F444040

General Info

Members Datasets Scaffolds Average Seq Length
438 195 876 143

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0069350|Ga0466966_0069350_1159_1605
Length 148
Sequence VDGLMQVVVLNGANLDVLGRRDPKLYGGLSLNELETRIYDWAHAAGVTARCRQTNSEGEYIGWIHDAYDDADGVIVNPGAWSHYSYAIRDALELLEVPVVEVHLSDVENREQWRRQSVIAEVAAHRVIGKGPDGYREALEFLAGKAED

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
49 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
50 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
51 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
67 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
137 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
141 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
146 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
147 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
195 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 1.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 16.89
Rhizosphere 81.28
Stem 0
Stem Tuber 0
Unclassified 6.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0069350 3300044684 Bacteria 2212
2 Ga0070658_10599413 3300005327 Bacteria 955
3 Ga0070680_100023087 3300005336 Bacteria 4958
4 Ga0070680_100024809 3300005336 Bacteria 4792
5 Ga0070682_100302605 3300005337 Unclassified 1174
6 Ga0070660_100022105 3300005339 Bacteria 4699
7 Ga0070661_100066264 3300005344 Bacteria 2653
8 Ga0070661_100500368 3300005344 Unclassified 973
9 Ga0070661_100566974 3300005344 Bacteria 915
10 Ga0070692_10486796 3300005345 Bacteria 797
11 Ga0070659_100052775 3300005366 Bacteria 3198
12 Ga0070709_10579552 3300005434 Bacteria 862
13 Ga0070714_100006357 3300005435 Bacteria 9111
14 Ga0070714_100076917 3300005435 Bacteria 2898
15 Ga0070714_100199956 3300005435 Bacteria 1828
16 Ga0070714_101220746 3300005435 Bacteria 734
17 Ga0070713_100442235 3300005436 Bacteria 1220
18 Ga0070713_100558571 3300005436 Bacteria 1084
19 Ga0070713_100845059 3300005436 Bacteria 879
20 Ga0070713_100849161 3300005436 Bacteria 877
21 Ga0070713_100925566 3300005436 Bacteria 839
22 Ga0070710_10001590 3300005437 Bacteria 10722
23 Ga0070710_10623546 3300005437 Unclassified 753
24 Ga0070711_100005385 3300005439 Bacteria 7655
25 Ga0070711_100009007 3300005439 Bacteria 6127
26 Ga0070711_100135400 3300005439 Bacteria 1840
27 Ga0070711_100328522 3300005439 Bacteria 1224
28 Ga0070694_100055874 3300005444 Bacteria 2679
29 Ga0070694_100563013 3300005444 Unclassified 914
30 Ga0070663_100551969 3300005455 Bacteria 963
31 Ga0070681_10001216 3300005458 Bacteria 22405
32 Ga0070681_10174786 3300005458 Bacteria 2069
33 Ga0070681_10215194 3300005458 Bacteria 1838
34 Ga0070681_10309702 3300005458 Bacteria 1488
35 Ga0070707_100001273 3300005468 Bacteria 24807
36 Ga0070679_100004090 3300005530 Bacteria 13450
37 Ga0070679_100333427 3300005530 Bacteria 1465
38 Ga0070679_100363799 3300005530 Bacteria 1394
39 Ga0070679_100390647 3300005530 Bacteria 1337
40 Ga0070684_100021195 3300005535 Bacteria 5402
41 Ga0070684_100063356 3300005535 Bacteria 3241
42 Ga0070684_100210840 3300005535 Bacteria 1770
43 Ga0068853_100115415 3300005539 Bacteria 2390
44 Ga0070695_100000023 3300005545 Bacteria 60293
45 Ga0070693_101009944 3300005547 Unclassified 630
46 Ga0068855_100041800 3300005563 Bacteria 5432
47 Ga0068855_100076760 3300005563 Bacteria 3876
48 Ga0068855_100357762 3300005563 Bacteria 1607
49 Ga0070664_100374409 3300005564 Bacteria 1299
50 Ga0068857_100023423 3300005577 Bacteria 5436
51 Ga0068856_100116990 3300005614 Bacteria 2666
52 Ga0068856_100520245 3300005614 Bacteria 1211
53 Ga0068856_100978090 3300005614 Unclassified 865
54 Ga0068852_100133917 3300005616 Bacteria 2286
55 Ga0068852_100450013 3300005616 Bacteria 1275
56 Ga0068864_100058340 3300005618 Bacteria 3335
57 Ga0081540_1001884 3300005983 Bacteria 17556
58 Ga0070717_10022558 3300006028 Bacteria 4975
59 Ga0070717_10048223 3300006028 Bacteria 3493
60 Ga0070717_10059684 3300006028 Bacteria 3157
61 Ga0070717_11001908 3300006028 Unclassified 761
62 Ga0070715_10267915 3300006163 Unclassified 900
63 Ga0070716_100247172 3300006173 Bacteria 1213
64 Ga0070716_100318592 3300006173 Bacteria 1089
65 Ga0070712_100052940 3300006175 Bacteria 2833
66 Ga0070712_100216889 3300006175 Bacteria 1512
