F444020

General Info

Members Datasets Scaffolds Average Seq Length
438 246 876 124

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100237426|Ga0307416_1002374262
Length 145
Sequence MALTAKNLDTGSMVADRVGVADTRATRAVGLLSRSGLEPGEGLWIVPSRGVHTWGMRFTIDVVALDERGVVIDRVSNLKPWRIRLPKPGTAGVLELPAGTLERSGTAVGHRIEFAAAPPVGRGRFETTARPAPAPVANEIEEFRS

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
161 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
162 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
163 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
164 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
165 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
166 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
167 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
177 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
178 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
179 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
180 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
181 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
182 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
183 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
243 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
244 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.9
Nodule 0
Rhizoplane 5.71
Rhizosphere 85.39
Stem 0
Stem Tuber 0
Unclassified 13.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100237426 3300032002 Bacteria 1763
2 Ga0065712_10000759 3300005290 Bacteria 12370
3 Ga0065715_10001031 3300005293 Bacteria 7831
4 Ga0065715_10007509 3300005293 Bacteria 4762
5 Ga0065715_10095903 3300005293 Bacteria 3983
6 Ga0065715_10100979 3300005293 Bacteria 3244
7 Ga0065715_10153334 3300005293 Bacteria 1704
8 Ga0065715_10155274 3300005293 Bacteria 1684
9 Ga0065715_10547604 3300005293 Bacteria 743
10 Ga0070676_10196113 3300005328 Bacteria 1321
11 Ga0070676_10651455 3300005328 Bacteria 764
12 Ga0070683_100009892 3300005329 Bacteria 8173
13 Ga0070690_100114487 3300005330 Bacteria 1803
14 Ga0070670_100012572 3300005331 Bacteria 7247
15 Ga0070670_100030157 3300005331 Bacteria 4670
16 Ga0070670_100083979 3300005331 Bacteria 2736
17 Ga0068869_100248922 3300005334 Bacteria 1419
18 Ga0070666_10051612 3300005335 Bacteria 2770
19 Ga0070666_10272527 3300005335 Bacteria 1201
20 Ga0070682_100225780 3300005337 Bacteria 1336
21 Ga0070682_100508791 3300005337 Unclassified 935
22 Ga0070682_102045466 3300005337 Unclassified 504
23 Ga0068868_100237977 3300005338 Bacteria 1529
24 Ga0070689_100023552 3300005340 Bacteria 4610
25 Ga0070689_100115674 3300005340 Bacteria 2138
26 Ga0070691_10120628 3300005341 Bacteria 1320
27 Ga0070687_100100468 3300005343 Bacteria 1618
28 Ga0070661_100039017 3300005344 Bacteria 3459
29 Ga0070661_100272524 3300005344 Bacteria 1311
30 Ga0070692_10105575 3300005345 Bacteria 1551
31 Ga0070668_101219581 3300005347 Bacteria 682
