F444051

General Info

Members Datasets Scaffolds Average Seq Length
438 235 438 129

Family's Representative Sequence

Representative Sequence 3300046476|Ga0495662_0202107|Ga0495662_0202107_362_817
Length 151
Sequence MSCSGVLPAGRSPTLTYREEKLMSAYAIVNLKEEVEDSWGERAPGTEGRFARKHLNSEHLGVSYLRYSPGVRSPTAHSHREQEEAYVVISGSGQVRLDDEIRDLRCWDVVRVDPATVRAFEAGHDGLELIAIGSDRPDGGDGVFAPSAWID

Samples

Sample ID Description Type Environment
1 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
55 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
56 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
57 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
105 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
106 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
107 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
110 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
123 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
126 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
127 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
132 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
149 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
150 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
151 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
192 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
232 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.91
Nodule 0
Rhizoplane 10.27
Rhizosphere 85.84
Stem 0
Stem Tuber 0
Unclassified 2.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058861_11687215 3300004800 Unclassified 796
2 Ga0070658_10196619 3300005327 Bacteria 1700
3 Ga0070658_10600529 3300005327 Unclassified 954
4 Ga0070658_10696580 3300005327 Unclassified 882
5 Ga0070658_11469703 3300005327 Unclassified 591
6 Ga0070683_100408128 3300005329 Bacteria 1296
7 Ga0070683_100965426 3300005329 Bacteria 818
8 Ga0070680_100689699 3300005336 Bacteria 879
9 Ga0070680_100711076 3300005336 Bacteria 865
10 Ga0070680_101386347 3300005336 Bacteria 609
11 Ga0070682_101094322 3300005337 Bacteria 667
12 Ga0070660_100127245 3300005339 Bacteria 2036
13 Ga0070660_100326899 3300005339 Unclassified 1260
14 Ga0070660_100334477 3300005339 Bacteria 1245
15 Ga0070691_10513471 3300005341 Unclassified 695
16 Ga0070687_100830364 3300005343 Bacteria 657
17 Ga0070661_100196017 3300005344 Bacteria 1542
18 Ga0070661_100862836 3300005344 Unclassified 746
19 Ga0070671_101015419 3300005355 Bacteria 727
20 Ga0070659_100137040 3300005366 Unclassified 1990
21 Ga0070709_10110004 3300005434 Unclassified 1850
22 Ga0070709_10226115 3300005434 Bacteria 1337
23 Ga0070709_10335373 3300005434 Bacteria 1113
24 Ga0070714_100040124 3300005435 Unclassified 3945
25 Ga0070714_100269802 3300005435 Archaea 1578
26 Ga0070714_100309565 3300005435 Bacteria 1474
27 Ga0070714_100320099 3300005435 Bacteria 1450
28 Ga0070714_100858376 3300005435 Unclassified 880
29 Ga0070714_100901565 3300005435 Unclassified 858
30 Ga0070714_101230520 3300005435 Bacteria 731
31 Ga0070713_100116247 3300005436 Unclassified 2339
32 Ga0070713_100201422 3300005436 Bacteria 1798
33 Ga0070713_100601934 3300005436 Bacteria 1044
34 Ga0070710_10032069 3300005437 Bacteria 2843
35 Ga0070710_10507458 3300005437 Unclassified 826
36 Ga0070711_100122339 3300005439 Bacteria 1927
37 Ga0070711_100179192 3300005439 Bacteria 1621
38 Ga0070711_100753996 3300005439 Unclassified 823
39 Ga0070711_101206141 3300005439 Bacteria 655
40 Ga0070711_101544598 3300005439 Unclassified 580
41 Ga0070705_100835732 3300005440 Unclassified 735
42 Ga0070694_100159588 3300005444 Bacteria 1653
43 Ga0070708_100582037 3300005445 Unclassified 1055
44 Ga0070708_100693350 3300005445 Bacteria 959
45 Ga0070708_101419820 3300005445 Unclassified 647
46 Ga0070708_101648422 3300005445 Unclassified 596
47 Ga0070681_10066102 3300005458 Unclassified 3584
48 Ga0070681_10121593 3300005458 Bacteria 2545
49 Ga0070681_10337465 3300005458 Unclassified 1416
50 Ga0070681_11839841 3300005458 Unclassified 533
51 Ga0070706_100516114 3300005467 Unclassified 1111
52 Ga0070706_100661487 3300005467 Unclassified 969
53 Ga0070706_100705319 3300005467 Unclassified 936
54 Ga0070706_101276336 3300005467 Bacteria 674
55 Ga0070707_100127812 3300005468 Bacteria 2470
56 Ga0070707_100690300 3300005468 Bacteria 984
57 Ga0070707_100839963 3300005468 Unclassified 882
58 Ga0070698_100869823 3300005471 Unclassified 846
59 Ga0070699_100314006 3300005518 Unclassified 1407
60 Ga0070679_100092180 3300005530 Bacteria 3017
61 Ga0070679_100490665 3300005530 Bacteria 1172
62 Ga0070679_100718892 3300005530 Bacteria 941
63 Ga0070684_101800918 3300005535 Bacteria 578
64 Ga0070697_100500636 3300005536 Bacteria 1062
65 Ga0068853_101748483 3300005539 Unclassified 603
66 Ga0070695_100000615 3300005545 Bacteria 18906
67 Ga0070695_100511282 3300005545 Unclassified 930
68 Ga0070695_101220593 3300005545 Bacteria 619
69 Ga0070696_100371692 3300005546 Unclassified 1112
70 Ga0070665_100597921 3300005548 Bacteria 1116
71 Ga0068855_100083614 3300005563 Unclassified 3697
72 Ga0068855_100222712 3300005563 Unclassified 2115
73 Ga0068855_100573563 3300005563 Unclassified 1219
74 Ga0068857_100496567 3300005577 Unclassified 1145
75 Ga0068852_101113626 3300005616 Unclassified 810
76 Ga0068864_101882771 3300005618 Unclassified 604
77 Ga0070717_10069068 3300006028 Unclassified 2941
78 Ga0070717_10550358 3300006028 Bacteria 1045
79 Ga0075365_10140933 3300006038 Bacteria 1674
80 Ga0075368_10459979 3300006042 Unclassified 564
81 Ga0070715_10150563 3300006163 Unclassified 1139
82 Ga0070716_100079629 3300006173 Unclassified 1951
83 Ga0070712_100013115 3300006175 Bacteria 5286
84 Ga0070712_100284273 3300006175 Unclassified 1333
85 Ga0070712_101054617 3300006175 Unclassified 704
86 Ga0070712_101406859 3300006175 Unclassified 609
87 Ga0097621_101339890 3300006237 Unclassified 677
88 Ga0075431_100739278 3300006847 Unclassified 960
89 Ga0075433_10775256 3300006852 Unclassified 838
90 Ga0075434_100543623 3300006871 Unclassified 1181
91 Ga0075436_100171592 3300006914 Bacteria 1531
92 Ga0075436_100176354 3300006914 Bacteria 1510
93 Ga0099795_10035351 3300007788 Unclassified 1746
94 Ga0105240_10026950 3300009093 Bacteria 7534
95 Ga0105240_10704288 3300009093 Unclassified 1102
96 Ga0105240_12596002 3300009093 Unclassified 523
97 Ga0105245_10279758 3300009098 Bacteria 1630
98 Ga0114129_10500328 3300009147 Unclassified 1587
99 Ga0105243_10115075 3300009148 Unclassified 2258