67 Ga0070712_100818824 3300006175 Bacteria 800
68 Ga0075433_10074172 3300006852 Bacteria 2994
69 Ga0075433_10460069 3300006852 Bacteria 1121
70 Ga0075434_100168329 3300006871 Bacteria 2211
71 Ga0075435_100212188 3300007076 Bacteria 1643
72 Ga0105240_10047240 3300009093 Bacteria 5448
73 Ga0105240_10362866 3300009093 Bacteria 1640
74 Ga0105240_10560299 3300009093 Bacteria 1263
75 Ga0105240_10694422 3300009093 Bacteria 1111
76 Ga0105240_10976842 3300009093 Bacteria 907
77 Ga0105240_11564353 3300009093 Bacteria 690
78 Ga0111539_10001928 3300009094 Bacteria 27646
79 Ga0111539_10179712 3300009094 Bacteria 2472
80 Ga0105245_10085538 3300009098 Bacteria 2890
81 Ga0105245_10159705 3300009098 Bacteria 2138
82 Ga0114129_10146506 3300009147 Bacteria 3234
83 Ga0114129_10161042 3300009147 Bacteria 3065
84 Ga0114129_12066169 3300009147 Bacteria 688
85 Ga0105241_10651924 3300009174 Bacteria 956
86 Ga0105241_11451393 3300009174 Bacteria 659
87 Ga0105241_12516764 3300009174 Unclassified 516
88 Ga0105242_10855110 3300009176 Bacteria 906
89 Ga0105248_10395718 3300009177 Bacteria 1556
90 Ga0105248_11309037 3300009177 Bacteria 820
91 Ga0105237_10101443 3300009545 Bacteria 2870
92 Ga0105237_10167534 3300009545 Bacteria 2196
93 Ga0105238_10185040 3300009551 Bacteria 2059
94 Ga0105238_10389657 3300009551 Bacteria 1385
95 Ga0099796_10051608 3300010159 Bacteria 1430
96 Ga0105239_11128465 3300010375 Bacteria 903
97 Ga0157320_1020220 3300012481 Bacteria 602
98 Ga0157341_1008515 3300012494 Bacteria 839
99 Ga0157342_1004360 3300012507 Bacteria 1254
100 Ga0157316_1001121 3300012510 Bacteria 1584
101 Ga0157373_10082194 3300013100 Bacteria 2270
102 Ga0157373_10288988 3300013100 Unclassified 1163
103 Ga0157373_10543847 3300013100 Bacteria 842
104 Ga0157373_10790860 3300013100 Bacteria 699
105 Ga0157371_11335540 3300013102 Bacteria 555
106 Ga0157370_10016816 3300013104 Bacteria 7394
107 Ga0157370_10344492 3300013104 Bacteria 1374
108 Ga0157370_11084353 3300013104 Bacteria 724
109 Ga0157369_10135156 3300013105 Bacteria 2611
110 Ga0157369_11009828 3300013105 Bacteria 852
111 Ga0157374_10163676 3300013296 Bacteria 2168
112 Ga0157374_10765779 3300013296 Bacteria 980
113 Ga0157378_10324892 3300013297 Bacteria 1496
114 Ga0163162_10277871 3300013306 Bacteria 1807
115 Ga0157372_10070101 3300013307 Bacteria 3944
116 Ga0157372_10084531 3300013307 Bacteria 3597
117 Ga0157372_10154252 3300013307 Bacteria 2652
118 Ga0157372_10200851 3300013307 Bacteria 2309
119 Ga0157375_10135241 3300013308 Bacteria 2588
120 Ga0163163_10116039 3300014325 Bacteria 2709
121 Ga0163163_12921243 3300014325 Unclassified 533
122 Ga0157377_10372182 3300014745 Bacteria 965
123 Ga0157379_10837091 3300014968 Bacteria 870
124 Ga0157376_10168545 3300014969 Bacteria 1992
125 Ga0157376_10197961 3300014969 Bacteria 1847
126 Ga0182007_10162596 3300015262 Bacteria 764
127 Ga0182005_1123844 3300015265 Bacteria 737
128 Ga0197907_10071468 3300020069 Bacteria 1037
129 Ga0197907_10970785 3300020069 Bacteria 2233
130 Ga0206354_11275485 3300020081 Bacteria 3095
131 Ga0206353_10032221 3300020082 Bacteria 597
132 Ga0206353_10430285 3300020082 Bacteria 2425
133 Ga0154015_1649951 3300020610 Bacteria 914
134 Ga0213876_10188094 3300021384 Bacteria 1098
135 Ga0207692_10018241 3300025898 Bacteria 3146
136 Ga0207692_10751727 3300025898 Unclassified 635
137 Ga0207699_10174567 3300025906 Bacteria 1440
138 Ga0207705_10175083 3300025909 Bacteria 1617
139 Ga0207705_10186193 3300025909 Bacteria 1568
140 Ga0207705_10352457 3300025909 Bacteria 1134
141 Ga0207707_10019260 3300025912 Bacteria 5957
142 Ga0207707_10212007 3300025912 Bacteria 1687
143 Ga0207707_10243310 3300025912 Bacteria 1564
144 Ga0207707_10334538 3300025912 Bacteria 1306
145 Ga0207695_10177138 3300025913 Bacteria 2054
146 Ga0207671_10068278 3300025914 Bacteria 2648
147 Ga0207671_10146851 3300025914 Bacteria 1820
148 Ga0207671_10471711 3300025914 Bacteria 1000
149 Ga0207693_10000198 3300025915 Bacteria 54576
150 Ga0207693_10059093 3300025915 Bacteria 3003
151 Ga0207663_10012170 3300025916 Bacteria 4643
152 Ga0207663_10131578 3300025916 Bacteria 1729
153 Ga0207663_11673062 3300025916 Bacteria 512
154 Ga0207660_10006952 3300025917 Bacteria 7326
155 Ga0207660_10235323 3300025917 Bacteria 1441