32 Ga0070669_100010039 3300005353 Bacteria 6730
33 Ga0070675_100953710 3300005354 Bacteria 787
34 Ga0070671_100012161 3300005355 Bacteria 6927
35 Ga0070671_100981394 3300005355 Unclassified 740
36 Ga0070674_100075896 3300005356 Bacteria 2389
37 Ga0070674_100091188 3300005356 Bacteria 2200
38 Ga0070674_101129293 3300005356 Bacteria 693
39 Ga0070673_100005413 3300005364 Bacteria 8167
40 Ga0070673_100466989 3300005364 Bacteria 1137
41 Ga0070688_100358820 3300005365 Unclassified 1069
42 Ga0070659_100055022 3300005366 Bacteria 3135
43 Ga0070659_100060181 3300005366 Bacteria 3000
44 Ga0070659_101124322 3300005366 Bacteria 693
45 Ga0070667_100049870 3300005367 Bacteria 3527
46 Ga0070667_100496451 3300005367 Unclassified 1118
47 Ga0070713_100023937 3300005436 Bacteria 4749
48 Ga0070701_10166276 3300005438 Bacteria 1281
49 Ga0070705_100194490 3300005440 Bacteria 1385
50 Ga0070700_100081591 3300005441 Bacteria 2090
51 Ga0070700_100435665 3300005441 Bacteria 994
52 Ga0070700_101779815 3300005441 Bacteria 530
53 Ga0070694_100050227 3300005444 Bacteria 2811
54 Ga0070694_101836075 3300005444 Unclassified 517
55 Ga0070708_101893587 3300005445 Unclassified 553
56 Ga0070708_101907422 3300005445 Unclassified 551
57 Ga0070663_100551897 3300005455 Bacteria 963
58 Ga0070663_100662173 3300005455 Unclassified 884
59 Ga0070662_100108133 3300005457 Bacteria 2115
60 Ga0070662_100329589 3300005457 Bacteria 1247
61 Ga0070662_100636591 3300005457 Bacteria 899
62 Ga0070662_101533399 3300005457 Bacteria 575
63 Ga0070681_10123235 3300005458 Bacteria 2525
64 Ga0070681_10697443 3300005458 Bacteria 931
65 Ga0070681_10711862 3300005458 Bacteria 920
66 Ga0068867_100005343 3300005459 Bacteria 9074
67 Ga0070685_10063199 3300005466 Bacteria 2173
68 Ga0070706_100390378 3300005467 Bacteria 1296
69 Ga0070706_100863088 3300005467 Bacteria 837
70 Ga0070706_101252675 3300005467 Unclassified 681
71 Ga0070699_100236079 3300005518 Bacteria 1631
72 Ga0070699_100560620 3300005518 Bacteria 1040
73 Ga0070679_100426014 3300005530 Bacteria 1272
74 Ga0070684_100039030 3300005535 Bacteria 4083
75 Ga0070684_100059958 3300005535 Bacteria 3327
76 Ga0068853_101029629 3300005539 Bacteria 793
77 Ga0068853_101832517 3300005539 Bacteria 588
78 Ga0070672_100030719 3300005543 Bacteria 4039
79 Ga0070672_100063227 3300005543 Bacteria 2923
80 Ga0070672_100087024 3300005543 Bacteria 2513
81 Ga0070672_100411096 3300005543 Bacteria 1161
82 Ga0070672_101912410 3300005543 Bacteria 534
83 Ga0070686_100037742 3300005544 Bacteria 2998
84 Ga0070686_100339023 3300005544 Unclassified 1126
85 Ga0070686_100776311 3300005544 Bacteria 770
86 Ga0070695_100130163 3300005545 Bacteria 1734
87 Ga0070696_100014062 3300005546 Bacteria 5374
88 Ga0070693_100050883 3300005547 Bacteria 2370
89 Ga0070665_101711664 3300005548 Bacteria 636
90 Ga0070704_100089356 3300005549 Bacteria 2291
91 Ga0070664_100018870 3300005564 Bacteria 5669