100 Ga0105243_10450083 3300009148 Unclassified 1208
101 Ga0105242_10234538 3300009176 Unclassified 1646
102 Ga0105237_10303288 3300009545 Bacteria 1600
103 Ga0099796_10010428 3300010159 Unclassified 2555
104 Ga0157339_1064856 3300012505 Unclassified 515
105 Ga0157342_1042362 3300012507 Unclassified 614
106 Ga0157316_1064456 3300012510 Unclassified 538
107 Ga0157373_10313657 3300013100 Bacteria 1115
108 Ga0157373_10492564 3300013100 Unclassified 885
109 Ga0157370_10411815 3300013104 Bacteria 1244
110 Ga0157369_10011986 3300013105 Bacteria 9846
111 Ga0157369_10121462 3300013105 Unclassified 2772
112 Ga0157369_10206430 3300013105 Bacteria 2060
113 Ga0157374_12437649 3300013296 Unclassified 550
114 Ga0157378_11075177 3300013297 Unclassified 841
115 Ga0157378_12156377 3300013297 Bacteria 608
116 Ga0157372_11043422 3300013307 Unclassified 946
117 Ga0157375_11867911 3300013308 Bacteria 713
118 Ga0157375_11949421 3300013308 Unclassified 698
119 Ga0163163_11248017 3300014325 Bacteria 806
120 Ga0182008_10535649 3300014497 Bacteria 649
121 Ga0182008_10611531 3300014497 Bacteria 613
122 Ga0157376_10885467 3300014969 Unclassified 910
123 Ga0206356_10215760 3300020070 Unclassified 1348
124 Ga0213874_10018974 3300021377 Bacteria 1867
125 Ga0213876_10125543 3300021384 Unclassified 1363
126 Ga0213871_10108522 3300021441 Unclassified 819
127 Ga0207692_10044901 3300025898 Bacteria 2207
128 Ga0207692_10178566 3300025898 Bacteria 1235
129 Ga0207692_10864218 3300025898 Bacteria 594
130 Ga0207685_10132508 3300025905 Unclassified 1108
131 Ga0207685_10447724 3300025905 Unclassified 671
132 Ga0207699_10063235 3300025906 Bacteria 2235
133 Ga0207699_10412466 3300025906 Unclassified 963
134 Ga0207705_10714560 3300025909 Bacteria 779
135 Ga0207705_10917654 3300025909 Unclassified 678
136 Ga0207684_11128650 3300025910 Unclassified 652
137 Ga0207654_10518987 3300025911 Bacteria 843
138 Ga0207707_10092098 3300025912 Bacteria 2649
139 Ga0207707_10338025 3300025912 Bacteria 1298
140 Ga0207707_10721760 3300025912 Unclassified 835
141 Ga0207695_10119224 3300025913 Bacteria 2609
142 Ga0207695_11111615 3300025913 Unclassified 670
143 Ga0207671_11142877 3300025914 Unclassified 611
144 Ga0207693_10011697 3300025915 Bacteria 7101
145 Ga0207693_10047890 3300025915 Bacteria 3358
146 Ga0207693_10049642 3300025915 Bacteria 3295
147 Ga0207693_10369335 3300025915 Unclassified 1122
148 Ga0207693_10378585 3300025915 Unclassified 1107
149 Ga0207693_10450517 3300025915 Bacteria 1006
150 Ga0207693_10849973 3300025915 Bacteria 702
151 Ga0207663_10052536 3300025916 Bacteria 2542
152 Ga0207663_10148385 3300025916 Unclassified 1642
153 Ga0207663_10677582 3300025916 Unclassified 815
154 Ga0207662_10418343 3300025918 Unclassified 912
155 Ga0207657_10103256 3300025919 Unclassified 2363
156 Ga0207649_10791994 3300025920 Unclassified 739
157 Ga0207652_10213725 3300025921 Bacteria 1737
158 Ga0207652_10833779 3300025921 Unclassified 817
159 Ga0207646_10310293 3300025922 Unclassified 1425
160 Ga0207646_11907930 3300025922 Bacteria 506
161 Ga0207687_10492029 3300025927 Unclassified 1023
162 Ga0207700_10033890 3300025928 Bacteria 3659
163 Ga0207700_10058101 3300025928 Unclassified 2920
164 Ga0207700_10320692 3300025928 Bacteria 1343
165 Ga0207664_10024782 3300025929 Bacteria 4512
166 Ga0207664_10026012 3300025929 Unclassified 4417
167 Ga0207664_10066834 3300025929 Bacteria 2883
168 Ga0207664_10222234 3300025929 Bacteria 1638
169 Ga0207664_10325176 3300025929 Bacteria 1357
170 Ga0207664_10418576 3300025929 Unclassified 1193
171 Ga0207664_10495799 3300025929 Unclassified 1093
172 Ga0207664_11564865 3300025929 Unclassified 581
173 Ga0207686_10115903 3300025934 Unclassified 1815
174 Ga0207709_10218747 3300025935 Unclassified 1372
175 Ga0207669_10504481 3300025937 Unclassified 969
176 Ga0207665_10016032 3300025939 Unclassified 4921
177 Ga0207665_10079584 3300025939 Unclassified 2253
178 Ga0207661_10185785 3300025944 Bacteria 1819
179 Ga0207679_10325908 3300025945 Unclassified 1331
180 Ga0207667_11106930 3300025949 Bacteria 775
181 Ga0207651_10429373 3300025960 Unclassified 1130
182 Ga0207639_10904231 3300026041 Unclassified 825
183 Ga0207708_10632846 3300026075 Bacteria 909
184 Ga0207702_12180672 3300026078 Unclassified 543
185 Ga0207428_11136492 3300027907 Unclassified 545
186 Ga0268266_10514014 3300028379 Bacteria 1144
187 Ga0265337_1179707 3300028556 Bacteria 574
188 Ga0265334_10047731 3300028573 Bacteria 1651
189 Ga0265318_10013612 3300028577 Bacteria 3431
190 Ga0265336_10167162 3300028666 Bacteria 654
191 Ga0265338_10018614 3300028800 Bacteria 7421
192 Ga0265338_10129065 3300028800 Bacteria 2000
193 Ga0265324_10311134 3300029957 Unclassified 536
194 Ga0265330_10016979 3300031235 Bacteria 3356
195 Ga0265325_10031572 3300031241 Bacteria 2833
196 Ga0265325_10031760 3300031241 Bacteria 2823
197 Ga0265325_10036543 3300031241 Bacteria 2601
198 Ga0265339_10020545 3300031249 Bacteria 3855
199 Ga0265331_10139929 3300031250 Bacteria 1101
200 Ga0265327_10004878 3300031251 Bacteria 11594
201 Ga0265327_10074301 3300031251 Bacteria 1694
202 Ga0265316_10039139 3300031344 Bacteria 3810
203 Ga0265313_10017252 3300031595 Bacteria 4111
204 Ga0265313_10026281 3300031595 Bacteria 3069
205 Ga0265314_10019185 3300031711 Bacteria 5302
206 Ga0265314_10044849 3300031711 Bacteria 3130
207 Ga0265342_10086667 3300031712 Bacteria 1800
208 Ga0307405_10207407 3300031731 Bacteria 1428
209 Ga0307407_10800696 3300031903 Bacteria 717
210 Ga0307415_101122685 3300032126 Bacteria 737
211 Ga0307415_101715929 3300032126 Unclassified 606
212 Ga0373944_0002497 3300035089 Bacteria 4676
213 Ga0373923_0042100 3300035111 Bacteria 1885
214 Ga0373936_0012425 3300035113 Bacteria 3239
215 Ga0373945_0051975 3300035116 Unclassified 1508
216 Ga0373945_0413332 3300035116 Unclassified 592
217 Ga0373953_0095888 3300035117 Unclassified 1245
218 Ga0373954_0100932 3300035118 Bacteria 1392
219 Ga0373954_0371893 3300035118 Unclassified 706
220 Ga0373956_0451946 3300035119 Unclassified 613
221 Ga0373957_0111458 3300035120 Unclassified 1102
222 Ga0373943_0021075 3300035170 Unclassified 3009
223 Ga0373943_0053001 3300035170 Bacteria 2002
224 Ga0373946_0007826 3300035171 Bacteria 3923
225 Ga0373946_0170670 3300035171 Bacteria 1026
226 Ga0373924_0225319 3300035410 Bacteria 828
227 Ga0373935_0032999 3300035692 Bacteria 3220
228 Ga0373935_0057018 3300035692 Bacteria 2491
229 Ga0373935_0389726 3300035692 Unclassified 999
