_107_559 141
45 3300005618 Ga0068864_100155175 Ga0068864_1001551752 142
46 3300006051 Ga0075364_10346231 Ga0075364_103462312 142
47 3300006186 Ga0075369_10326383 Ga0075369_103263832 142
48 3300025304 Ga0209257_1025243 Ga0209257_10252432 142
49 3300046522 Ga0495643_0309863 Ga0495643_0309863_230_658 142
50 3300046694 Ga0495649_0028845 Ga0495649_0028845_2427_2891 142
51 3300047472 Ga0495686_0504089 Ga0495686_0504089_163_627 142
52 3300048919 Ga0496116_0011406 Ga0496116_0011406_4702_5205 142
53 3300048924 Ga0496121_0004902 Ga0496121_0004902_7225_7728 142
54 3300048925 Ga0496122_0134578 Ga0496122_0134578_599_1102 142
55 3300048928 Ga0496125_0046312 Ga0496125_0046312_1986_2441 142
56 3300050495 nmdc:mga04h51_234906_c1 nmdc:mga04h51_234906_c1_32_487 142
57 3300050496 nmdc:mga07m45_268022_c1 nmdc:mga07m45_268022_c1_317_772 142
58 3300050516 nmdc:mga0sz30_298689_c1 nmdc:mga0sz30_298689_c1_44_547 142
59 3300005331 Ga0070670_100206532 Ga0070670_1002065322 143
60 3300005841 Ga0068863_100480615 Ga0068863_1004806152 143
61 3300005843 Ga0068860_100000409 Ga0068860_10000040916 143
62 3300006844 Ga0075428_100068525 Ga0075428_1000685252 143
63 3300006844 Ga0075428_100444189 Ga0075428_1004441892 143
64 3300006846 Ga0075430_100069277 Ga0075430_1000692772 143
65 3300006847 Ga0075431_100088376 Ga0075431_1000883763 143
66 3300006847 Ga0075431_100152027 Ga0075431_1001520272 143
67 3300006880 Ga0075429_100027917 Ga0075429_1000279173 143
68 3300009101 Ga0105247_10188226 Ga0105247_101882262 143
69 3300009553 Ga0105249_10483939 Ga0105249_104839392 143
70 3300014326 Ga0157380_10310114 Ga0157380_103101141 143
71 3300025900 Ga0207710_10056563 Ga0207710_100565632 143
72 3300025907 Ga0207645_10056934 Ga0207645_100569343 143
73 3300025925 Ga0207650_10049831 Ga0207650_100498313 143
74 3300025928 Ga0207700_11218538 Ga0207700_112185382 143
75 3300026088 Ga0207641_10333409 Ga0207641_103334092 143
76 3300026121 Ga0207683_10041344 Ga0207683_100413443 143
77 3300027907 Ga0207428_10710994 Ga0207428_107109942 143
78 3300028381 Ga0268264_10000020 Ga0268264_1000002028 143
79 3300048923 Ga0496120_0103203 Ga0496120_0103203_818_1276 143
80 3300048924 Ga0496121_0111065 Ga0496121_0111065_267_725 143
81 3300048929 Ga0496126_0332095 Ga0496126_0332095_631_1089 143
82 3300049593 Ga0501077_0239540 Ga0501077_0239540_312_779 143
83 3300050508 nmdc:mga09592_144384_c1 nmdc:mga09592_144384_c1_1432_1899 143
84 3300050509 nmdc:mga0qj67_11370_c1 nmdc:mga0qj67_11370_c1_3673_4140 143
85 3300050509 nmdc:mga0qj67_12709_c1 nmdc:mga0qj67_12709_c1_3664_4131 143
86 3300050510 nmdc:mga06r32_182978_c1 nmdc:mga06r32_182978_c1_255_722 143
87 3300050510 nmdc:mga06r32_39668_c1 nmdc:mga06r32_39668_c1_2566_3033 143
88 3300050511 nmdc:mga08y16_118761_c1 nmdc:mga08y16_118761_c1_2211_2675 143
89 3300003323 rootH1_10007743 rootH1_1000774316 144
90 3300005467 Ga0070706_100062307 Ga0070706_1000623073 144
91 3300005468 Ga0070707_100617917 Ga0070707_1006179172 144
92 3300005518 Ga0070699_100098442 Ga0070699_1000984422 144
93 3300005536 Ga0070697_100153736 Ga0070697_1001537362 144
94 3300005617 Ga0068859_100284992 Ga0068859_1002849922 144
95 3300005718 Ga0068866_10189418 Ga0068866_101894182 144
96 3300006931 Ga0097620_100284978 Ga0097620_1002849782 144