92 Ga0070664_102295693 3300005564 Unclassified 512
93 Ga0068857_100106337 3300005577 Bacteria 2520
94 Ga0068857_101358537 3300005577 Bacteria 690
95 Ga0068854_100383927 3300005578 Unclassified 1158
96 Ga0070702_100199468 3300005615 Bacteria 1323
97 Ga0070702_100351593 3300005615 Bacteria 1038
98 Ga0070702_100557547 3300005615 Bacteria 852
99 Ga0068852_100019869 3300005616 Bacteria 5328
100 Ga0068859_102399706 3300005617 Bacteria 581
101 Ga0068859_102647527 3300005617 Unclassified 551
102 Ga0068864_100170486 3300005618 Bacteria 1984
103 Ga0068864_100717233 3300005618 Bacteria 978
104 Ga0068864_102442343 3300005618 Bacteria 529
105 Ga0068861_100187947 3300005719 Bacteria 1724
106 Ga0068861_100388901 3300005719 Unclassified 1234
107 Ga0068861_101655298 3300005719 Bacteria 632
108 Ga0068851_10110500 3300005834 Bacteria 1467
109 Ga0068863_100046891 3300005841 Bacteria 4101
110 Ga0068858_100057413 3300005842 Bacteria 3597
111 Ga0068858_100292037 3300005842 Bacteria 1554
112 Ga0068860_100167793 3300005843 Bacteria 2120
113 Ga0068862_100027311 3300005844 Bacteria 4804
114 Ga0068862_100516890 3300005844 Bacteria 1136
115 Ga0081455_10050373 3300005937 Bacteria 3582
116 Ga0070717_10568092 3300006028 Bacteria 1028
117 Ga0070717_11477888 3300006028 Unclassified 617
118 Ga0075365_10006570 3300006038 Bacteria 6412
119 Ga0075365_10011444 3300006038 Bacteria 5216
120 Ga0075368_10010318 3300006042 Bacteria 3375
121 Ga0075368_10204699 3300006042 Bacteria 835
122 Ga0075363_100208144 3300006048 Bacteria 1119
123 Ga0075364_10014105 3300006051 Bacteria 4931
124 Ga0075364_10020730 3300006051 Bacteria 4137
125 Ga0075364_10023949 3300006051 Bacteria 3870
126 Ga0075364_10663866 3300006051 Bacteria 712
127 Ga0070715_10437662 3300006163 Bacteria 735
128 Ga0075362_10000473 3300006177 Bacteria 11679
129 Ga0075367_10037472 3300006178 Bacteria 2818
130 Ga0075367_10046142 3300006178 Bacteria 2559
131 Ga0075367_10144766 3300006178 Bacteria 1473
132 Ga0075367_10267891 3300006178 Bacteria 1073
133 Ga0075366_10034147 3300006195 Bacteria 2996
134 Ga0075366_10102588 3300006195 Bacteria 1717
135 Ga0075366_10123490 3300006195 Bacteria 1561
136 Ga0075366_10684647 3300006195 Unclassified 637
137 Ga0097621_100898105 3300006237 Unclassified 825
138 Ga0075370_10001536 3300006353 Bacteria 10094
139 Ga0075428_100015955 3300006844 Bacteria 8312
140 Ga0075428_100376031 3300006844 Bacteria 1523
141 Ga0075428_101366519 3300006844 Unclassified 744
142 Ga0075430_100010033 3300006846 Bacteria 8014
143 Ga0075430_100094111 3300006846 Bacteria 2505
144 Ga0075430_100198189 3300006846 Bacteria 1668
145 Ga0075430_100269396 3300006846 Bacteria 1410
146 Ga0075430_100986611 3300006846 Bacteria 694
147 Ga0075431_100022945 3300006847 Bacteria 6379
148 Ga0075431_100176545 3300006847 Bacteria 2194
149 Ga0075431_100916108 3300006847 Bacteria 846
150 Ga0075433_10243606 3300006852 Unclassified 1596
151 Ga0075434_100338674 3300006871 Unclassified 1525