156 Ga0207657_10077242 3300025919 Bacteria 2807
157 Ga0207657_10129347 3300025919 Bacteria 2071
158 Ga0207657_10342505 3300025919 Bacteria 1180
159 Ga0207649_10042588 3300025920 Bacteria 2770
160 Ga0207649_10143647 3300025920 Bacteria 1636
161 Ga0207652_10039111 3300025921 Bacteria 4024
162 Ga0207652_10050043 3300025921 Bacteria 3579
163 Ga0207652_10169440 3300025921 Bacteria 1959
164 Ga0207646_10004655 3300025922 Bacteria 14797
165 Ga0207694_10267537 3300025924 Bacteria 1401
166 Ga0207687_10309123 3300025927 Bacteria 1276
167 Ga0207700_10326928 3300025928 Bacteria 1330
168 Ga0207700_10503340 3300025928 Bacteria 1072
169 Ga0207700_10526286 3300025928 Bacteria 1048
170 Ga0207664_10032010 3300025929 Bacteria 4028
171 Ga0207664_10241518 3300025929 Bacteria 1573
172 Ga0207664_10402957 3300025929 Bacteria 1217
173 Ga0207664_10810372 3300025929 Bacteria 842
174 Ga0207664_11226185 3300025929 Bacteria 669
175 Ga0207644_10481506 3300025931 Unclassified 1022
176 Ga0207665_10157054 3300025939 Bacteria 1633
177 Ga0207665_10706686 3300025939 Unclassified 793
178 Ga0207711_10328853 3300025941 Bacteria 1413
179 Ga0207661_10054599 3300025944 Bacteria 3201
180 Ga0207661_10308088 3300025944 Bacteria 1421
181 Ga0207679_10139695 3300025945 Bacteria 1956
182 Ga0207667_10289297 3300025949 Bacteria 1674
183 Ga0207667_10806287 3300025949 Bacteria 935
184 Ga0207651_10986065 3300025960 Bacteria 753
185 Ga0207639_10594412 3300026041 Bacteria 1020
186 Ga0207678_10192943 3300026067 Bacteria 1741
187 Ga0207641_10183116 3300026088 Bacteria 1920
188 Ga0207676_10505349 3300026095 Bacteria 1148
189 Ga0207674_10019717 3300026116 Bacteria 7300
190 Ga0207698_10364063 3300026142 Bacteria 1370
191 Ga0207428_10190101 3300027907 Bacteria 1548
192 Ga0373944_0222126 3300035089 Bacteria 690
193 Ga0373936_0001651 3300035113 Bacteria 8182
194 Ga0373939_0081206 3300035114 Bacteria 1077
195 Ga0373943_0004165 3300035170 Bacteria 6563
196 Ga0373942_0193185 3300035207 Bacteria 672
197 Ga0373927_0028600 3300035695 Bacteria 3636
198 Ga0373947_0009028 3300035725 Bacteria 5732
199 Ga0373947_0245028 3300035725 Bacteria 1184
200 Ga0373925_0009063 3300037068 Bacteria 7242
201 Ga0395899_0004144 3300037312 Bacteria 11391
202 Ga0395899_0458698 3300037312 Bacteria 833
203 Ga0395899_0541968 3300037312 Bacteria 749
204 Ga0395900_0024289 3300037418 Bacteria 6206
205 Ga0395900_0143270 3300037418 Bacteria 2446
206 Ga0395900_0452937 3300037418 Bacteria 1239
207 Ga0395900_0708854 3300037418 Bacteria 939
208 Ga0395900_0993294 3300037418 Bacteria 759
209 Ga0395898_0032483 3300037466 Bacteria 5210
210 Ga0395898_0065411 3300037466 Bacteria 3525
211 Ga0395898_0272225 3300037466 Bacteria 1615
212 Ga0395898_0575082 3300037466 Bacteria 1069
213 Ga0395898_0695030 3300037466 Bacteria 959
214 Ga0395898_1170022 3300037466 Bacteria 701
215 Ga0395898_1178605 3300037466 Bacteria 698
216 Ga0395905_0128894 3300037471 Bacteria 2379
217 Ga0395905_0194907 3300037471 Bacteria 1900
218 Ga0395905_0304671 3300037471 Unclassified 1481
219 Ga0436364_0788659 3300037853 Bacteria 1758
220 Ga0395901_0017394 3300038443 Bacteria 7340
221 Ga0395901_0026574 3300038443 Bacteria 5944
222 Ga0395901_0058174 3300038443 Bacteria 4021
223 Ga0395901_0076731 3300038443 Bacteria 3487
224 Ga0395901_0154638 3300038443 Bacteria 2409
225 Ga0395901_0421337 3300038443 Bacteria 1369
226 Ga0436365_0954189 3300039437 Bacteria 1925
227 Ga0436365_1500758 3300039437 Bacteria 1801
228 Ga0436363_0540092 3300039450 Bacteria 785
229 Ga0436363_0916693 3300039450 Bacteria 692
230 Ga0436363_0928073 3300039450 Unclassified 805
231 Ga0436363_1053431 3300039450 Bacteria 2536
232 Ga0439453_0025576 3300041408 Bacteria 1090
233 Ga0451577_0516840 3300042876 Bacteria 1084
234 Ga0466969_0045674 3300044656 Bacteria 2174
235 Ga0466965_0204884 3300044683 Bacteria 1047
236 Ga0466966_0001372 3300044684 Bacteria 15654
237 Ga0466966_0030634 3300044684 Bacteria 3490
238 Ga0466966_0084152 3300044684 Bacteria 1979
239 Ga0466966_0096654 3300044684 Bacteria 1829
240 Ga0466961_0002911 3300044693 Bacteria 10626
241 Ga0466961_0040721 3300044693 Bacteria 2978
242 Ga0466961_0071826 3300044693 Bacteria 2196
243 Ga0466961_0166802 3300044693 Bacteria 1370
244 Ga0466961_0539394 3300044693 Unclassified 703