230 Ga0373927_0102384 3300035695 Unclassified 1863
231 Ga0373927_0288006 3300035695 Unclassified 1081
232 Ga0373927_1147409 3300035695 Unclassified 512
233 Ga0373933_0235017 3300035724 Unclassified 1178
234 Ga0373947_0001172 3300035725 Bacteria 16110
235 Ga0373925_0004590 3300037068 Bacteria 10433
236 Ga0373925_0050982 3300037068 Bacteria 3088
237 Ga0373925_0130034 3300037068 Unclassified 1962
238 Ga0395900_0078350 3300037418 Bacteria 3396
239 Ga0395900_0136904 3300037418 Bacteria 2509
240 Ga0395900_0643458 3300037418 Bacteria 997
241 Ga0395898_0014158 3300037466 Bacteria 8201
242 Ga0395898_0055053 3300037466 Bacteria 3880
243 Ga0395905_0852616 3300037471 Unclassified 814
244 Ga0436364_0312418 3300037853 Unclassified 699
245 Ga0436364_0994868 3300037853 Bacteria 2948
246 Ga0436364_1163397 3300037853 Bacteria 544
247 Ga0395901_0352370 3300038443 Bacteria 1519
248 Ga0395901_1654139 3300038443 Unclassified 592
249 Ga0242419_002913 3300038698 Unclassified 1137
250 Ga0436365_1217175 3300039437 Unclassified 1514
251 Ga0436365_1630189 3300039437 Bacteria 5982
252 Ga0436365_1700702 3300039437 Bacteria 13111
253 Ga0436360_0454285 3300039438 Unclassified 2084
254 Ga0436361_0317272 3300039447 Bacteria 887
255 Ga0436363_0530432 3300039450 Bacteria 785
256 Ga0436363_0748736 3300039450 Bacteria 1109
257 Ga0436363_0810839 3300039450 Bacteria 3345
258 Ga0451787_346218 3300041441 Unclassified 1168
259 Ga0451795_0034971 3300041456 Unclassified 580
260 Ga0451798_0790122 3300041458 Bacteria 554
261 Ga0451804_1091483 3300041463 Bacteria 1006
262 Ga0451807_1018100 3300041486 Unclassified 533
263 Ga0451807_2296071 3300041486 Bacteria 1913
264 Ga0451839_1000935 3300041496 Unclassified 580
265 Ga0451853_2264426 3300041512 Unclassified 1403
266 Ga0466961_0400537 3300044693 Unclassified 833
267 Ga0466961_0624817 3300044693 Bacteria 647
268 Ga0466963_0056744 3300044694 Unclassified 2606
269 Ga0466971_0720381 3300044719 Unclassified 502
270 Ga0466968_0114616 3300044735 Bacteria 1215
271 Ga0466957_0021839 3300044842 Unclassified 3773
272 Ga0466957_0050211 3300044842 Unclassified 2538
273 Ga0466960_0040343 3300044901 Unclassified 2207
274 Ga0466960_0260437 3300044901 Unclassified 966
275 Ga0466959_0717672 3300045049 Bacteria 670
276 Ga0466959_0830117 3300045049 Unclassified 617
277 Ga0466959_0972420 3300045049 Bacteria 566
278 Ga0466958_0028392 3300045836 Unclassified 3317
279 Ga0466958_0143951 3300045836 Archaea 1502
280 Ga0466958_0474031 3300045836 Unclassified 811
281 Ga0466967_0027913 3300045976 Bacteria 4704
282 Ga0466967_0166538 3300045976 Unclassified 2071
283 Ga0466967_0758852 3300045976 Bacteria 962
284 Ga0466967_0797873 3300045976 Unclassified 937
285 Ga0495592_0123877 3300046454 Unclassified 1815
286 Ga0495603_0044509 3300046455 Bacteria 2649
287 Ga0495603_0303846 3300046455 Unclassified 916
288 Ga0495629_0001040 3300046459 Bacteria 22219
289 Ga0495629_0005651 3300046459 Bacteria 9340
290 Ga0495629_0215237 3300046459 Bacteria 1326
291 Ga0495641_0050039 3300046461 Bacteria 1911
292 Ga0495641_0074000 3300046461 Unclassified 1528
293 Ga0495651_0019924 3300046462 Bacteria 5203
294 Ga0495651_0088724 3300046462 Unclassified 2323
295 Ga0495651_0263267 3300046462 Unclassified 1172
296 Ga0495651_0691307 3300046462 Unclassified 636
297 Ga0495653_0078314 3300046463 Bacteria 2451
298 Ga0495653_0397682 3300046463 Unclassified 876
299 Ga0495580_0263309 3300046472 Unclassified 1179
300 Ga0495582_0064118 3300046473 Unclassified 2028
301 Ga0495582_0184138 3300046473 Unclassified 1190
302 Ga0495582_0689520 3300046473 Unclassified 591
303 Ga0495639_0005277 3300046475 Bacteria 5559
304 Ga0495639_0141334 3300046475 Bacteria 1157
305 Ga0495662_0020231 3300046476 Unclassified 3218
306 Ga0495662_0202107 3300046476 Bacteria 979
307 Ga0495664_0049334 3300046477 Bacteria 2498
308 Ga0495594_0076179 3300046499 Unclassified 1870
309 Ga0495607_0374318 3300046501 Unclassified 653
310 Ga0495618_0111866 3300046514 Bacteria 1748
311 Ga0495618_0212094 3300046514 Unclassified 1224
312 Ga0495628_0134246 3300046516 Bacteria 1892
313 Ga0495628_0211976 3300046516 Unclassified 1457
314 Ga0495628_0539756 3300046516 Unclassified 838
315 Ga0495630_0002952 3300046517 Bacteria 11812
316 Ga0495630_0004773 3300046517 Bacteria 9505
317 Ga0495630_0689643 3300046517 Unclassified 781
318 Ga0495666_0040189 3300046526 Bacteria 2268
319 Ga0495652_0067172 3300046529 Unclassified 3006
320 Ga0495652_0089127 3300046529 Unclassified 2526
321 Ga0495652_0191179 3300046529 Bacteria 1562
322 Ga0495665_0000530 3300046531 Bacteria 19297
323 Ga0495665_0005099 3300046531 Bacteria 7083
324 Ga0495640_0098219 3300046533 Bacteria 1924
325 Ga0495640_0260577 3300046533 Unclassified 1083
326 Ga0495640_0373887 3300046533 Bacteria 877
327 Ga0495586_0042680 3300046535 Bacteria 2441
328 Ga0495586_0104680 3300046535 Bacteria 1572
329 Ga0495586_0758205 3300046535 Unclassified 560
330 Ga0495587_0201852 3300046536 Unclassified 1124
331 Ga0495645_0119324 3300046543 Unclassified 1858
332 Ga0495622_0333726 3300046557 Bacteria 657
333 Ga0495667_0022497 3300046559 Unclassified 4246
334 Ga0495667_0185429 3300046559 Bacteria 1334
335 Ga0495667_0654599 3300046559 Bacteria 652
336 Ga0495634_0016978 3300046642 Bacteria 5199
337 Ga0495634_0045101 3300046642 Unclassified 2981
338 Ga0495635_0178073 3300046663 Bacteria 1445
339 Ga0495659_0361054 3300046664 Unclassified 622
340 Ga0495588_0129706 3300046674 Unclassified 1330
341 Ga0495588_0248620 3300046674 Unclassified 938
342 Ga0495588_0527045 3300046674 Unclassified 619
343 Ga0495657_0792043 3300046675 Bacteria 542
344 Ga0495599_0079725 3300046678 Bacteria 2044
345 Ga0495599_0365694 3300046678 Unclassified 863
346 Ga0495599_0670242 3300046678 Bacteria 600
347 Ga0495623_0515614 3300046679 Bacteria 629
348 Ga0495646_0079946 3300046680 Unclassified 1907
349 Ga0495646_0659676 3300046680 Unclassified 528
350 Ga0495658_0158233 3300046683 Bacteria 1395
351 Ga0495658_0267097 3300046683 Bacteria 1078
352 Ga0495613_0006189 3300046689 Bacteria 8954
353 Ga0495613_0056293 3300046689 Unclassified 2887
354 Ga0495613_0386175 3300046689 Unclassified 957
355 Ga0495624_0089543 3300046690 Unclassified 1899
356 Ga0495600_0025981 3300046809 Unclassified 3777
357 Ga0495600_0165465 3300046809 Unclassified 1429
358 Ga0495600_0428212 3300046809 Bacteria 820
359 Ga0495600_0638496 3300046809 Unclassified 644
360 Ga0495581_0011490 3300047315 Bacteria 5124
361 Ga0495581_0576108 3300047315 Bacteria 652