152 Ga0075434_100764666 3300006871 Unclassified 983
153 Ga0075429_100017456 3300006880 Bacteria 6205
154 Ga0075429_100651327 3300006880 Bacteria 923
155 Ga0068865_100017137 3300006881 Bacteria 4653
156 Ga0068865_100879749 3300006881 Bacteria 778
157 Ga0075436_100270396 3300006914 Bacteria 1214
158 Ga0097620_102400111 3300006931 Bacteria 581
159 Ga0097620_102647493 3300006931 Unclassified 551
160 Ga0075435_100058895 3300007076 Bacteria 3112
161 Ga0075435_101875956 3300007076 Bacteria 526
162 Ga0105240_11138771 3300009093 Unclassified 829
163 Ga0111539_10003266 3300009094 Bacteria 21438
164 Ga0111539_10176463 3300009094 Unclassified 2496
165 Ga0111539_11026215 3300009094 Bacteria 959
166 Ga0111539_12244160 3300009094 Bacteria 633
167 Ga0111539_13135577 3300009094 Bacteria 533
168 Ga0111539_13480770 3300009094 Bacteria 506
169 Ga0105245_10076557 3300009098 Bacteria 3048
170 Ga0114129_10001304 3300009147 Bacteria 33279
171 Ga0114129_10050070 3300009147 Bacteria 5869
172 Ga0114129_10196624 3300009147 Bacteria 2734
173 Ga0114129_10253981 3300009147 Bacteria 2359
174 Ga0105243_10034426 3300009148 Bacteria 3921
175 Ga0105243_10203542 3300009148 Unclassified 1738
176 Ga0105241_10021453 3300009174 Bacteria 4774
177 Ga0105242_10038062 3300009176 Bacteria 3866
178 Ga0105242_12738637 3300009176 Bacteria 543
179 Ga0105248_10027467 3300009177 Bacteria 6336
180 Ga0105248_10068335 3300009177 Bacteria 3989
181 Ga0105248_13261816 3300009177 Unclassified 516
182 Ga0105238_11594449 3300009551 Unclassified 683
183 Ga0105249_10003894 3300009553 Bacteria 12898
184 Ga0105249_10053185 3300009553 Bacteria 3701
185 Ga0105249_10315345 3300009553 Bacteria 1573
186 Ga0105239_10099239 3300010375 Bacteria 3219
187 Ga0105239_12369762 3300010375 Unclassified 618
188 Ga0105246_10390073 3300011119 Bacteria 1153
189 Ga0157378_10458840 3300013297 Bacteria 1266
190 Ga0157375_10856602 3300013308 Unclassified 1055
191 Ga0157375_11209008 3300013308 Unclassified 887
192 Ga0157380_10022266 3300014326 Bacteria 4767
193 Ga0157380_10338919 3300014326 Bacteria 1402
194 Ga0157380_10375807 3300014326 Bacteria 1339
195 Ga0157379_10059935 3300014968 Bacteria 3403
196 Ga0163161_10448191 3300017792 Bacteria 1043
197 Ga0207697_10147046 3300025315 Bacteria 1024
198 Ga0207653_10379251 3300025885 Unclassified 554
199 Ga0207682_10270603 3300025893 Bacteria 793
200 Ga0207642_10209317 3300025899 Bacteria 1082
201 Ga0207680_10047218 3300025903 Bacteria 2550
202 Ga0207680_11132109 3300025903 Unclassified 559
203 Ga0207645_10012548 3300025907 Bacteria 5747
204 Ga0207684_10189347 3300025910 Bacteria 1774
205 Ga0207684_10525752 3300025910 Bacteria 1013
206 Ga0207663_10955551 3300025916 Bacteria 686
207 Ga0207662_10032101 3300025918 Bacteria 3054
208 Ga0207657_10346464 3300025919 Bacteria 1172
209 Ga0207657_10486485 3300025919 Bacteria 967
210 Ga0207649_10062273 3300025920 Bacteria 2351