97 3300009177 Ga0105248_11654929 Ga0105248_116549291 144
98 3300025922 Ga0207646_10572368 Ga0207646_105723681 144
99 3300041491 Ga0451833_0878483 Ga0451833_0878483_2159_2644 144
100 3300041494 Ga0451837_0108500 Ga0451837_0108500_746_1231 144
101 3300041505 Ga0451849_1220883 Ga0451849_1220883_109_594 144
102 3300044658 Ga0466972_0000047 Ga0466972_0000047_91500_91964 144
103 3300049576 Ga0501040_0150605 Ga0501040_0150605_10_477 144
104 3300049591 Ga0501075_0058038 Ga0501075_0058038_97_564 144
105 3300049591 Ga0501075_0326563 Ga0501075_0326563_118_585 144
106 3300049592 Ga0501076_0215328 Ga0501076_0215328_191_658 144
107 3300049593 Ga0501077_0074983 Ga0501077_0074983_330_797 144
108 3300049741 Ga0501079_0139066 Ga0501079_0139066_879_1346 144
109 3300049742 Ga0501080_0675289 Ga0501080_0675289_204_671 144
110 3300049743 Ga0501081_0104577 Ga0501081_0104577_934_1401 144
111 3300049822 Ga0501035_0263938 Ga0501035_0263938_39_473 144
112 3300049824 Ga0501045_0215420 Ga0501045_0215420_824_1291 144
113 3300053086 Ga0500578_0023317 Ga0500578_0023317_1695_2159 144
114 3300053090 Ga0500646_0000534 Ga0500646_0000534_5792_6256 144
115 3300053105 Ga0500557_000007 Ga0500557_000007_112258_112719 144
116 3300053729 Ga0500625_006466 Ga0500625_006466_2785_3246 144
117 3300053737 Ga0500601_024969 Ga0500601_024969_213_674 144
118 3300054114 Ga0501084_0003367 Ga0501084_0003367_12146_12613 144
119 3300054114 Ga0501084_0743456 Ga0501084_0743456_122_589 144
120 3300060353 Ga0501082_0084620 Ga0501082_0084620_2202_2669 144
121 3300005328 Ga0070676_10406023 Ga0070676_104060231 145
122 3300005354 Ga0070675_100089511 Ga0070675_1000895113 145
123 3300005367 Ga0070667_100071921 Ga0070667_1000719211 145
124 3300005539 Ga0068853_100128145 Ga0068853_1001281451 145
125 3300005546 Ga0070696_100076931 Ga0070696_1000769313 145
126 3300005563 Ga0068855_100215091 Ga0068855_1002150912 145
127 3300005617 Ga0068859_100092134 Ga0068859_1000921342 145
128 3300005718 Ga0068866_10657254 Ga0068866_106572541 145
129 3300006931 Ga0097620_100092135 Ga0097620_1000921352 145
130 3300009098 Ga0105245_10578939 Ga0105245_105789392 145
131 3300009098 Ga0105245_10751215 Ga0105245_107512152 145
132 3300009545 Ga0105237_10148544 Ga0105237_101485442 145
133 3300009551 Ga0105238_10041626 Ga0105238_100416262 145
134 3300013296 Ga0157374_10248001 Ga0157374_102480012 145
135 3300013306 Ga0163162_10937889 Ga0163162_109378892 145
136 3300021388 Ga0213875_10076308 Ga0213875_100763082 145
137 3300025914 Ga0207671_10222457 Ga0207671_102224572 145
138 3300025924 Ga0207694_10030482 Ga0207694_100304824 145
139 3300025926 Ga0207659_10008810 Ga0207659_100088106 145
140 3300025927 Ga0207687_10023885 Ga0207687_100238853 145
141 3300025927 Ga0207687_10524450 Ga0207687_105244502 145
142 3300025944 Ga0207661_10376876 Ga0207661_103768762 145
143 3300025949 Ga0207667_10259506 Ga0207667_102595062 145
144 3300025961 Ga0207712_11040755 Ga0207712_110407552 145
145 3300025986 Ga0207658_10373905 Ga0207658_103739051 145
146 3300026067 Ga0207678_10912974 Ga0207678_109129742 145
147 3300031251 Ga0265327_10008846 Ga0265327_100088463 145
148 3300031616 Ga0307508_10002697 Ga0307508_1000269711 145