362 Ga0495604_0036803 3300047317 Bacteria 3857
363 Ga0495674_0024601 3300047319 Bacteria 5530
364 Ga0495674_0113105 3300047319 Bacteria 2299
365 Ga0495674_0222869 3300047319 Bacteria 1558
366 Ga0495674_0451788 3300047319 Unclassified 1032
367 Ga0495674_0672688 3300047319 Bacteria 814
368 Ga0495676_0019173 3300047321 Bacteria 6019
369 Ga0495676_0019986 3300047321 Bacteria 5882
370 Ga0495676_0034948 3300047321 Unclassified 4210
371 Ga0495680_0002021 3300047322 Bacteria 21279
372 Ga0495680_0314302 3300047322 Unclassified 1097
373 Ga0495684_0002378 3300047471 Bacteria 15041
374 Ga0495684_0131239 3300047471 Unclassified 1881
375 Ga0495593_0002851 3300047673 Bacteria 10420
376 Ga0495593_0060088 3300047673 Bacteria 1990
377 Ga0495593_0531398 3300047673 Unclassified 590
378 Ga0495602_0056238 3300048088 Bacteria 3461
379 Ga0495602_0155686 3300048088 Unclassified 1790
380 Ga0495602_0289249 3300048088 Unclassified 1204
381 Ga0495602_0595419 3300048088 Bacteria 761
382 Ga0495614_0040447 3300048089 Bacteria 2001
383 Ga0496100_0211862 3300048903 Unclassified 1417
384 Ga0496100_0263096 3300048903 Bacteria 1280
385 Ga0496100_0497463 3300048903 Bacteria 939
386 Ga0496101_0859441 3300048904 Bacteria 715
387 Ga0496102_0031131 3300048905 Bacteria 4783
388 Ga0496102_0200458 3300048905 Bacteria 1881
389 Ga0496102_1619273 3300048905 Bacteria 566
390 Ga0496103_0064614 3300048906 Unclassified 2281
391 Ga0496103_0114204 3300048906 Bacteria 1717
392 Ga0496103_0238751 3300048906 Unclassified 1169
393 Ga0496104_0069882 3300048907 Bacteria 3338
394 Ga0496104_1381080 3300048907 Unclassified 607
395 Ga0496105_0130338 3300048908 Bacteria 2073
396 Ga0496105_0492606 3300048908 Unclassified 963
397 Ga0496105_0617949 3300048908 Unclassified 839
398 Ga0496105_0948734 3300048908 Bacteria 646
399 Ga0496105_1271869 3300048908 Unclassified 538
400 Ga0496106_0307555 3300048909 Bacteria 1272
401 Ga0496106_0313013 3300048909 Bacteria 1260
402 Ga0496107_1007689 3300048910 Bacteria 604
403 Ga0496108_0005734 3300048911 Bacteria 10054
404 Ga0496108_1002090 3300048911 Unclassified 713
405 Ga0496109_0049135 3300048912 Bacteria 3839
406 Ga0496111_0388034 3300048914 Unclassified 1032
407 Ga0496112_0002346 3300048915 Bacteria 15195
408 Ga0496112_0005303 3300048915 Bacteria 11122
409 Ga0496112_0024300 3300048915 Bacteria 5800
410 Ga0496112_0085302 3300048915 Unclassified 3124
411 Ga0496112_0760871 3300048915 Unclassified 894
412 Ga0496113_0459512 3300048916 Bacteria 1023
413 Ga0496113_0520482 3300048916 Unclassified 955
414 Ga0496113_1388982 3300048916 Bacteria 544
415 Ga0496114_0117171 3300048917 Unclassified 2288
416 Ga0496114_0121252 3300048917 Bacteria 2249
417 Ga0496114_0394053 3300048917 Unclassified 1226
418 Ga0496114_1406406 3300048917 Unclassified 585
419 Ga0496115_0008343 3300048918 Bacteria 7664
420 Ga0496115_0058134 3300048918 Bacteria 3111
421 Ga0496115_0318348 3300048918 Unclassified 1273
422 nmdc:mga0yw44_182310_c1 3300050492 Bacteria 1382
423 nmdc:mga05p37_262415_c1 3300050507 Unclassified 2067
424 nmdc:mga05p37_374510_c1 3300050507 Unclassified 1670
425 nmdc:mga0n895_618156_c1 3300050512 Unclassified 1085
426 nmdc:mga08x19_726053_c1 3300050514 Archaea 705
427 nmdc:mga0a205_158539_c1 3300050515 Unclassified 2161
428 Ga0495601_0215292 3300053077 Unclassified 1255
429 Ga0495601_0267387 3300053077 Unclassified 1116
430 Ga0495601_0344398 3300053077 Unclassified 969
431 Ga0495612_0001904 3300053078 Bacteria 8584
432 Ga0495595_0001357 3300053084 Bacteria 9508
433 Ga0495595_0418446 3300053084 Bacteria 680
434 Ga0495619_0000841 3300053085 Bacteria 20167
435 Ga0495619_0057552 3300053085 Bacteria 2580
436 Ga0495619_0087392 3300053085 Bacteria 2107
437 Ga0500566_0051312 3300053094 Bacteria 2359
438 Ga0501084_0938142 3300054114 Unclassified 728

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10196619 Ga0070658_101966192 120
2 3300005336 Ga0070680_100689699 Ga0070680_1006896992 120
3 3300005339 Ga0070660_100334477 Ga0070660_1003344772 120
4 3300005366 Ga0070659_100137040 Ga0070659_1001370401 120
5 3300005467 Ga0070706_100705319 Ga0070706_1007053191 120
6 3300005468 Ga0070707_100127812 Ga0070707_1001278122 120
7 3300013297 Ga0157378_12156377 Ga0157378_121563771 120
8 3300005329 Ga0070683_100408128 Ga0070683_1004081281 121
9 3300014497 Ga0182008_10535649 Ga0182008_105356491 121
10 3300005336 Ga0070680_100711076 Ga0070680_1007110761 122
11 3300005337 Ga0070682_101094322 Ga0070682_1010943221 122
12 3300005339 Ga0070660_100127245 Ga0070660_1001272452 122
13 3300005439 Ga0070711_101206141 Ga0070711_1012061411 122
14 3300005458 Ga0070681_10121593 Ga0070681_101215932 122
15 3300005468 Ga0070707_100839963 Ga0070707_1008399632 122
16 3300025912 Ga0207707_10092098 Ga0207707_100920982 122
17 3300025919 Ga0207657_10103256 Ga0207657_101032562 122
18 3300025922 Ga0207646_10310293 Ga0207646_103102932 122
19 3300044694 Ga0466963_0056744 Ga0466963_0056744_1560_1949 122
20 3300045836 Ga0466958_0474031 Ga0466958_0474031_357_746 122
21 3300045976 Ga0466967_0166538 Ga0466967_0166538_1549_1938 122
22 3300048905 Ga0496102_0200458 Ga0496102_0200458_541_930 122
23 3300048915 Ga0496112_0002346 Ga0496112_0002346_4976_5365 122
24 3300048916 Ga0496113_0459512 Ga0496113_0459512_353_742 122
25 3300053077 Ga0495601_0267387 Ga0495601_0267387_360_734 122
26 3300005577 Ga0068857_100496567 Ga0068857_1004965672 123
27 3300050514 nmdc:mga08x19_726053_c1 nmdc:mga08x19_726053_c1_17_388 123
28 3300053077 Ga0495601_0344398 Ga0495601_0344398_13_384 123
29 3300006038 Ga0075365_10140933 Ga0075365_101409332 124
30 3300050492 nmdc:mga0yw44_182310_c1 nmdc:mga0yw44_182310_c1_166_546 124
31 3300005355 Ga0070671_101015419 Ga0070671_1010154191 125
32 3300041458 Ga0451798_0790122 Ga0451798_0790122_56_442 125
33 3300041486 Ga0451807_1018100 Ga0451807_1018100_129_515 125
34 3300048903 Ga0496100_0497463 Ga0496100_0497463_65_451 125
35 3300048907 Ga0496104_0069882 Ga0496104_0069882_2157_2543 125
36 3300048911 Ga0496108_0005734 Ga0496108_0005734_27_413 125
37 3300048912 Ga0496109_0049135 Ga0496109_0049135_250_636 125
38 3300048915 Ga0496112_0005303 Ga0496112_0005303_9457_9843 125
39 3300005467 Ga0070706_101276336 Ga0070706_1012763361 126
40 3300005468 Ga0070707_100690300 Ga0070707_1006903002 126
41 3300013105 Ga0157369_10121462 Ga0157369_101214622 126
42 3300025922 Ga0207646_11907930 Ga0207646_119079301 126
43 3300048909 Ga0496106_0307555 Ga0496106_0307555_95_475 126
44 3300048910 Ga0496107_1007689 Ga0496107_1007689_120_500 126