245 Ga0466963_0003081 3300044694 Bacteria 9445
246 Ga0466963_0009821 3300044694 Bacteria 5777
247 Ga0466963_0012380 3300044694 Bacteria 5220
248 Ga0466963_0013553 3300044694 Bacteria 5007
249 Ga0466963_0050173 3300044694 Bacteria 2762
250 Ga0466963_0059375 3300044694 Bacteria 2552
251 Ga0466963_0089844 3300044694 Bacteria 2090
252 Ga0466963_0249133 3300044694 Unclassified 1247
253 Ga0466963_0266896 3300044694 Bacteria 1202
254 Ga0466964_0009009 3300044706 Bacteria 3756
255 Ga0466964_0009122 3300044706 Bacteria 3732
256 Ga0466964_0022278 3300044706 Bacteria 2456
257 Ga0466964_0772780 3300044706 Bacteria 541
258 Ga0453684_1289242 3300044712 Bacteria 763
259 Ga0466971_0001838 3300044719 Bacteria 9020
260 Ga0466971_0043971 3300044719 Bacteria 2006
261 Ga0466971_0071291 3300044719 Bacteria 1578
262 Ga0466971_0080693 3300044719 Bacteria 1483
263 Ga0466971_0370105 3300044719 Bacteria 696
264 Ga0466971_0386313 3300044719 Bacteria 681
265 Ga0466968_0011869 3300044735 Bacteria 3400
266 Ga0466968_0016885 3300044735 Bacteria 2910
267 Ga0466968_0067739 3300044735 Bacteria 1549
268 Ga0466968_0116203 3300044735 Bacteria 1207
269 Ga0466968_0160049 3300044735 Bacteria 1039
270 Ga0466970_0242853 3300044765 Bacteria 1008
271 Ga0466957_0001323 3300044842 Bacteria 12938
272 Ga0466957_0018705 3300044842 Bacteria 4070
273 Ga0466957_0060019 3300044842 Bacteria 2332
274 Ga0466957_0079210 3300044842 Bacteria 2044
275 Ga0466957_0158618 3300044842 Bacteria 1468
276 Ga0466957_0285819 3300044842 Bacteria 1105
277 Ga0466957_0296044 3300044842 Bacteria 1086
278 Ga0466957_0982426 3300044842 Bacteria 606
279 Ga0466960_0006101 3300044901 Bacteria 4820
280 Ga0466960_0518649 3300044901 Bacteria 700
281 Ga0466959_0005421 3300045049 Bacteria 8729
282 Ga0466959_0022491 3300045049 Bacteria 4662
283 Ga0466959_0255135 3300045049 Bacteria 1209
284 Ga0466958_0001250 3300045836 Bacteria 11901
285 Ga0466958_0010910 3300045836 Bacteria 5103
286 Ga0466958_0090307 3300045836 Bacteria 1895
287 Ga0466958_0340342 3300045836 Bacteria 965
288 Ga0466967_0006846 3300045976 Bacteria 8131
289 Ga0466967_0008441 3300045976 Bacteria 7548
290 Ga0466967_0010633 3300045976 Bacteria 6915
291 Ga0466967_0013789 3300045976 Bacteria 6263
292 Ga0466967_0036404 3300045976 Bacteria 4201
293 Ga0466967_0047379 3300045976 Bacteria 3747
294 Ga0466967_0060507 3300045976 Bacteria 3356
295 Ga0466967_0115659 3300045976 Bacteria 2470
296 Ga0466967_0129048 3300045976 Bacteria 2345
297 Ga0466967_0130859 3300045976 Bacteria 2329
298 Ga0466967_0139060 3300045976 Bacteria 2261
299 Ga0466967_0277761 3300045976 Bacteria 1606
300 Ga0466967_0298030 3300045976 Bacteria 1551
301 Ga0466967_0598148 3300045976 Bacteria 1088
302 Ga0495629_0001473 3300046459 Bacteria 18571
303 Ga0495629_0021928 3300046459 Bacteria 4558
304 Ga0495629_0213500 3300046459 Unclassified 1332
305 Ga0495641_0044670 3300046461 Bacteria 2043
306 Ga0495653_0153534 3300046463 Bacteria 1606
307 Ga0495582_0121584 3300046473 Bacteria 1471
308 Ga0495582_0376364 3300046473 Bacteria 818
309 Ga0495639_0101483 3300046475 Bacteria 1359
310 Ga0495584_0201004 3300046491 Bacteria 1013
311 Ga0495607_0023628 3300046501 Bacteria 3845
312 Ga0495618_0510629 3300046514 Unclassified 724
313 Ga0495630_0011122 3300046517 Bacteria 6513
314 Ga0495630_0109105 3300046517 Bacteria 2096
315 Ga0495630_0248272 3300046517 Bacteria 1359
316 Ga0495631_0263912 3300046518 Bacteria 734
317 Ga0495644_0128463 3300046523 Bacteria 965
318 Ga0495666_0349848 3300046526 Bacteria 666
319 Ga0495642_0050880 3300046528 Bacteria 1704
320 Ga0495665_0089328 3300046531 Unclassified 1619
321 Ga0495640_0082115 3300046533 Bacteria 2141
322 Ga0495656_0080549 3300046615 Bacteria 1468
323 Ga0495668_0551809 3300046616 Bacteria 636
324 Ga0495634_0138363 3300046642 Bacteria 1548
325 Ga0495634_0177539 3300046642 Bacteria 1335
326 Ga0495647_0298955 3300046681 Bacteria 725
327 Ga0495658_0086765 3300046683 Bacteria 1847
328 Ga0495658_0120388 3300046683 Bacteria 1587
329 Ga0495613_0022068 3300046689 Bacteria 4744
330 Ga0495613_0030653 3300046689 Bacteria 3995
331 Ga0495613_0079252 3300046689 Bacteria 2388
332 Ga0495624_0312491 3300046690 Bacteria 947
333 Ga0495604_0133262 3300047317 Bacteria 1784
334 Ga0495674_0026681 3300047319 Bacteria 5284