149 3300037853 Ga0436364_0714717 Ga0436364_0714717_565_1059 145
150 3300046526 Ga0495666_0185131 Ga0495666_0185131_166_630 145
151 3300046660 Ga0495625_0194401 Ga0495625_0194401_64_528 145
152 3300049571 Ga0501034_0663545 Ga0501034_0663545_136_600 145
153 3300053116 Ga0500592_038011 Ga0500592_038011_209_673 145
154 3300060353 Ga0501082_1231908 Ga0501082_1231908_95_562 145
155 3300061734 Ga0530510_1066525 Ga0530510_1066525_85_552 145
156 3300003215 JGI25153J46596_10000744 JGI25153J46596_1000074414 146
157 3300003322 rootL2_10120629 rootL2_101206292 146
158 3300005293 Ga0065715_10003750 Ga0065715_100037505 146
159 3300005329 Ga0070683_100512247 Ga0070683_1005122472 146
160 3300005335 Ga0070666_10385635 Ga0070666_103856351 146
161 3300005336 Ga0070680_100215403 Ga0070680_1002154032 146
162 3300005338 Ga0068868_100172436 Ga0068868_1001724362 146
163 3300005341 Ga0070691_10184160 Ga0070691_101841602 146
164 3300005343 Ga0070687_100028037 Ga0070687_1000280372 146
165 3300005434 Ga0070709_10264137 Ga0070709_102641372 146
166 3300005455 Ga0070663_100449891 Ga0070663_1004498912 146
167 3300005458 Ga0070681_10093572 Ga0070681_100935722 146
168 3300005458 Ga0070681_10114783 Ga0070681_101147833 146
169 3300005530 Ga0070679_100405791 Ga0070679_1004057911 146
170 3300005530 Ga0070679_100586175 Ga0070679_1005861752 146
171 3300005535 Ga0070684_100323108 Ga0070684_1003231082 146
172 3300005563 Ga0068855_100283789 Ga0068855_1002837892 146
173 3300005614 Ga0068856_102098395 Ga0068856_1020983951 146
174 3300005843 Ga0068860_100020727 Ga0068860_1000207275 146
175 3300006175 Ga0070712_100786730 Ga0070712_1007867302 146
176 3300006237 Ga0097621_100361991 Ga0097621_1003619912 146
177 3300006237 Ga0097621_100672079 Ga0097621_1006720792 146
178 3300009093 Ga0105240_10008582 Ga0105240_100085825 146
179 3300009101 Ga0105247_11200303 Ga0105247_112003031 146
180 3300009545 Ga0105237_10000577 Ga0105237_1000057727 146
181 3300009545 Ga0105237_10033764 Ga0105237_100337645 146
182 3300009545 Ga0105237_10093286 Ga0105237_100932862 146
183 3300009545 Ga0105237_10218642 Ga0105237_102186422 146
184 3300009551 Ga0105238_10363295 Ga0105238_103632952 146
185 3300010375 Ga0105239_10006826 Ga0105239_100068268 146
186 3300010375 Ga0105239_10106769 Ga0105239_101067692 146
187 3300013306 Ga0163162_10242894 Ga0163162_102428941 146
188 3300013306 Ga0163162_10558177 Ga0163162_105581772 146
189 3300021361 Ga0213872_10041452 Ga0213872_100414522 146
190 3300025261 Ga0209233_1012021 Ga0209233_10120212 146
191 3300025297 Ga0209758_1000482 Ga0209758_100048234 146
192 3300025297 Ga0209758_1001785 Ga0209758_10017859 146
193 3300025898 Ga0207692_10460619 Ga0207692_104606192 146
194 3300025906 Ga0207699_10199720 Ga0207699_101997202 146
195 3300025912 Ga0207707_10073098 Ga0207707_100730982 146
196 3300025913 Ga0207695_10013567 Ga0207695_100135674 146
197 3300025913 Ga0207695_11262181 Ga0207695_112621812 146
198 3300025914 Ga0207671_10001317 Ga0207671_1000131711 146
199 3300025914 Ga0207671_10110525 Ga0207671_101105252 146
200 3300025914 Ga0207671_10110669 Ga0207671_101106692 146
201 3300025914 Ga0207671_10144338 Ga0207671_101443382 146
202 3300025918 Ga0207662_10074683 Ga0207662_100746831 146
203 3300025921 Ga0207652_10255302 Ga0207652_102553022 146