45 3300037418 Ga0395900_0078350 Ga0395900_0078350_93_476 127
46 3300037471 Ga0395905_0852616 Ga0395905_0852616_303_686 127
47 3300038443 Ga0395901_1654139 Ga0395901_1654139_16_399 127
48 3300005343 Ga0070687_100830364 Ga0070687_1008303642 128
49 3300005434 Ga0070709_10110004 Ga0070709_101100042 128
50 3300005435 Ga0070714_100269802 Ga0070714_1002698021 128
51 3300005435 Ga0070714_101230520 Ga0070714_1012305201 128
52 3300005436 Ga0070713_100201422 Ga0070713_1002014222 128
53 3300005436 Ga0070713_100601934 Ga0070713_1006019342 128
54 3300005437 Ga0070710_10032069 Ga0070710_100320693 128
55 3300005439 Ga0070711_100122339 Ga0070711_1001223392 128
56 3300005439 Ga0070711_100179192 Ga0070711_1001791922 128
57 3300005439 Ga0070711_100753996 Ga0070711_1007539961 128
58 3300005445 Ga0070708_101419820 Ga0070708_1014198201 128
59 3300005536 Ga0070697_100500636 Ga0070697_1005006362 128
60 3300005545 Ga0070695_101220593 Ga0070695_1012205932 128
61 3300005548 Ga0070665_100597921 Ga0070665_1005979212 128
62 3300006028 Ga0070717_10550358 Ga0070717_105503582 128
63 3300006175 Ga0070712_100013115 Ga0070712_1000131152 128
64 3300013308 Ga0157375_11867911 Ga0157375_118679111 128
65 3300014497 Ga0182008_10611531 Ga0182008_106115311 128
66 3300021377 Ga0213874_10018974 Ga0213874_100189742 128
67 3300021384 Ga0213876_10125543 Ga0213876_101255432 128
68 3300021441 Ga0213871_10108522 Ga0213871_101085222 128
69 3300025898 Ga0207692_10044901 Ga0207692_100449013 128
70 3300025898 Ga0207692_10178566 Ga0207692_101785662 128
71 3300025898 Ga0207692_10864218 Ga0207692_108642181 128
72 3300025905 Ga0207685_10447724 Ga0207685_104477241 128
73 3300025906 Ga0207699_10063235 Ga0207699_100632352 128
74 3300025915 Ga0207693_10011697 Ga0207693_100116978 128
75 3300025915 Ga0207693_10047890 Ga0207693_100478903 128
76 3300025915 Ga0207693_10049642 Ga0207693_100496422 128
77 3300025915 Ga0207693_10450517 Ga0207693_104505172 128
78 3300025915 Ga0207693_10849973 Ga0207693_108499731 128
79 3300025916 Ga0207663_10052536 Ga0207663_100525362 128
80 3300025916 Ga0207663_10148385 Ga0207663_101483851 128
81 3300025928 Ga0207700_10033890 Ga0207700_100338903 128
82 3300025928 Ga0207700_10320692 Ga0207700_103206922 128
83 3300025929 Ga0207664_10024782 Ga0207664_100247825 128
84 3300025929 Ga0207664_10495799 Ga0207664_104957991 128
85 3300025939 Ga0207665_10079584 Ga0207665_100795841 128
86 3300026075 Ga0207708_10632846 Ga0207708_106328462 128
87 3300028379 Ga0268266_10514014 Ga0268266_105140142 128
88 3300028556 Ga0265337_1179707 Ga0265337_11797072 128
89 3300028573 Ga0265334_10047731 Ga0265334_100477312 128
90 3300028577 Ga0265318_10013612 Ga0265318_100136125 128
91 3300028666 Ga0265336_10167162 Ga0265336_101671622 128
92 3300028800 Ga0265338_10018614 Ga0265338_100186148 128
93 3300028800 Ga0265338_10129065 Ga0265338_101290652 128
94 3300029957 Ga0265324_10311134 Ga0265324_103111342 128
95 3300031235 Ga0265330_10016979 Ga0265330_100169793 128
96 3300031241 Ga0265325_10031572 Ga0265325_100315724 128
97 3300031241 Ga0265325_10031760 Ga0265325_100317604 128
98 3300031241 Ga0265325_10036543 Ga0265325_100365432 128
99 3300031249 Ga0265339_10020545 Ga0265339_100205454 128
100 3300031250 Ga0265331_10139929 Ga0265331_101399292 128
101 3300031251 Ga0265327_10004878 Ga0265327_100048788 128
102 3300031251 Ga0265327_10074301 Ga0265327_100743014 128
103 3300031344 Ga0265316_10039139 Ga0265316_100391393 128
104 3300031595 Ga0265313_10017252 Ga0265313_100172524 128
105 3300031595 Ga0265313_10026281 Ga0265313_100262813 128
106 3300031711 Ga0265314_10019185 Ga0265314_100191853 128
107 3300031711 Ga0265314_10044849 Ga0265314_100448495 128
108 3300031712 Ga0265342_10086667 Ga0265342_100866672 128
109 3300031731 Ga0307405_10207407 Ga0307405_102074071 128
110 3300031903 Ga0307407_10800696 Ga0307407_108006961 128
111 3300032126 Ga0307415_101122685 Ga0307415_1011226851 128
112 3300032126 Ga0307415_101715929 Ga0307415_1017159292 128
113 3300037418 Ga0395900_0643458 Ga0395900_0643458_413_799 128
114 3300037853 Ga0436364_0312418 Ga0436364_0312418_225_617 128
115 3300037853 Ga0436364_0994868 Ga0436364_0994868_1627_2019 128
116 3300037853 Ga0436364_1163397 Ga0436364_1163397_134_526 128
117 3300039437 Ga0436365_1217175 Ga0436365_1217175_480_872 128
118 3300039437 Ga0436365_1630189 Ga0436365_1630189_1384_1776 128
119 3300039437 Ga0436365_1700702 Ga0436365_1700702_11802_12194 128
120 3300039438 Ga0436360_0454285 Ga0436360_0454285_1122_1520 128
121 3300039447 Ga0436361_0317272 Ga0436361_0317272_247_645 128
122 3300039450 Ga0436363_0530432 Ga0436363_0530432_347_739 128
123 3300039450 Ga0436363_0748736 Ga0436363_0748736_89_475 128
124 3300039450 Ga0436363_0810839 Ga0436363_0810839_1543_1947 128
125 3300041496 Ga0451839_1000935 Ga0451839_1000935_101_487 128
126 3300044693 Ga0466961_0400537 Ga0466961_0400537_179_565 128
127 3300044735 Ga0466968_0114616 Ga0466968_0114616_546_941 128
128 3300045049 Ga0466959_0717672 Ga0466959_0717672_211_612 128
129 3300045049 Ga0466959_0972420 Ga0466959_0972420_99_491 128
130 3300045976 Ga0466967_0758852 Ga0466967_0758852_392_778 128
131 3300046459 Ga0495629_0215237 Ga0495629_0215237_474_884 128
132 3300046473 Ga0495582_0689520 Ga0495582_0689520_158_568 128
133 3300046516 Ga0495628_0211976 Ga0495628_0211976_635_1021 128
134 3300046517 Ga0495630_0002952 Ga0495630_0002952_11231_11641 128
135 3300046533 Ga0495640_0098219 Ga0495640_0098219_1016_1426 128
136 3300046533 Ga0495640_0373887 Ga0495640_0373887_376_762 128
137 3300046535 Ga0495586_0104680 Ga0495586_0104680_623_1033 128
138 3300046642 Ga0495634_0016978 Ga0495634_0016978_2399_2809 128
139 3300046675 Ga0495657_0792043 Ga0495657_0792043_60_446 128
140 3300046678 Ga0495599_0670242 Ga0495599_0670242_166_558 128
141 3300047319 Ga0495674_0113105 Ga0495674_0113105_1607_2017 128
142 3300047319 Ga0495674_0222869 Ga0495674_0222869_327_713 128
143 3300048088 Ga0495602_0289249 Ga0495602_0289249_208_594 128
144 3300048088 Ga0495602_0595419 Ga0495602_0595419_49_435 128
145 3300048903 Ga0496100_0263096 Ga0496100_0263096_769_1155 128
146 3300048904 Ga0496101_0859441 Ga0496101_0859441_217_603 128
147 3300048905 Ga0496102_1619273 Ga0496102_1619273_33_419 128
148 3300048906 Ga0496103_0114204 Ga0496103_0114204_807_1193 128
149 3300048908 Ga0496105_0948734 Ga0496105_0948734_185_571 128
150 3300048909 Ga0496106_0313013 Ga0496106_0313013_792_1178 128
151 3300048916 Ga0496113_1388982 Ga0496113_1388982_60_470 128