211 Ga0207652_11327924 3300025921 Bacteria 622
212 Ga0207646_10405685 3300025922 Bacteria 1231
213 Ga0207681_10331835 3300025923 Bacteria 1212
214 Ga0207681_11233614 3300025923 Bacteria 628
215 Ga0207650_10015559 3300025925 Bacteria 5300
216 Ga0207650_10069721 3300025925 Bacteria 2641
217 Ga0207659_10286742 3300025926 Bacteria 1348
218 Ga0207659_10313585 3300025926 Bacteria 1292
219 Ga0207700_10050339 3300025928 Bacteria 3104
220 Ga0207644_10131017 3300025931 Bacteria 1919
221 Ga0207644_10772116 3300025931 Bacteria 803
222 Ga0207690_10072461 3300025932 Bacteria 2379
223 Ga0207690_10156620 3300025932 Bacteria 1694
224 Ga0207690_11265935 3300025932 Bacteria 616
225 Ga0207706_10028642 3300025933 Bacteria 4974
226 Ga0207706_10087034 3300025933 Bacteria 2746
227 Ga0207706_11139089 3300025933 Unclassified 650
228 Ga0207686_10678003 3300025934 Bacteria 818
229 Ga0207709_10195321 3300025935 Bacteria 1441
230 Ga0207709_10303842 3300025935 Unclassified 1188
231 Ga0207709_11566207 3300025935 Unclassified 547
232 Ga0207670_10088168 3300025936 Bacteria 2188
233 Ga0207670_10123091 3300025936 Bacteria 1889
234 Ga0207669_10068142 3300025937 Bacteria 2221
235 Ga0207669_10084865 3300025937 Bacteria 2042
236 Ga0207669_10986286 3300025937 Bacteria 707
237 Ga0207704_10310802 3300025938 Bacteria 1211
238 Ga0207704_10400622 3300025938 Unclassified 1083
239 Ga0207691_10018959 3300025940 Bacteria 6518
240 Ga0207691_10121296 3300025940 Bacteria 2317
241 Ga0207691_10136658 3300025940 Bacteria 2162
242 Ga0207691_10544194 3300025940 Bacteria 985
243 Ga0207711_10008567 3300025941 Bacteria 8555
244 Ga0207711_10062657 3300025941 Bacteria 3208
245 Ga0207661_10021090 3300025944 Bacteria 4880
246 Ga0207661_10141713 3300025944 Bacteria 2069
247 Ga0207679_10083813 3300025945 Bacteria 2445
248 Ga0207679_10277901 3300025945 Bacteria 1435
249 Ga0207679_10332994 3300025945 Bacteria 1318
250 Ga0207651_10006971 3300025960 Bacteria 5980
251 Ga0207651_10437308 3300025960 Bacteria 1120
252 Ga0207651_10440386 3300025960 Bacteria 1116
253 Ga0207712_10032026 3300025961 Bacteria 3546
254 Ga0207712_10306664 3300025961 Bacteria 1305
255 Ga0207640_10042898 3300025981 Bacteria 2887
256 Ga0207640_11125173 3300025981 Bacteria 696
257 Ga0207658_10648757 3300025986 Bacteria 951
258 Ga0207703_10162646 3300026035 Bacteria 1956
259 Ga0207703_10242397 3300026035 Bacteria 1621
260 Ga0207639_10510016 3300026041 Bacteria 1100
261 Ga0207639_10740441 3300026041 Unclassified 914
262 Ga0207639_11584331 3300026041 Bacteria 614
263 Ga0207678_10743655 3300026067 Bacteria 864
264 Ga0207708_10008694 3300026075 Bacteria 7517
265 Ga0207708_10439260 3300026075 Bacteria 1085
266 Ga0207708_10968127 3300026075 Bacteria 738
267 Ga0207641_10019471 3300026088 Bacteria 5573
268 Ga0207648_10000709 3300026089 Bacteria 37371
269 Ga0207648_10271029 3300026089 Bacteria 1516
270 Ga0207676_10153636 3300026095 Bacteria 1985
271 Ga0207676_11006365 3300026095 Bacteria 821