204 3300025921 Ga0207652_10368999 Ga0207652_103689992 146
205 3300025924 Ga0207694_10703147 Ga0207694_107031472 146
206 3300025944 Ga0207661_11089643 Ga0207661_110896432 146
207 3300025949 Ga0207667_10193710 Ga0207667_101937102 146
208 3300026023 Ga0207677_11113454 Ga0207677_111134542 146
209 3300026067 Ga0207678_10447323 Ga0207678_104473232 146
210 3300028381 Ga0268264_10018924 Ga0268264_100189245 146
211 3300028381 Ga0268264_10157935 Ga0268264_101579352 146
212 3300030521 Ga0307511_10122791 Ga0307511_101227912 146
213 3300031247 Ga0265340_10055886 Ga0265340_100558862 146
214 3300031249 Ga0265339_10004757 Ga0265339_100047575 146
215 3300031616 Ga0307508_10050769 Ga0307508_100507692 146
216 3300031730 Ga0307516_10302747 Ga0307516_103027472 146
217 3300033179 Ga0307507_10037052 Ga0307507_100370524 146
218 3300035086 Ga0373934_0428774 Ga0373934_0428774_59_526 146
219 3300035111 Ga0373923_0054514 Ga0373923_0054514_406_873 146
220 3300035118 Ga0373954_0226881 Ga0373954_0226881_397_864 146
221 3300035695 Ga0373927_0961661 Ga0373927_0961661_33_500 146
222 3300035724 Ga0373933_0209009 Ga0373933_0209009_771_1238 146
223 3300036401 Ga0373937_0167001 Ga0373937_0167001_1078_1545 146
224 3300037068 Ga0373925_0326716 Ga0373925_0326716_739_1206 146
225 3300037418 Ga0395900_0446094 Ga0395900_0446094_617_1084 146
226 3300037466 Ga0395898_0281014 Ga0395898_0281014_53_520 146
227 3300037466 Ga0395898_0292757 Ga0395898_0292757_219_686 146
228 3300037853 Ga0436364_0175813 Ga0436364_0175813_3434_3901 146
229 3300039437 Ga0436365_1354402 Ga0436365_1354402_966_1433 146
230 3300039437 Ga0436365_1604306 Ga0436365_1604306_390_857 146
231 3300044684 Ga0466966_0069528 Ga0466966_0069528_1298_1765 146
232 3300044693 Ga0466961_0112628 Ga0466961_0112628_583_1050 146
233 3300044842 Ga0466957_0095656 Ga0466957_0095656_206_673 146
234 3300045049 Ga0466959_0007439 Ga0466959_0007439_1856_2323 146
235 3300045976 Ga0466967_0489605 Ga0466967_0489605_592_1059 146
236 3300045976 Ga0466967_0511721 Ga0466967_0511721_248_715 146
237 3300046459 Ga0495629_0835838 Ga0495629_0835838_110_577 146
238 3300046476 Ga0495662_0291173 Ga0495662_0291173_112_579 146
239 3300046517 Ga0495630_0152626 Ga0495630_0152626_626_1093 146
240 3300046522 Ga0495643_0015619 Ga0495643_0015619_3856_4368 146
241 3300046524 Ga0495648_0008505 Ga0495648_0008505_6307_6774 146
242 3300046529 Ga0495652_0690557 Ga0495652_0690557_23_490 146
243 3300046642 Ga0495634_0053809 Ga0495634_0053809_1343_1810 146
244 3300046663 Ga0495635_1064523 Ga0495635_1064523_33_500 146
245 3300046683 Ga0495658_0217567 Ga0495658_0217567_263_730 146
246 3300046690 Ga0495624_0102393 Ga0495624_0102393_849_1316 146
247 3300047315 Ga0495581_0083441 Ga0495581_0083441_130_597 146
248 3300047319 Ga0495674_0057245 Ga0495674_0057245_1323_1790 146
249 3300047320 Ga0495672_0007947 Ga0495672_0007947_256_723 146
250 3300047471 Ga0495684_0286848 Ga0495684_0286848_677_1144 146
251 3300048905 Ga0496102_0044391 Ga0496102_0044391_3299_3787 146
252 3300048905 Ga0496102_0064999 Ga0496102_0064999_2806_3273 146
253 3300048906 Ga0496103_0018310 Ga0496103_0018310_682_1170 146
254 3300048909 Ga0496106_1323987 Ga0496106_1323987_38_505 146