152 3300048917 Ga0496114_0121252 Ga0496114_0121252_663_1049 128
153 3300048918 Ga0496115_0008343 Ga0496115_0008343_2323_2709 128
154 3300053077 Ga0495601_0215292 Ga0495601_0215292_686_1072 128
155 3300053084 Ga0495595_0418446 Ga0495595_0418446_93_479 128
156 3300054114 Ga0501084_0938142 Ga0501084_0938142_95_484 128
157 3300004800 Ga0058861_11687215 Ga0058861_116872151 129
158 3300005327 Ga0070658_10600529 Ga0070658_106005292 129
159 3300005327 Ga0070658_10696580 Ga0070658_106965802 129
160 3300005327 Ga0070658_11469703 Ga0070658_114697031 129
161 3300005329 Ga0070683_100965426 Ga0070683_1009654262 129
162 3300005336 Ga0070680_101386347 Ga0070680_1013863471 129
163 3300005339 Ga0070660_100326899 Ga0070660_1003268991 129
164 3300005341 Ga0070691_10513471 Ga0070691_105134711 129
165 3300005344 Ga0070661_100196017 Ga0070661_1001960172 129
166 3300005344 Ga0070661_100862836 Ga0070661_1008628362 129
167 3300005434 Ga0070709_10226115 Ga0070709_102261152 129
168 3300005434 Ga0070709_10335373 Ga0070709_103353732 129
169 3300005435 Ga0070714_100040124 Ga0070714_1000401242 129
170 3300005435 Ga0070714_100309565 Ga0070714_1003095652 129
171 3300005435 Ga0070714_100320099 Ga0070714_1003200994 129
172 3300005435 Ga0070714_100858376 Ga0070714_1008583763 129
173 3300005435 Ga0070714_100901565 Ga0070714_1009015651 129
174 3300005436 Ga0070713_100116247 Ga0070713_1001162473 129
175 3300005437 Ga0070710_10507458 Ga0070710_105074581 129
176 3300005439 Ga0070711_101544598 Ga0070711_1015445981 129
177 3300005440 Ga0070705_100835732 Ga0070705_1008357322 129
178 3300005444 Ga0070694_100159588 Ga0070694_1001595882 129
179 3300005445 Ga0070708_100582037 Ga0070708_1005820372 129
180 3300005445 Ga0070708_100693350 Ga0070708_1006933502 129
181 3300005445 Ga0070708_101648422 Ga0070708_1016484221 129
182 3300005458 Ga0070681_10066102 Ga0070681_100661022 129
183 3300005458 Ga0070681_10337465 Ga0070681_103374652 129
184 3300005458 Ga0070681_11839841 Ga0070681_118398411 129
185 3300005467 Ga0070706_100516114 Ga0070706_1005161142 129
186 3300005467 Ga0070706_100661487 Ga0070706_1006614872 129
187 3300005471 Ga0070698_100869823 Ga0070698_1008698232 129
188 3300005518 Ga0070699_100314006 Ga0070699_1003140062 129
189 3300005530 Ga0070679_100092180 Ga0070679_1000921805 129
190 3300005530 Ga0070679_100490665 Ga0070679_1004906651 129
191 3300005530 Ga0070679_100718892 Ga0070679_1007188922 129
192 3300005535 Ga0070684_101800918 Ga0070684_1018009181 129
193 3300005539 Ga0068853_101748483 Ga0068853_1017484831 129
194 3300005545 Ga0070695_100000615 Ga0070695_10000061516 129
195 3300005545 Ga0070695_100511282 Ga0070695_1005112822 129
196 3300005546 Ga0070696_100371692 Ga0070696_1003716921 129
197 3300005563 Ga0068855_100083614 Ga0068855_1000836144 129
198 3300005563 Ga0068855_100222712 Ga0068855_1002227122 129
199 3300005563 Ga0068855_100573563 Ga0068855_1005735632 129
200 3300005616 Ga0068852_101113626 Ga0068852_1011136262 129
201 3300005618 Ga0068864_101882771 Ga0068864_1018827711 129
202 3300006028 Ga0070717_10069068 Ga0070717_100690682 129
203 3300006042 Ga0075368_10459979 Ga0075368_104599791 129
204 3300006163 Ga0070715_10150563 Ga0070715_101505633 129
205 3300006173 Ga0070716_100079629 Ga0070716_1000796292 129
206 3300006175 Ga0070712_100284273 Ga0070712_1002842731 129
207 3300006175 Ga0070712_101054617 Ga0070712_1010546172 129
208 3300006175 Ga0070712_101406859 Ga0070712_1014068591 129
209 3300006237 Ga0097621_101339890 Ga0097621_1013398901 129
210 3300006847 Ga0075431_100739278 Ga0075431_1007392782 129
211 3300006852 Ga0075433_10775256 Ga0075433_107752562 129
212 3300006871 Ga0075434_100543623 Ga0075434_1005436232 129
213 3300006914 Ga0075436_100171592 Ga0075436_1001715922 129
214 3300006914 Ga0075436_100176354 Ga0075436_1001763541 129
215 3300007788 Ga0099795_10035351 Ga0099795_100353512 129
216 3300009093 Ga0105240_10026950 Ga0105240_100269507 129
217 3300009093 Ga0105240_10704288 Ga0105240_107042882 129
218 3300009093 Ga0105240_12596002 Ga0105240_125960021 129
219 3300009098 Ga0105245_10279758 Ga0105245_102797583 129
220 3300009147 Ga0114129_10500328 Ga0114129_105003283 129
221 3300009148 Ga0105243_10115075 Ga0105243_101150753 129
222 3300009148 Ga0105243_10450083 Ga0105243_104500831 129
223 3300009176 Ga0105242_10234538 Ga0105242_102345382 129
224 3300009545 Ga0105237_10303288 Ga0105237_103032881 129
225 3300010159 Ga0099796_10010428 Ga0099796_100104282 129
226 3300012505 Ga0157339_1064856 Ga0157339_10648561 129
227 3300012507 Ga0157342_1042362 Ga0157342_10423621 129
228 3300012510 Ga0157316_1064456 Ga0157316_10644561 129
229 3300013100 Ga0157373_10313657 Ga0157373_103136572 129
230 3300013100 Ga0157373_10492564 Ga0157373_104925641 129
231 3300013104 Ga0157370_10411815 Ga0157370_104118151 129
232 3300013105 Ga0157369_10011986 Ga0157369_100119867 129
233 3300013105 Ga0157369_10206430 Ga0157369_102064302 129
234 3300013296 Ga0157374_12437649 Ga0157374_124376491 129
235 3300013297 Ga0157378_11075177 Ga0157378_110751772 129
236 3300013307 Ga0157372_11043422 Ga0157372_110434222 129
237 3300013308 Ga0157375_11949421 Ga0157375_119494212 129
238 3300014325 Ga0163163_11248017 Ga0163163_112480171 129
239 3300014969 Ga0157376_10885467 Ga0157376_108854672 129
240 3300020070 Ga0206356_10215760 Ga0206356_102157601 129
241 3300025905 Ga0207685_10132508 Ga0207685_101325082 129
242 3300025906 Ga0207699_10412466 Ga0207699_104124662 129
243 3300025909 Ga0207705_10714560 Ga0207705_107145602 129
244 3300025909 Ga0207705_10917654 Ga0207705_109176542 129
245 3300025910 Ga0207684_11128650 Ga0207684_111286502 129
246 3300025911 Ga0207654_10518987 Ga0207654_105189872 129
247 3300025912 Ga0207707_10338025 Ga0207707_103380252 129
248 3300025912 Ga0207707_10721760 Ga0207707_107217601 129
249 3300025913 Ga0207695_10119224 Ga0207695_101192241 129
250 3300025913 Ga0207695_11111615 Ga0207695_111116151 129
251 3300025914 Ga0207671_11142877 Ga0207671_111428772 129
252 3300025915 Ga0207693_10369335 Ga0207693_103693352 129
253 3300025915 Ga0207693_10378585 Ga0207693_103785851 129
254 3300025916 Ga0207663_10677582 Ga0207663_106775822 129
255 3300025918 Ga0207662_10418343 Ga0207662_104183432 129
256 3300025920 Ga0207649_10791994 Ga0207649_107919942 129
257 3300025921 Ga0207652_10213725 Ga0207652_102137252 129
258 3300025921 Ga0207652_10833779 Ga0207652_108337791 129
259 3300025927 Ga0207687_10492029 Ga0207687_104920292 129
260 3300025928 Ga0207700_10058101 Ga0207700_100581012 129