272 Ga0207674_10743720 3300026116 Bacteria 946
273 Ga0207675_100012864 3300026118 Bacteria 7816
274 Ga0207675_100556960 3300026118 Bacteria 1146
275 Ga0207683_10109746 3300026121 Bacteria 2470
276 Ga0209813_10046849 3300027866 Bacteria 1337
277 Ga0209813_10178636 3300027866 Bacteria 775
278 Ga0207428_10129642 3300027907 Bacteria 1931
279 Ga0268266_12248491 3300028379 Bacteria 517
280 Ga0268265_10213502 3300028380 Bacteria 1683
281 Ga0268265_10792731 3300028380 Bacteria 923
282 Ga0268264_11001057 3300028381 Bacteria 842
283 Ga0307408_100032094 3300031548 Bacteria 3662
284 Ga0307408_100445637 3300031548 Bacteria 1122
285 Ga0307405_10049228 3300031731 Bacteria 2604
286 Ga0307413_10160906 3300031824 Bacteria 1577
287 Ga0307410_10463782 3300031852 Bacteria 1036
288 Ga0307406_10023635 3300031901 Bacteria 3660
289 Ga0307407_10636579 3300031903 Bacteria 797
290 Ga0307412_10713030 3300031911 Unclassified 862
291 Ga0307412_10960936 3300031911 Bacteria 752
292 Ga0307409_100046491 3300031995 Bacteria 3286
293 Ga0307416_100160452 3300032002 Bacteria 2077
294 Ga0307416_100389143 3300032002 Bacteria 1427
295 Ga0307416_100954845 3300032002 Bacteria 959
296 Ga0307414_10044174 3300032004 Bacteria 3041
297 Ga0307411_10051758 3300032005 Bacteria 2681
298 Ga0307411_10216448 3300032005 Bacteria 1483
299 Ga0307411_10627186 3300032005 Bacteria 928
300 Ga0307415_100519783 3300032126 Bacteria 1044
301 Ga0373959_0015903 3300034820 Bacteria 1388
302 Ga0373928_0150697 3300035084 Bacteria 644
303 Ga0373949_0012314 3300035090 Bacteria 1891
304 Ga0373951_0082128 3300035091 Unclassified 835
305 Ga0373952_0035890 3300035092 Bacteria 1124
306 Ga0373932_0060048 3300035112 Unclassified 1153
307 Ga0373939_0109465 3300035114 Bacteria 960
308 Ga0373941_0191443 3300035115 Bacteria 773
309 Ga0373946_0230436 3300035171 Bacteria 897
310 Ga0373962_0163136 3300035242 Bacteria 736
311 Ga0373931_0031451 3300035691 Bacteria 2740
312 Ga0373937_1107569 3300036401 Bacteria 740
313 Ga0373925_0004437 3300037068 Bacteria 10602
314 Ga0373925_0718182 3300037068 Bacteria 824
315 Ga0395899_0595566 3300037312 Bacteria 705
316 Ga0395905_0245730 3300037471 Bacteria 1672
317 Ga0395901_0589889 3300038443 Bacteria 1122
318 Ga0439461_0030577 3300041410 Bacteria 1120
319 Ga0451807_1644080 3300041486 Bacteria 1106
320 Ga0439431_0025348 3300041997 Bacteria 1448
321 Ga0439431_0093831 3300041997 Bacteria 820
322 Ga0439442_019244 3300042002 Bacteria 1413
323 Ga0439455_0050570 3300042012 Bacteria 1085
324 Ga0450898_013321 3300042134 Bacteria 1369
325 Ga0439446_0043289 3300042156 Bacteria 1330
326 Ga0495621_0478271 3300046539 Unclassified 536
327 Ga0495658_0263688 3300046683 Bacteria 1085
328 Ga0495669_0352170 3300046684 Unclassified 712
329 Ga0495613_0117230 3300046689 Bacteria 1915
330 Ga0495680_0338088 3300047322 Bacteria 1051
331 Ga0496100_0095381 3300048903 Bacteria 2039
332 Ga0496101_0349898 3300048904 Bacteria 1161