335 Ga0495676_0088126 3300047321 Bacteria 2329
336 Ga0495676_0563218 3300047321 Bacteria 744
337 Ga0495680_0056696 3300047322 Bacteria 3032
338 Ga0495614_0387447 3300048089 Unclassified 655
339 Ga0496100_0012827 3300048903 Bacteria 4817
340 Ga0496100_0072349 3300048903 Bacteria 2304
341 Ga0496100_0106829 3300048903 Bacteria 1938
342 Ga0496101_0017071 3300048904 Bacteria 4916
343 Ga0496101_0018307 3300048904 Bacteria 4761
344 Ga0496102_0120253 3300048905 Bacteria 2453
345 Ga0496102_0491033 3300048905 Bacteria 1149
346 Ga0496102_0608660 3300048905 Unclassified 1016
347 Ga0496102_0671779 3300048905 Bacteria 959
348 Ga0496103_0011110 3300048906 Bacteria 5332
349 Ga0496103_0018185 3300048906 Bacteria 4215
350 Ga0496104_0000977 3300048907 Bacteria 24462
351 Ga0496104_0001337 3300048907 Bacteria 21325
352 Ga0496104_0074386 3300048907 Bacteria 3234
353 Ga0496104_0231297 3300048907 Bacteria 1760
354 Ga0496104_0693751 3300048907 Bacteria 926
355 Ga0496105_0002654 3300048908 Bacteria 13026
356 Ga0496105_0027308 3300048908 Bacteria 4661
357 Ga0496105_0115095 3300048908 Bacteria 2218
358 Ga0496105_0202804 3300048908 Bacteria 1618
359 Ga0496105_0380004 3300048908 Bacteria 1124
360 Ga0496106_0016435 3300048909 Bacteria 5475
361 Ga0496106_0279036 3300048909 Bacteria 1339
362 Ga0496107_0048574 3300048910 Bacteria 3058
363 Ga0496107_0147695 3300048910 Bacteria 1738
364 Ga0496107_0763234 3300048910 Bacteria 709
365 Ga0496107_1085568 3300048910 Bacteria 579
366 Ga0496108_0000272 3300048911 Bacteria 44414
367 Ga0496108_0014268 3300048911 Bacteria 6483
368 Ga0496108_0031484 3300048911 Bacteria 4402
369 Ga0496109_0000857 3300048912 Bacteria 25402
370 Ga0496109_0001789 3300048912 Bacteria 17869
371 Ga0496109_0045880 3300048912 Bacteria 3967
372 Ga0496109_0063963 3300048912 Bacteria 3365
373 Ga0496109_0097461 3300048912 Bacteria 2725
374 Ga0496109_0364583 3300048912 Bacteria 1365
375 Ga0496109_0529837 3300048912 Bacteria 1112
376 Ga0496109_0968565 3300048912 Bacteria 788
377 Ga0496110_0001545 3300048913 Bacteria 16749
378 Ga0496110_0019527 3300048913 Bacteria 5705
379 Ga0496110_0340554 3300048913 Bacteria 1366
380 Ga0496110_0376153 3300048913 Bacteria 1294
381 Ga0496110_0773548 3300048913 Bacteria 864
382 Ga0496110_1398353 3300048913 Unclassified 609
383 Ga0496111_0001182 3300048914 Bacteria 14531
384 Ga0496111_0031342 3300048914 Bacteria 3787
385 Ga0496111_0056197 3300048914 Bacteria 2847
386 Ga0496111_1050659 3300048914 Bacteria 582
387 Ga0496112_0026349 3300048915 Bacteria 5591
388 Ga0496112_0127357 3300048915 Bacteria 2517
389 Ga0496112_0141705 3300048915 Bacteria 2373
390 Ga0496112_0173162 3300048915 Bacteria 2124
391 Ga0496112_0256111 3300048915 Bacteria 1700
392 Ga0496112_0784342 3300048915 Bacteria 878
393 Ga0496112_0880762 3300048915 Bacteria 818
394 Ga0496112_1161866 3300048915 Bacteria 689
395 Ga0496112_1584591 3300048915 Bacteria 568
396 Ga0496113_0000040 3300048916 Bacteria 55517
397 Ga0496113_0441385 3300048916 Bacteria 1045
398 Ga0496114_0024418 3300048917 Bacteria 4934
399 Ga0496114_0032407 3300048917 Bacteria 4302
400 Ga0496114_0091593 3300048917 Bacteria 2582
401 Ga0496114_0115593 3300048917 Bacteria 2302
402 Ga0496114_0145416 3300048917 Bacteria 2055
403 Ga0496114_0164234 3300048917 Bacteria 1932
404 Ga0496114_0247219 3300048917 Bacteria 1569
405 Ga0496114_0738687 3300048917 Bacteria 861
406 Ga0496115_0003551 3300048918 Bacteria 11223
407 Ga0496115_0031760 3300048918 Bacteria 4163
408 Ga0496115_0049895 3300048918 Bacteria 3351
409 Ga0496115_0051963 3300048918 Bacteria 3286
410 Ga0496115_0068958 3300048918 Bacteria 2863
411 Ga0496115_0252379 3300048918 Bacteria 1452
412 Ga0496115_0339978 3300048918 Bacteria 1225
413 Ga0501047_0095622 3300049581 Bacteria 2850
414 Ga0501067_0073967 3300049583 Bacteria 1888
415 Ga0501067_0105998 3300049583 Bacteria 1562
416 Ga0501069_0007108 3300049585 Bacteria 5865
417 Ga0501070_0042772 3300049586 Bacteria 3772
418 Ga0501070_0072404 3300049586 Bacteria 2853
419 Ga0501070_1158577 3300049586 Bacteria 594
420 Ga0501074_0006879 3300049590 Bacteria 8213
421 Ga0501074_0101472 3300049590 Bacteria 2060
422 Ga0501079_0315558 3300049741 Bacteria 1224
423 Ga0501080_0064734 3300049742 Bacteria 3400