261 3300025929 Ga0207664_10026012 Ga0207664_100260122 129
262 3300025929 Ga0207664_10066834 Ga0207664_100668344 129
263 3300025929 Ga0207664_10222234 Ga0207664_102222342 129
264 3300025929 Ga0207664_10325176 Ga0207664_103251763 129
265 3300025929 Ga0207664_10418576 Ga0207664_104185762 129
266 3300025929 Ga0207664_11564865 Ga0207664_115648651 129
267 3300025934 Ga0207686_10115903 Ga0207686_101159032 129
268 3300025935 Ga0207709_10218747 Ga0207709_102187471 129
269 3300025937 Ga0207669_10504481 Ga0207669_105044812 129
270 3300025939 Ga0207665_10016032 Ga0207665_100160322 129
271 3300025944 Ga0207661_10185785 Ga0207661_101857851 129
272 3300025945 Ga0207679_10325908 Ga0207679_103259082 129
273 3300025949 Ga0207667_11106930 Ga0207667_111069302 129
274 3300025960 Ga0207651_10429373 Ga0207651_104293732 129
275 3300026041 Ga0207639_10904231 Ga0207639_109042311 129
276 3300026078 Ga0207702_12180672 Ga0207702_121806722 129
277 3300027907 Ga0207428_11136492 Ga0207428_111364921 129
278 3300035089 Ga0373944_0002497 Ga0373944_0002497_682_1071 129
279 3300035111 Ga0373923_0042100 Ga0373923_0042100_1266_1655 129
280 3300035113 Ga0373936_0012425 Ga0373936_0012425_1677_2066 129
281 3300035116 Ga0373945_0051975 Ga0373945_0051975_91_480 129
282 3300035116 Ga0373945_0413332 Ga0373945_0413332_147_536 129
283 3300035117 Ga0373953_0095888 Ga0373953_0095888_583_972 129
284 3300035118 Ga0373954_0100932 Ga0373954_0100932_503_892 129
285 3300035118 Ga0373954_0371893 Ga0373954_0371893_117_506 129
286 3300035119 Ga0373956_0451946 Ga0373956_0451946_58_447 129
287 3300035120 Ga0373957_0111458 Ga0373957_0111458_182_571 129
288 3300035170 Ga0373943_0021075 Ga0373943_0021075_2418_2807 129
289 3300035170 Ga0373943_0053001 Ga0373943_0053001_345_734 129
290 3300035171 Ga0373946_0007826 Ga0373946_0007826_1195_1584 129
291 3300035171 Ga0373946_0170670 Ga0373946_0170670_287_676 129
292 3300035410 Ga0373924_0225319 Ga0373924_0225319_99_488 129
293 3300035692 Ga0373935_0032999 Ga0373935_0032999_743_1132 129
294 3300035692 Ga0373935_0057018 Ga0373935_0057018_1519_1908 129
295 3300035692 Ga0373935_0389726 Ga0373935_0389726_382_771 129
296 3300035695 Ga0373927_0102384 Ga0373927_0102384_1217_1606 129
297 3300035695 Ga0373927_0288006 Ga0373927_0288006_318_707 129
298 3300035695 Ga0373927_1147409 Ga0373927_1147409_51_440 129
299 3300035724 Ga0373933_0235017 Ga0373933_0235017_184_573 129
300 3300035725 Ga0373947_0001172 Ga0373947_0001172_11012_11437 129
301 3300037068 Ga0373925_0004590 Ga0373925_0004590_9994_10383 129
302 3300037068 Ga0373925_0050982 Ga0373925_0050982_903_1328 129
303 3300037068 Ga0373925_0130034 Ga0373925_0130034_1297_1686 129
304 3300037418 Ga0395900_0136904 Ga0395900_0136904_1291_1719 129
305 3300037466 Ga0395898_0014158 Ga0395898_0014158_447_836 129
306 3300037466 Ga0395898_0055053 Ga0395898_0055053_2839_3267 129
307 3300038443 Ga0395901_0352370 Ga0395901_0352370_511_939 129
308 3300038698 Ga0242419_002913 Ga0242419_002913_152_541 129
309 3300041441 Ga0451787_346218 Ga0451787_346218_234_623 129
310 3300041456 Ga0451795_0034971 Ga0451795_0034971_146_535 129
311 3300041463 Ga0451804_1091483 Ga0451804_1091483_77_466 129
312 3300041486 Ga0451807_2296071 Ga0451807_2296071_563_952 129
313 3300041512 Ga0451853_2264426 Ga0451853_2264426_124_513 129
314 3300044693 Ga0466961_0624817 Ga0466961_0624817_67_456 129
315 3300044719 Ga0466971_0720381 Ga0466971_0720381_25_414 129
316 3300044842 Ga0466957_0021839 Ga0466957_0021839_2044_2433 129
317 3300044842 Ga0466957_0050211 Ga0466957_0050211_1532_1921 129
318 3300044901 Ga0466960_0040343 Ga0466960_0040343_1654_2052 129
319 3300044901 Ga0466960_0260437 Ga0466960_0260437_167_619 129
320 3300045049 Ga0466959_0830117 Ga0466959_0830117_101_490 129
321 3300045836 Ga0466958_0028392 Ga0466958_0028392_2519_2908 129
322 3300045836 Ga0466958_0143951 Ga0466958_0143951_174_563 129
323 3300045976 Ga0466967_0027913 Ga0466967_0027913_3046_3435 129
324 3300045976 Ga0466967_0797873 Ga0466967_0797873_317_706 129
325 3300046454 Ga0495592_0123877 Ga0495592_0123877_306_695 129
326 3300046455 Ga0495603_0044509 Ga0495603_0044509_463_852 129
327 3300046455 Ga0495603_0303846 Ga0495603_0303846_48_437 129
328 3300046459 Ga0495629_0001040 Ga0495629_0001040_2589_2978 129
329 3300046459 Ga0495629_0005651 Ga0495629_0005651_2775_3164 129
330 3300046461 Ga0495641_0050039 Ga0495641_0050039_362_751 129
331 3300046461 Ga0495641_0074000 Ga0495641_0074000_512_901 129
332 3300046462 Ga0495651_0019924 Ga0495651_0019924_927_1316 129
333 3300046462 Ga0495651_0088724 Ga0495651_0088724_946_1335 129
334 3300046462 Ga0495651_0263267 Ga0495651_0263267_671_1060 129
335 3300046462 Ga0495651_0691307 Ga0495651_0691307_41_430 129
336 3300046463 Ga0495653_0078314 Ga0495653_0078314_436_825 129
337 3300046463 Ga0495653_0397682 Ga0495653_0397682_208_597 129
338 3300046472 Ga0495580_0263309 Ga0495580_0263309_458_847 129
339 3300046473 Ga0495582_0064118 Ga0495582_0064118_586_975 129
340 3300046473 Ga0495582_0184138 Ga0495582_0184138_743_1132 129
341 3300046475 Ga0495639_0005277 Ga0495639_0005277_3910_4299 129
342 3300046475 Ga0495639_0141334 Ga0495639_0141334_223_612 129
343 3300046476 Ga0495662_0020231 Ga0495662_0020231_362_751 129
344 3300046476 Ga0495662_0202107 Ga0495662_0202107_362_817 129
345 3300046477 Ga0495664_0049334 Ga0495664_0049334_2059_2448 129
346 3300046499 Ga0495594_0076179 Ga0495594_0076179_503_892 129
347 3300046501 Ga0495607_0374318 Ga0495607_0374318_204_593 129
348 3300046514 Ga0495618_0111866 Ga0495618_0111866_802_1191 129
349 3300046514 Ga0495618_0212094 Ga0495618_0212094_290_679 129
350 3300046516 Ga0495628_0134246 Ga0495628_0134246_725_1114 129
351 3300046516 Ga0495628_0539756 Ga0495628_0539756_432_821 129
352 3300046517 Ga0495630_0004773 Ga0495630_0004773_9041_9430 129
353 3300046517 Ga0495630_0689643 Ga0495630_0689643_138_527 129
354 3300046526 Ga0495666_0040189 Ga0495666_0040189_40_429 129
355 3300046529 Ga0495652_0067172 Ga0495652_0067172_443_832 129
356 3300046529 Ga0495652_0089127 Ga0495652_0089127_991_1380 129
357 3300046529 Ga0495652_0191179 Ga0495652_0191179_534_923 129
358 3300046531 Ga0495665_0000530 Ga0495665_0000530_18325_18714 129
359 3300046531 Ga0495665_0005099 Ga0495665_0005099_51_440 129
360 3300046533 Ga0495640_0260577 Ga0495640_0260577_495_884 129
361 3300046535 Ga0495586_0042680 Ga0495586_0042680_213_602 129
362 3300046535 Ga0495586_0758205 Ga0495586_0758205_60_449 129
363 3300046536 Ga0495587_0201852 Ga0495587_0201852_95_484 129