255 3300048910 Ga0496107_1115896 Ga0496107_1115896_53_541 146
256 3300048924 Ga0496121_0001584 Ga0496121_0001584_29009_29476 146
257 3300048924 Ga0496121_0176191 Ga0496121_0176191_664_1131 146
258 3300048924 Ga0496121_0226789 Ga0496121_0226789_758_1225 146
259 3300048929 Ga0496126_0025679 Ga0496126_0025679_5026_5493 146
260 3300048929 Ga0496126_0295263 Ga0496126_0295263_229_696 146
261 3300048929 Ga0496126_0513151 Ga0496126_0513151_229_696 146
262 3300048929 Ga0496126_0696739 Ga0496126_0696739_153_620 146
263 3300049580 Ga0501046_0062135 Ga0501046_0062135_1406_1873 146
264 3300049581 Ga0501047_0022387 Ga0501047_0022387_3245_3712 146
265 3300049586 Ga0501070_0047520 Ga0501070_0047520_1015_1482 146
266 3300049589 Ga0501073_0025069 Ga0501073_0025069_2705_3172 146
267 3300049742 Ga0501080_0033362 Ga0501080_0033362_1753_2220 146
268 3300049823 Ga0501044_0037681 Ga0501044_0037681_1342_1809 146
269 3300053104 Ga0500556_0090495 Ga0500556_0090495_265_732 146
270 3300053111 Ga0500572_209464 Ga0500572_209464_43_510 146
271 3300003791 Ga0055530_10003364 Ga0055530_100033646 147
272 3300005539 Ga0068853_101881990 Ga0068853_1018819901 147
273 3300005617 Ga0068859_101346876 Ga0068859_1013468761 147
274 3300006931 Ga0097620_101346519 Ga0097620_1013465191 147
275 3300009148 Ga0105243_11080613 Ga0105243_110806132 147
276 3300009553 Ga0105249_11193000 Ga0105249_111930001 147
277 3300010375 Ga0105239_11529996 Ga0105239_115299962 147
278 3300011119 Ga0105246_10272565 Ga0105246_102725651 147
279 3300013105 Ga0157369_10995326 Ga0157369_109953262 147
280 3300013308 Ga0157375_11735739 Ga0157375_117357392 147
281 3300025298 Ga0209050_1000118 Ga0209050_100011889 147
282 3300025303 Ga0209051_1045927 Ga0209051_10459272 147
283 3300025935 Ga0207709_10504770 Ga0207709_105047702 147
284 3300026078 Ga0207702_10972799 Ga0207702_109727992 147
285 3300031251 Ga0265327_10000700 Ga0265327_1000070020 147
286 3300048904 Ga0496101_0751151 Ga0496101_0751151_52_519 147
287 3300046615 Ga0495656_0088073 Ga0495656_0088073_736_1203 148
288 3300046648 Ga0495611_0204606 Ga0495611_0204606_258_725 148
289 3300005458 Ga0070681_10222351 Ga0070681_102223512 149
290 3300013307 Ga0157372_10221991 Ga0157372_102219912 149
291 3300009093 Ga0105240_10000387 Ga0105240_1000038745 150
292 3300009545 Ga0105237_11733418 Ga0105237_117334182 150
293 3300009551 Ga0105238_10249716 Ga0105238_102497162 150
294 3300010375 Ga0105239_10192513 Ga0105239_101925132 150
295 3300011119 Ga0105246_11567946 Ga0105246_115679462 150
296 3300014969 Ga0157376_10570137 Ga0157376_105701371 150
297 3300025913 Ga0207695_10000510 Ga0207695_1000051044 150
298 3300025914 Ga0207671_11271100 Ga0207671_112711001 150
299 3300025924 Ga0207694_10589468 Ga0207694_105894682 150
300 3300031901 Ga0307406_10150611 Ga0307406_101506112 150
301 3300005436 Ga0070713_100401479 Ga0070713_1004014791 151
302 3300009147 Ga0114129_10056913 Ga0114129_100569133 151
303 3300046528 Ga0495642_0018271 Ga0495642_0018271_1263_1823 151
304 3300050507 nmdc:mga05p37_99563_c1 nmdc:mga05p37_99563_c1_1289_1759 151
305 3300005335 Ga0070666_10534151 Ga0070666_105341512 152
306 3300005338 Ga0068868_100601143 Ga0068868_1006011431 152
307 3300005347 Ga0070668_100250598 Ga0070668_1002505982 152