424 Ga0501035_0190791 3300049822 Bacteria 1762
425 nmdc:mga05p37_299511_c1 3300050507 Bacteria 1911
426 nmdc:mga05p37_40689_c1 3300050507 Bacteria 5707
427 nmdc:mga08y16_704259_c1 3300050511 Bacteria 1009
428 nmdc:mga0n895_89177_c1 3300050512 Bacteria 3085
429 nmdc:mga0rr50_1051023_c1 3300050513 Bacteria 693
430 nmdc:mga0a205_117780_c1 3300050515 Bacteria 2554
431 Ga0495619_0157549 3300053085 Unclassified 1567
432 Ga0587128_052647 3300059630 Unclassified 747
433 Ga0587111_0209304 3300060346 Unclassified 557
434 Ga0466962_0001141 3300061719 Bacteria 12262
435 Ga0466962_0060353 3300061719 Bacteria 1810
436 Ga0466962_0120528 3300061719 Bacteria 1266
437 Ga0466962_0748679 3300061719 Bacteria 503
438 Ga0530510_1299681 3300061734 Bacteria 558
439 Ga0466966_0069350
440 Ga0070658_10599413
441 Ga0070680_100023087
442 Ga0070680_100024809
443 Ga0070682_100302605
444 Ga0070660_100022105
445 Ga0070661_100066264
446 Ga0070661_100500368
447 Ga0070661_100566974
448 Ga0070692_10486796
449 Ga0070659_100052775
450 Ga0070709_10579552
451 Ga0070714_100006357
452 Ga0070714_100076917
453 Ga0070714_100199956
454 Ga0070714_101220746
455 Ga0070713_100442235
456 Ga0070713_100558571
457 Ga0070713_100845059
458 Ga0070713_100849161
459 Ga0070713_100925566
460 Ga0070710_10001590
461 Ga0070710_10623546
462 Ga0070711_100005385
463 Ga0070711_100009007
464 Ga0070711_100135400
465 Ga0070711_100328522
466 Ga0070694_100055874
467 Ga0070694_100563013
468 Ga0070663_100551969
469 Ga0070681_10001216
470 Ga0070681_10174786
471 Ga0070681_10215194
472 Ga0070681_10309702
473 Ga0070707_100001273
474 Ga0070679_100004090
475 Ga0070679_100333427
476 Ga0070679_100363799
477 Ga0070679_100390647
478 Ga0070684_100021195
479 Ga0070684_100063356
480 Ga0070684_100210840
481 Ga0068853_100115415
482 Ga0070695_100000023
483 Ga0070693_101009944
484 Ga0068855_100041800
485 Ga0068855_100076760
486 Ga0068855_100357762
487 Ga0070664_100374409
488 Ga0068857_100023423
489 Ga0068856_100116990
490 Ga0068856_100520245
491 Ga0068856_100978090
492 Ga0068852_100133917
493 Ga0068852_100450013
494 Ga0068864_100058340
495 Ga0081540_1001884
496 Ga0070717_10022558
497 Ga0070717_10048223
498 Ga0070717_10059684
499 Ga0070717_11001908
500 Ga0070715_10267915
501 Ga0070716_100247172
502 Ga0070716_100318592
503 Ga0070712_100052940
504 Ga0070712_100216889
505 Ga0070712_100818824
506 Ga0075433_10074172
507 Ga0075433_10460069
508 Ga0075434_100168329
509 Ga0075435_100212188
510 Ga0105240_10047240
511 Ga0105240_10362866
512 Ga0105240_10560299
513 Ga0105240_10694422
514 Ga0105240_10976842
515 Ga0105240_11564353
516 Ga0111539_10001928
517 Ga0111539_10179712
518 Ga0105245_10085538
519 Ga0105245_10159705
520 Ga0114129_10146506
521 Ga0114129_10161042
522 Ga0114129_12066169
523 Ga0105241_10651924
524 Ga0105241_11451393
525 Ga0105241_12516764
526 Ga0105242_10855110
527 Ga0105248_10395718
528 Ga0105248_11309037
529 Ga0105237_10101443
530 Ga0105237_10167534
531 Ga0105238_10185040
532 Ga0105238_10389657
533 Ga0099796_10051608
534 Ga0105239_11128465
535 Ga0157320_1020220
536 Ga0157341_1008515
537 Ga0157342_1004360
538 Ga0157316_1001121
539 Ga0157373_10082194
540 Ga0157373_10288988
541 Ga0157373_10543847
542 Ga0157373_10790860
543 Ga0157371_11335540
544 Ga0157370_10016816
545 Ga0157370_10344492
546 Ga0157370_11084353
547 Ga0157369_10135156
548 Ga0157369_11009828
549 Ga0157374_10163676
550 Ga0157374_10765779
551 Ga0157378_10324892
552 Ga0163162_10277871
553 Ga0157372_10070101
554 Ga0157372_10084531
555 Ga0157372_10154252
556 Ga0157372_10200851
557 Ga0157375_10135241
558 Ga0163163_10116039
559 Ga0163163_12921243
560 Ga0157377_10372182
561 Ga0157379_10837091
562 Ga0157376_10168545
563 Ga0157376_10197961
564 Ga0182007_10162596
565 Ga0182005_1123844
566 Ga0197907_10071468
567 Ga0197907_10970785
568 Ga0206354_11275485
569 Ga0206353_10032221
570 Ga0206353_10430285
571 Ga0154015_1649951
572 Ga0213876_10188094
573 Ga0207692_10018241
574 Ga0207692_10751727
575 Ga0207699_10174567
576 Ga0207705_10175083
577 Ga0207705_10186193
578 Ga0207705_10352457
579 Ga0207707_10019260
580 Ga0207707_10212007
581 Ga0207707_10243310
582 Ga0207707_10334538
583 Ga0207695_10177138
584 Ga0207671_10068278
585 Ga0207671_10146851
586 Ga0207671_10471711
587 Ga0207693_10000198
588 Ga0207693_10059093