333 Ga0496102_0171573 3300048905 Unclassified 2042
334 Ga0496102_0863683 3300048905 Bacteria 827
335 Ga0496102_0886892 3300048905 Bacteria 814
336 Ga0496104_0002365 3300048907 Bacteria 16293
337 Ga0496104_0397288 3300048907 Unclassified 1291
338 Ga0496105_0044674 3300048908 Bacteria 3655
339 Ga0496106_0051156 3300048909 Bacteria 3115
340 Ga0496106_0901429 3300048909 Unclassified 698
341 Ga0496107_0053882 3300048910 Bacteria 2902
342 Ga0496108_0088006 3300048911 Bacteria 2639
343 Ga0496109_0001246 3300048912 Bacteria 21103
344 Ga0496109_0208565 3300048912 Bacteria 1837
345 Ga0496109_0346085 3300048912 Bacteria 1404
346 Ga0496110_0002416 3300048913 Bacteria 13982
347 Ga0496110_0146121 3300048913 Bacteria 2139
348 Ga0496111_0007202 3300048914 Bacteria 7273
349 Ga0496112_0000287 3300048915 Bacteria 32756
350 Ga0496112_0069036 3300048915 Bacteria 3491
351 Ga0496112_0137813 3300048915 Unclassified 2410
352 Ga0496113_0011533 3300048916 Bacteria 5903
353 Ga0496113_0111106 3300048916 Bacteria 2134
354 Ga0496113_0263213 3300048916 Bacteria 1378
355 Ga0501034_0411993 3300049571 Bacteria 1273
356 Ga0501036_0224126 3300049572 Bacteria 1578
357 Ga0501036_0838192 3300049572 Bacteria 756
358 Ga0501038_0703674 3300049574 Bacteria 757
359 Ga0501040_0126423 3300049576 Bacteria 1796
360 Ga0501041_0407528 3300049577 Bacteria 861
361 Ga0501046_0786889 3300049580 Unclassified 667
362 Ga0501047_0107607 3300049581 Bacteria 2670
363 Ga0501048_0723726 3300049582 Bacteria 715
364 Ga0501067_0194627 3300049583 Bacteria 1129
365 Ga0501068_0169100 3300049584 Bacteria 1379
366 Ga0501068_0445923 3300049584 Unclassified 837
367 Ga0501069_0052029 3300049585 Bacteria 2280
368 Ga0501071_0012747 3300049587 Bacteria 5715
369 Ga0501071_0100031 3300049587 Bacteria 2137
370 Ga0501071_0253231 3300049587 Bacteria 1329
371 Ga0501072_0093520 3300049588 Bacteria 2388
372 Ga0501074_0377173 3300049590 Bacteria 1006
373 Ga0501074_0941708 3300049590 Bacteria 608
374 Ga0501075_0024456 3300049591 Bacteria 4430
375 Ga0501076_0014348 3300049592 Bacteria 5967
376 Ga0501077_0795881 3300049593 Unclassified 608
377 Ga0501077_1080682 3300049593 Bacteria 516
378 Ga0501233_210117 3300049668 Unclassified 570
379 Ga0501079_0214432 3300049741 Bacteria 1504
380 Ga0501079_0368430 3300049741 Bacteria 1126
381 Ga0501079_0525048 3300049741 Unclassified 931
382 Ga0501079_1359527 3300049741 Bacteria 559
383 Ga0501080_0687111 3300049742 Bacteria 903
384 Ga0501080_1155990 3300049742 Bacteria 667
385 Ga0501081_0269357 3300049743 Bacteria 1245
386 Ga0501045_0386861 3300049824 Bacteria 1041
387 Ga0501045_1181979 3300049824 Bacteria 558
388 nmdc:mga03683_367_c1 3300050489 Bacteria 13025
389 nmdc:mga03n38_913673_c1 3300050490 Bacteria 516
390 nmdc:mga00v17_165953_c1 3300050491 Bacteria 1423
391 nmdc:mga00v17_16835_c1 3300050491 Bacteria 4127
392 nmdc:mga00v17_32981_c1 3300050491 Bacteria 3065