308 3300005366 Ga0070659_101319565 Ga0070659_1013195651 152
309 3300005456 Ga0070678_100702484 Ga0070678_1007024841 152
310 3300005457 Ga0070662_100050620 Ga0070662_1000506201 152
311 3300005563 Ga0068855_100593209 Ga0068855_1005932092 152
312 3300005719 Ga0068861_100395959 Ga0068861_1003959592 152
313 3300006871 Ga0075434_100635935 Ga0075434_1006359351 152
314 3300009101 Ga0105247_10049227 Ga0105247_100492273 152
315 3300009177 Ga0105248_10228063 Ga0105248_102280632 152
316 3300009553 Ga0105249_10670202 Ga0105249_106702022 152
317 3300011119 Ga0105246_10963522 Ga0105246_109635222 152
318 3300013296 Ga0157374_10939559 Ga0157374_109395592 152
319 3300013306 Ga0163162_10029156 Ga0163162_100291564 152
320 3300013306 Ga0163162_10157318 Ga0163162_101573183 152
321 3300013308 Ga0157375_11179334 Ga0157375_111793342 152
322 3300014325 Ga0163163_10493502 Ga0163163_104935022 152
323 3300025900 Ga0207710_10134560 Ga0207710_101345602 152
324 3300025903 Ga0207680_10294643 Ga0207680_102946432 152
325 3300025907 Ga0207645_10080974 Ga0207645_100809742 152
326 3300025914 Ga0207671_10255243 Ga0207671_102552432 152
327 3300025933 Ga0207706_10708169 Ga0207706_107081691 152
328 3300025945 Ga0207679_10207497 Ga0207679_102074972 152
329 3300025949 Ga0207667_10630646 Ga0207667_106306462 152
330 3300025972 Ga0207668_10109172 Ga0207668_101091722 152
331 3300026023 Ga0207677_10233552 Ga0207677_102335522 152
332 3300026088 Ga0207641_10302133 Ga0207641_103021332 152
333 3300026095 Ga0207676_11251105 Ga0207676_112511051 152
334 3300026095 Ga0207676_12160954 Ga0207676_121609541 152
335 3300026118 Ga0207675_100109235 Ga0207675_1001092352 152
336 3300026142 Ga0207698_10430595 Ga0207698_104305952 152
337 3300028379 Ga0268266_10053276 Ga0268266_100532764 152
338 3300028380 Ga0268265_10297667 Ga0268265_102976672 152
339 3300031247 Ga0265340_10197525 Ga0265340_101975252 152
340 3300046522 Ga0495643_0147890 Ga0495643_0147890_108_593 152
341 3300046615 Ga0495656_0125281 Ga0495656_0125281_160_645 152
342 3300046684 Ga0495669_0261732 Ga0495669_0261732_219_704 152
343 3300048912 Ga0496109_0400683 Ga0496109_0400683_629_1129 152
344 3300048916 Ga0496113_0485009 Ga0496113_0485009_477_977 152
345 3300037466 Ga0395898_0737097 Ga0395898_0737097_255_716 153
346 3300037471 Ga0395905_0304386 Ga0395905_0304386_588_1049 153
347 3300053153 Ga0500616_0050233 Ga0500616_0050233_1100_1561 153
348 3300005614 Ga0068856_100122657 Ga0068856_1001226573 154
349 3300005614 Ga0068856_100784016 Ga0068856_1007840162 154
350 3300009545 Ga0105237_11441750 Ga0105237_114417502 154
351 3300026041 Ga0207639_10693256 Ga0207639_106932562 154
352 3300026067 Ga0207678_10218039 Ga0207678_102180392 154
353 3300026078 Ga0207702_10879601 Ga0207702_108796012 154
354 3300044712 Ga0453684_1100977 Ga0453684_1100977_345_809 154
355 3300050493 nmdc:mga0k408_49682_c1 nmdc:mga0k408_49682_c1_1941_2405 154
356 3300053156 Ga0500622_0032206 Ga0500622_0032206_861_1325 154
357 3300053160 Ga0500633_0305871 Ga0500633_0305871_58_522 154
358 3300005329 Ga0070683_100275566 Ga0070683_1002755662 155
359 3300005535 Ga0070684_100518682 Ga0070684_1005186822 155
360 3300005564 Ga0070664_100369999 Ga0070664_1003699992 155