589 Ga0207663_10012170
590 Ga0207663_10131578
591 Ga0207663_11673062
592 Ga0207660_10006952
593 Ga0207660_10235323
594 Ga0207657_10077242
595 Ga0207657_10129347
596 Ga0207657_10342505
597 Ga0207649_10042588
598 Ga0207649_10143647
599 Ga0207652_10039111
600 Ga0207652_10050043
601 Ga0207652_10169440
602 Ga0207646_10004655
603 Ga0207694_10267537
604 Ga0207687_10309123
605 Ga0207700_10326928
606 Ga0207700_10503340
607 Ga0207700_10526286
608 Ga0207664_10032010
609 Ga0207664_10241518
610 Ga0207664_10402957
611 Ga0207664_10810372
612 Ga0207664_11226185
613 Ga0207644_10481506
614 Ga0207665_10157054
615 Ga0207665_10706686
616 Ga0207711_10328853
617 Ga0207661_10054599
618 Ga0207661_10308088
619 Ga0207679_10139695
620 Ga0207667_10289297
621 Ga0207667_10806287
622 Ga0207651_10986065
623 Ga0207639_10594412
624 Ga0207678_10192943
625 Ga0207641_10183116
626 Ga0207676_10505349
627 Ga0207674_10019717
628 Ga0207698_10364063
629 Ga0207428_10190101
630 Ga0373944_0222126
631 Ga0373936_0001651
632 Ga0373939_0081206
633 Ga0373943_0004165
634 Ga0373942_0193185
635 Ga0373927_0028600
636 Ga0373947_0009028
637 Ga0373947_0245028
638 Ga0373925_0009063
639 Ga0395899_0004144
640 Ga0395899_0458698
641 Ga0395899_0541968
642 Ga0395900_0024289
643 Ga0395900_0143270
644 Ga0395900_0452937
645 Ga0395900_0708854
646 Ga0395900_0993294
647 Ga0395898_0032483
648 Ga0395898_0065411
649 Ga0395898_0272225
650 Ga0395898_0575082
651 Ga0395898_0695030
652 Ga0395898_1170022
653 Ga0395898_1178605
654 Ga0395905_0128894
655 Ga0395905_0194907
656 Ga0395905_0304671
657 Ga0436364_0788659
658 Ga0395901_0017394
659 Ga0395901_0026574
660 Ga0395901_0058174
661 Ga0395901_0076731
662 Ga0395901_0154638
663 Ga0395901_0421337
664 Ga0436365_0954189
665 Ga0436365_1500758
666 Ga0436363_0540092
667 Ga0436363_0916693
668 Ga0436363_0928073
669 Ga0436363_1053431
670 Ga0439453_0025576
671 Ga0451577_0516840
672 Ga0466969_0045674
673 Ga0466965_0204884
674 Ga0466966_0001372
675 Ga0466966_0030634
676 Ga0466966_0084152
677 Ga0466966_0096654
678 Ga0466961_0002911
679 Ga0466961_0040721
680 Ga0466961_0071826
681 Ga0466961_0166802
682 Ga0466961_0539394
683 Ga0466963_0003081
684 Ga0466963_0009821
685 Ga0466963_0012380
686 Ga0466963_0013553
687 Ga0466963_0050173
688 Ga0466963_0059375
689 Ga0466963_0089844
690 Ga0466963_0249133
691 Ga0466963_0266896
692 Ga0466964_0009009
693 Ga0466964_0009122
694 Ga0466964_0022278
695 Ga0466964_0772780
696 Ga0453684_1289242
697 Ga0466971_0001838
698 Ga0466971_0043971
699 Ga0466971_0071291
700 Ga0466971_0080693
701 Ga0466971_0370105
702 Ga0466971_0386313
703 Ga0466968_0011869
704 Ga0466968_0016885
705 Ga0466968_0067739
706 Ga0466968_0116203
707 Ga0466968_0160049
708 Ga0466970_0242853
709 Ga0466957_0001323
710 Ga0466957_0018705
711 Ga0466957_0060019
712 Ga0466957_0079210
713 Ga0466957_0158618
714 Ga0466957_0285819
715 Ga0466957_0296044
716 Ga0466957_0982426
717 Ga0466960_0006101
718 Ga0466960_0518649
719 Ga0466959_0005421
720 Ga0466959_0022491
721 Ga0466959_0255135
722 Ga0466958_0001250
723 Ga0466958_0010910
724 Ga0466958_0090307
725 Ga0466958_0340342
726 Ga0466967_0006846
727 Ga0466967_0008441
728 Ga0466967_0010633
729 Ga0466967_0013789
730 Ga0466967_0036404
731 Ga0466967_0047379
732 Ga0466967_0060507
733 Ga0466967_0115659
734 Ga0466967_0129048
735 Ga0466967_0130859
736 Ga0466967_0139060
737 Ga0466967_0277761
738 Ga0466967_0298030
739 Ga0466967_0598148
740 Ga0495629_0001473
741 Ga0495629_0021928
742 Ga0495629_0213500
743 Ga0495641_0044670
744 Ga0495653_0153534
745 Ga0495582_0121584
746 Ga0495582_0376364
747 Ga0495639_0101483
748 Ga0495584_0201004
749 Ga0495607_0023628
750 Ga0495618_0510629
751 Ga0495630_0011122
752 Ga0495630_0109105
753 Ga0495630_0248272
754 Ga0495631_0263912
755 Ga0495644_0128463
756 Ga0495666_0349848
757 Ga0495642_0050880
758 Ga0495665_0089328
759 Ga0495640_0082115
760 Ga0495656_0080549
761 Ga0495668_0551809
762 Ga0495634_0138363
763 Ga0495634_0177539
764 Ga0495647_0298955
765 Ga0495658_0086765
766 Ga0495658_0120388
767 Ga0495613_0022068
768 Ga0495613_0030653
769 Ga0495613_0079252
770 Ga0495624_0312491
771 Ga0495604_0133262
772 Ga0495674_0026681
773 Ga0495676_0088126
774 Ga0495676_0563218
775 Ga0495680_0056696
776 Ga0495614_0387447
777 Ga0496100_0012827
778 Ga0496100_0072349