364 3300046543 Ga0495645_0119324 Ga0495645_0119324_776_1165 129
365 3300046557 Ga0495622_0333726 Ga0495622_0333726_103_492 129
366 3300046559 Ga0495667_0022497 Ga0495667_0022497_2027_2416 129
367 3300046559 Ga0495667_0185429 Ga0495667_0185429_455_844 129
368 3300046559 Ga0495667_0654599 Ga0495667_0654599_106_495 129
369 3300046642 Ga0495634_0045101 Ga0495634_0045101_2218_2607 129
370 3300046663 Ga0495635_0178073 Ga0495635_0178073_383_772 129
371 3300046664 Ga0495659_0361054 Ga0495659_0361054_159_548 129
372 3300046674 Ga0495588_0129706 Ga0495588_0129706_724_1113 129
373 3300046674 Ga0495588_0248620 Ga0495588_0248620_113_502 129
374 3300046674 Ga0495588_0527045 Ga0495588_0527045_62_451 129
375 3300046678 Ga0495599_0079725 Ga0495599_0079725_1599_1988 129
376 3300046678 Ga0495599_0365694 Ga0495599_0365694_256_645 129
377 3300046679 Ga0495623_0515614 Ga0495623_0515614_27_416 129
378 3300046680 Ga0495646_0079946 Ga0495646_0079946_198_587 129
379 3300046680 Ga0495646_0659676 Ga0495646_0659676_26_415 129
380 3300046683 Ga0495658_0158233 Ga0495658_0158233_265_654 129
381 3300046683 Ga0495658_0267097 Ga0495658_0267097_429_818 129
382 3300046689 Ga0495613_0006189 Ga0495613_0006189_1187_1576 129
383 3300046689 Ga0495613_0056293 Ga0495613_0056293_213_602 129
384 3300046689 Ga0495613_0386175 Ga0495613_0386175_22_411 129
385 3300046690 Ga0495624_0089543 Ga0495624_0089543_1135_1524 129
386 3300046809 Ga0495600_0025981 Ga0495600_0025981_2070_2459 129
387 3300046809 Ga0495600_0165465 Ga0495600_0165465_941_1330 129
388 3300046809 Ga0495600_0428212 Ga0495600_0428212_218_607 129
389 3300046809 Ga0495600_0638496 Ga0495600_0638496_177_566 129
390 3300047315 Ga0495581_0011490 Ga0495581_0011490_3948_4337 129
391 3300047315 Ga0495581_0576108 Ga0495581_0576108_51_440 129
392 3300047317 Ga0495604_0036803 Ga0495604_0036803_1926_2315 129
393 3300047319 Ga0495674_0024601 Ga0495674_0024601_440_829 129
394 3300047319 Ga0495674_0451788 Ga0495674_0451788_248_637 129
395 3300047319 Ga0495674_0672688 Ga0495674_0672688_51_440 129
396 3300047321 Ga0495676_0019173 Ga0495676_0019173_522_911 129
397 3300047321 Ga0495676_0019986 Ga0495676_0019986_51_440 129
398 3300047321 Ga0495676_0034948 Ga0495676_0034948_2157_2546 129
399 3300047322 Ga0495680_0002021 Ga0495680_0002021_2301_2690 129
400 3300047322 Ga0495680_0314302 Ga0495680_0314302_24_413 129
401 3300047471 Ga0495684_0002378 Ga0495684_0002378_13425_13814 129
402 3300047471 Ga0495684_0131239 Ga0495684_0131239_502_891 129
403 3300047673 Ga0495593_0002851 Ga0495593_0002851_51_440 129
404 3300047673 Ga0495593_0060088 Ga0495593_0060088_1286_1675 129
405 3300047673 Ga0495593_0531398 Ga0495593_0531398_173_562 129
406 3300048088 Ga0495602_0056238 Ga0495602_0056238_1851_2240 129
407 3300048088 Ga0495602_0155686 Ga0495602_0155686_24_413 129
408 3300048089 Ga0495614_0040447 Ga0495614_0040447_1496_1885 129
409 3300048903 Ga0496100_0211862 Ga0496100_0211862_345_734 129
410 3300048905 Ga0496102_0031131 Ga0496102_0031131_4157_4546 129
411 3300048906 Ga0496103_0064614 Ga0496103_0064614_1819_2208 129
412 3300048906 Ga0496103_0238751 Ga0496103_0238751_597_986 129
413 3300048907 Ga0496104_1381080 Ga0496104_1381080_185_574 129
414 3300048908 Ga0496105_0130338 Ga0496105_0130338_1466_1855 129
415 3300048908 Ga0496105_0492606 Ga0496105_0492606_551_940 129
416 3300048908 Ga0496105_0617949 Ga0496105_0617949_440_829 129
417 3300048908 Ga0496105_1271869 Ga0496105_1271869_44_496 129
418 3300048911 Ga0496108_1002090 Ga0496108_1002090_40_429 129
419 3300048914 Ga0496111_0388034 Ga0496111_0388034_184_573 129
420 3300048915 Ga0496112_0024300 Ga0496112_0024300_3143_3532 129
421 3300048915 Ga0496112_0085302 Ga0496112_0085302_1799_2188 129
422 3300048915 Ga0496112_0760871 Ga0496112_0760871_10_399 129
423 3300048916 Ga0496113_0520482 Ga0496113_0520482_414_803 129
424 3300048917 Ga0496114_0117171 Ga0496114_0117171_1536_1925 129
425 3300048917 Ga0496114_0394053 Ga0496114_0394053_23_412 129
426 3300048917 Ga0496114_1406406 Ga0496114_1406406_57_446 129
427 3300048918 Ga0496115_0058134 Ga0496115_0058134_565_954 129
428 3300048918 Ga0496115_0318348 Ga0496115_0318348_445_834 129
429 3300050507 nmdc:mga05p37_262415_c1 nmdc:mga05p37_262415_c1_112_501 129
430 3300050507 nmdc:mga05p37_374510_c1 nmdc:mga05p37_374510_c1_426_815 129
431 3300050512 nmdc:mga0n895_618156_c1 nmdc:mga0n895_618156_c1_486_875 129
432 3300050515 nmdc:mga0a205_158539_c1 nmdc:mga0a205_158539_c1_332_721 129
433 3300053078 Ga0495612_0001904 Ga0495612_0001904_7994_8383 129
434 3300053084 Ga0495595_0001357 Ga0495595_0001357_7670_8059 129
435 3300053085 Ga0495619_0000841 Ga0495619_0000841_2242_2631 129
436 3300053085 Ga0495619_0057552 Ga0495619_0057552_1383_1772 129
437 3300053085 Ga0495619_0087392 Ga0495619_0087392_1068_1457 129
438 3300053094 Ga0500566_0051312 Ga0500566_0051312_73_462 129

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

63

133

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bu7-assembly1.cif.gz_B crystal structure and biochemical characterization of gdosp, a gentisate 1,2-dioxygenase from silicibacter pomeroyi 0.9044 37 112
2d40-assembly1.cif.gz_B crystal structure of z3393 from escherichia coli o157:h7 0.8943 36 115
2d40-assembly1.cif.gz_C crystal structure of z3393 from escherichia coli o157:h7 0.8943 36 115
4e2g-assembly2.cif.gz_C crystal structure of cupin fold protein sthe2323 from sphaerobacter thermophilus 0.8897 3 115
6s0p-assembly1.cif.gz_A plant cysteine oxidase pco4 from arabidopsis thaliana 0.8869 35 113
ID Description Score Start End Superfamily
3cewA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9243 26 116 2.60.120.10
3bu7B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9044 37 112 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9015 35 123 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9007 23 113 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8982 24 113 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7X7R0M3-F1-model_v4 Cupin domain-containing protein 0.9724 26 113 GO:0046872
AF-A0A7V6I4S0-F1-model_v4 Cupin domain-containing protein 0.968 28 113 GO:0046872
AF-A0A6J4TPA1-F1-model_v4 Cupin 2 conserved barrel domain-containing protein 0.9661 1 128
AF-D5EXP4-F1-model_v4 Cupin domain protein 0.9629 26 113 GO:0046872
AF-L0DPG7-F1-model_v4 Cupin domain-containing protein 0.9615 28 113

Feature Viewer

pLDDT pTM Quality
94.91 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map