361 3300006846 Ga0075430_100002156 Ga0075430_10000215613 155
362 3300006847 Ga0075431_100003788 Ga0075431_1000037887 155
363 3300006871 Ga0075434_100943369 Ga0075434_1009433691 155
364 3300006880 Ga0075429_100204718 Ga0075429_1002047182 155
365 3300031852 Ga0307410_10733271 Ga0307410_107332712 155
366 3300031911 Ga0307412_10877670 Ga0307412_108776702 155
367 3300032004 Ga0307414_10237059 Ga0307414_102370592 155
368 3300032004 Ga0307414_10258490 Ga0307414_102584902 155
369 3300041512 Ga0451853_3672779 Ga0451853_3672779_111_581 155
370 3300050508 nmdc:mga09592_58055_c2 nmdc:mga09592_58055_c2_395_862 155
371 3300050509 nmdc:mga0qj67_4133_c1 nmdc:mga0qj67_4133_c1_5720_6187 155
372 3300050510 nmdc:mga06r32_910_c1 nmdc:mga06r32_910_c1_4227_4694 155
373 iso_pu_bacteria 2765235942 2766064964 155
374 iso_pu_bacteria 2838668709 2838672363 155
375 iso_pu_bacteria 2838701080 2838703895 155
376 iso_pu_bacteria 2842146304 2842148313 155
377 iso_pu_bacteria 2842250916 2842253379 155
378 iso_pu_bacteria 2842285085 2842289327 155
379 iso_pu_bacteria 2842311132 2842312592 155
380 iso_pu_bacteria 2842317721 2842322624 155
381 iso_pu_bacteria 2842395702 2842401955 155
382 iso_pu_bacteria 2842402390 2842406675 155
383 iso_pu_bacteria 2842409023 2842413829 155
384 iso_pu_bacteria 2842415677 2842420209 155
385 iso_pu_bacteria 2842495871 2842501988 155
386 iso_pu_bacteria 2857516855 2857524470 155
387 iso_pu_bacteria 639633055 639646702 155
388 iso_pu_bacteria 8005275841 8005278922 155
389 iso_pu_bacteria 8005563573 8005565032 155
390 iso_pu_bacteria 8005695170 8005700608 155
391 iso_pu_bacteria 8018176218 8018179429 155
392 3300005339 Ga0070660_100191480 Ga0070660_1001914801 156
393 3300005366 Ga0070659_100097196 Ga0070659_1000971963 156
394 3300005536 Ga0070697_100000134 Ga0070697_10000013436 156
395 3300013307 Ga0157372_10040297 Ga0157372_100402973 156
396 3300025910 Ga0207684_10533340 Ga0207684_105333403 156
397 3300025919 Ga0207657_10127125 Ga0207657_101271252 156
398 3300025932 Ga0207690_10155829 Ga0207690_101558292 156
399 3300028800 Ga0265338_10768052 Ga0265338_107680522 156
400 3300031344 Ga0265316_10392689 Ga0265316_103926891 156
401 3300031852 Ga0307410_10315337 Ga0307410_103153372 156
402 3300038726 Ga0400490_44737 Ga0400490_44737_14858_15328 156
403 3300045051 Ga0451576_1293796 Ga0451576_1293796_277_750 156
404 3300049570 Ga0501033_0001075 Ga0501033_0001075_24044_24517 157
405 3300049579 Ga0501043_0590467 Ga0501043_0590467_187_699 157
406 3300049580 Ga0501046_0195495 Ga0501046_0195495_245_718 157
407 3300049581 Ga0501047_0013983 Ga0501047_0013983_1594_2067 157
408 3300049742 Ga0501080_0473225 Ga0501080_0473225_513_986 157
409 3300049823 Ga0501044_0000106 Ga0501044_0000106_39554_40027 157
410 3300053139 Ga0500568_0000217 Ga0500568_0000217_18683_19177 157
411 3300053160 Ga0500633_0000096 Ga0500633_0000096_5609_6103 157
412 3300049675 Ga0501243_000169 Ga0501243_000169_6657_7133 158
413 3300005343 Ga0070687_100980037 Ga0070687_1009800371 159
414 3300044712 Ga0453684_0682643 Ga0453684_0682643_595_1074 159
415 3300046513 Ga0495616_0093175 Ga0495616_0093175_384_863 159
416 3300053134 Ga0500658_0210204 Ga0500658_0210204_34_513 159
417 iso_pu_bacteria 2510917030 2511197000 159