779 Ga0496100_0106829
780 Ga0496101_0017071
781 Ga0496101_0018307
782 Ga0496102_0120253
783 Ga0496102_0491033
784 Ga0496102_0608660
785 Ga0496102_0671779
786 Ga0496103_0011110
787 Ga0496103_0018185
788 Ga0496104_0000977
789 Ga0496104_0001337
790 Ga0496104_0074386
791 Ga0496104_0231297
792 Ga0496104_0693751
793 Ga0496105_0002654
794 Ga0496105_0027308
795 Ga0496105_0115095
796 Ga0496105_0202804
797 Ga0496105_0380004
798 Ga0496106_0016435
799 Ga0496106_0279036
800 Ga0496107_0048574
801 Ga0496107_0147695
802 Ga0496107_0763234
803 Ga0496107_1085568
804 Ga0496108_0000272
805 Ga0496108_0014268
806 Ga0496108_0031484
807 Ga0496109_0000857
808 Ga0496109_0001789
809 Ga0496109_0045880
810 Ga0496109_0063963
811 Ga0496109_0097461
812 Ga0496109_0364583
813 Ga0496109_0529837
814 Ga0496109_0968565
815 Ga0496110_0001545
816 Ga0496110_0019527
817 Ga0496110_0340554
818 Ga0496110_0376153
819 Ga0496110_0773548
820 Ga0496110_1398353
821 Ga0496111_0001182
822 Ga0496111_0031342
823 Ga0496111_0056197
824 Ga0496111_1050659
825 Ga0496112_0026349
826 Ga0496112_0127357
827 Ga0496112_0141705
828 Ga0496112_0173162
829 Ga0496112_0256111
830 Ga0496112_0784342
831 Ga0496112_0880762
832 Ga0496112_1161866
833 Ga0496112_1584591
834 Ga0496113_0000040
835 Ga0496113_0441385
836 Ga0496114_0024418
837 Ga0496114_0032407
838 Ga0496114_0091593
839 Ga0496114_0115593
840 Ga0496114_0145416
841 Ga0496114_0164234
842 Ga0496114_0247219
843 Ga0496114_0738687
844 Ga0496115_0003551
845 Ga0496115_0031760
846 Ga0496115_0049895
847 Ga0496115_0051963
848 Ga0496115_0068958
849 Ga0496115_0252379
850 Ga0496115_0339978
851 Ga0501047_0095622
852 Ga0501067_0073967
853 Ga0501067_0105998
854 Ga0501069_0007108
855 Ga0501070_0042772
856 Ga0501070_0072404
857 Ga0501070_1158577
858 Ga0501074_0006879
859 Ga0501074_0101472
860 Ga0501079_0315558
861 Ga0501080_0064734
862 Ga0501035_0190791
863 nmdc:mga05p37_299511_c1
864 nmdc:mga05p37_40689_c1
865 nmdc:mga08y16_704259_c1
866 nmdc:mga0n895_89177_c1
867 nmdc:mga0rr50_1051023_c1
868 nmdc:mga0a205_117780_c1
869 Ga0495619_0157549
870 Ga0587128_052647
871 Ga0587111_0209304
872 Ga0466962_0001141
873 Ga0466962_0060353
874 Ga0466962_0120528
875 Ga0466962_0748679
876 Ga0530510_1299681

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01220

DHquinase_II

Dehydroquinase class II

6

143

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3n59-assembly2.cif.gz_P type ii dehydroquinase from mycobacterium tuberculosis complexed with 3-dehydroshikimate 0.9758 1 140
4ckx-assembly1.cif.gz_A structure of the mycobacterium tuberculosis type ii dehydroquinase n12s mutant (crystal form 2) 0.9749 1 140
4kiu-assembly2.cif.gz_X design and structural analysis of aromatic inhibitors of type ii dehydroquinate dehydratase from mycobacterium tuberculosis - compound 49d [5-[(3-nitrobenzyl)oxy]benzene-1,3-dicarboxylic acid] 0.9744 2 139
3n8n-assembly1.cif.gz_L crystal structure of 3-dehydroquinate dehydratase from mycobacterium tuberculosis in complex with inhibitor 6 0.9738 1 140
3n8n-assembly2.cif.gz_N crystal structure of 3-dehydroquinate dehydratase from mycobacterium tuberculosis in complex with inhibitor 6 0.9721 1 140
ID Description Score Start End Superfamily
4kiuM00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9537 1 140 3.40.50.9100
1d0iH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9517 2 141 3.40.50.9100
1gqoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9511 1 140 3.40.50.9100
4kiuM00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.94 1 140 3.40.50.9100
1gqoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9383 1 140 3.40.50.9100
ID Description Score Start End GO Terms
AF-A0A3C2DXA6-F1-model_v4 3-dehydroquinate dehydratase (EC 4.2.1.10) 0.9812 25 140 GO:0003855
GO:0009423
GO:0019631
AF-A0A7W1LEV3-F1-model_v4 3-dehydroquinate dehydratase (EC 4.2.1.10) 0.9763 19 140 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A7W0P7A9-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9739 1 144 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-B6BSR7-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9723 2 140 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A484H7X8-F1-model_v4 3-dehydroquinate dehydratase (EC 4.2.1.10) 0.9709 2 140 GO:0003855
GO:0019631

Map