418 iso_pu_bacteria 2585427529 2585550672 159
419 3300005841 Ga0068863_100011283 Ga0068863_1000112837 161
420 3300045051 Ga0451576_0035399 Ga0451576_0035399_2929_3423 162
421 3300002987 JGI25159J45721_1000044 JGI25159J45721_100004459 163
422 3300003354 JGI25160J50197_1000206 JGI25160J50197_100020644 163
423 3300003374 JGI25161J50226_1000097 JGI25161J50226_100009744 163
424 3300003775 Ga0055524_1006179 Ga0055524_10061793 163
425 3300004625 Ga0055543_1000056 Ga0055543_100005619 163
426 3300005262 Ga0065165_1000719 Ga0065165_100071915 163
427 3300025208 Ga0209436_100008 Ga0209436_10000858 163
428 3300025258 Ga0209129_1006573 Ga0209129_10065733 163
429 3300025273 Ga0209673_1005252 Ga0209673_10052526 163
430 3300025284 Ga0209130_1000019 Ga0209130_1000019161 163
431 3300025299 Ga0209256_1001370 Ga0209256_100137015 163
432 3300025302 Ga0207426_1000005 Ga0207426_1000005447 163
433 3300025304 Ga0209257_1012202 Ga0209257_10122023 163
434 3300046692 Ga0495671_0500014 Ga0495671_0500014_25_516 163
435 3300046694 Ga0495649_0021712 Ga0495649_0021712_527_1018 163
436 3300048927 Ga0496124_0067575 Ga0496124_0067575_686_1177 163
437 3300049589 Ga0501073_0387319 Ga0501073_0387319_141_632 163
438 3300053156 Ga0500622_0000092 Ga0500622_0000092_66471_66962 163

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00132

Hexapep

Bacterial transferase hexapeptide (six repeats)

43

78

0.94

PF14602

Hexapep_2

Hexapeptide repeat of succinyl-transferase

115

148

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mzu-assembly2.cif.gz_G crystal structure of fdtd, a bifunctional ketoisomerase/n-acetyltransferase from shewanella denitrificans 0.925 9 156
1sst-assembly1.cif.gz_A-2 serine acetyltransferase- complex with coa 0.9109 45 153
4n6b-assembly2.cif.gz_C soybean serine acetyltransferase complexed with coa 0.8933 45 153
3mc4-assembly2.cif.gz_B crystal structure of ww/rsp5/wwp domain: bacterial transferase hexapeptide repeat: serine o-acetyltransferase from brucella melitensis 0.887 51 155
3r8y-assembly2.cif.gz_E structure of the bacillus anthracis tetrahydropicolinate succinyltransferase 0.8838 19 153
ID Description Score Start End Superfamily
af_F1QSV4_111_509_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9334 13 64 3.90.550.10
4mzuA01 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8732 12 159 2.160.10.10
4mzuA01 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8673 12 159 2.160.10.10
af_A4HUR5_71_238_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8455 13 158 2.160.10.10
af_Q9NR50_335_449_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8309 24 149 2.160.10.10
ID Description Score Start End GO Terms
AF-A0A833DGQ9-F1-model_v4 N-acetyltransferase 1.003 59 154 GO:0016740
AF-A0A2V6KPX5-F1-model_v4 UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase 1.003 103 156 GO:0005829
GO:0008374
AF-A0A7C7IQD4-F1-model_v4 N-acetyltransferase 0.9982 5 154 GO:0016740
AF-A0A3B9I1C8-F1-model_v4 UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase 0.998 4 156 GO:0016746
AF-A0A560DY19-F1-model_v4 Succinyltransferase-like protein 0.9978 4 153 GO:0016740

Feature Viewer

pLDDT pTM Quality
95.03 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map