393 nmdc:mga00v17_510077_c1 3300050491 Bacteria 779
394 nmdc:mga0yw44_259468_c1 3300050492 Bacteria 1158
395 nmdc:mga0yw44_35364_c1 3300050492 Bacteria 2935
396 nmdc:mga0yw44_37053_c1 3300050492 Bacteria 2878
397 nmdc:mga0k408_3204_c1 3300050493 Bacteria 8665
398 nmdc:mga0k408_59503_c1 3300050493 Bacteria 2220
399 nmdc:mga0k408_62258_c1 3300050493 Bacteria 2169
400 nmdc:mga06z11_308382_c1 3300050494 Bacteria 942
401 nmdc:mga06z11_31053_c1 3300050494 Bacteria 2592
402 nmdc:mga06z11_5106_c1 3300050494 Bacteria 5233
403 nmdc:mga04h51_1638_c1 3300050495 Bacteria 5224
404 nmdc:mga04h51_40236_c1 3300050495 Bacteria 1522
405 nmdc:mga07m45_3284_c1 3300050496 Bacteria 7780
406 nmdc:mga05p37_209173_c1 3300050507 Bacteria 2359
407 nmdc:mga05p37_29948_c1 3300050507 Bacteria 6643
408 nmdc:mga09592_159341_c1 3300050508 Bacteria 1949
409 nmdc:mga0qj67_1142445_c1 3300050509 Bacteria 607
410 nmdc:mga0qj67_126446_c1 3300050509 Bacteria 2069
411 nmdc:mga0qj67_180113_c1 3300050509 Bacteria 1716
412 nmdc:mga0qj67_296164_c1 3300050509 Bacteria 1311
413 nmdc:mga0qj67_670209_c1 3300050509 Unclassified 827
414 nmdc:mga06r32_245105_c1 3300050510 Bacteria 1368
415 nmdc:mga06r32_28239_c1 3300050510 Bacteria 5246
416 nmdc:mga06r32_980458_c1 3300050510 Unclassified 799
417 nmdc:mga08y16_1103394_c1 3300050511 Bacteria 768
418 nmdc:mga08y16_122900_c1 3300050511 Bacteria 2701
419 nmdc:mga08y16_24508_c1 3300050511 Bacteria 6367
420 nmdc:mga08y16_582141_c1 3300050511 Bacteria 1130
421 nmdc:mga0n895_445229_c1 3300050512 Unclassified 1308
422 nmdc:mga0n895_825743_c1 3300050512 Bacteria 916
423 nmdc:mga0rr50_17815_c1 3300050513 Bacteria 4755
424 nmdc:mga08x19_111608_c1 3300050514 Bacteria 1824
425 nmdc:mga0a205_56081_c1 3300050515 Bacteria 3805
426 Ga0495619_0127847 3300053085 Bacteria 1745
427 Ga0501084_0070132 3300054114 Bacteria 2935
428 Ga0501084_0109220 3300054114 Unclassified 2324
429 Ga0501084_1715989 3300054114 Unclassified 525
430 Ga0590071_000149 3300059421 Bacteria 20050
431 Ga0590071_061754 3300059421 Bacteria 917
432 Ga0590075_027155 3300059424 Bacteria 1443
433 Ga0590077_000260 3300059426 Bacteria 15106
434 Ga0590077_036583 3300059426 Unclassified 1083
435 Ga0501082_0492504 3300060353 Unclassified 1071
436 Ga0530510_0221395 3300061734 Bacteria 1407
437 Ga0530510_0828860 3300061734 Bacteria 706
438 Ga0530510_1065039 3300061734 Bacteria 619
439 Ga0307416_100237426
440 Ga0065712_10000759
441 Ga0065715_10001031
442 Ga0065715_10007509
443 Ga0065715_10095903
444 Ga0065715_10100979
445 Ga0065715_10153334
446 Ga0065715_10155274
447 Ga0065715_10547604
448 Ga0070676_10196113
449 Ga0070676_10651455
450 Ga0070683_100009892
451 Ga0070690_100114487
452 Ga0070670_100012572
453 Ga0070670_100030157
454 Ga0070670_100083979
455 Ga0068869_100248922
456 Ga0070666_10051612
457 Ga0070666_10272527
458 Ga0070682_100225780
459 Ga0070682_100508791
460 Ga0070682_102045466
461 Ga0068868_100237977
462 Ga0070689_100023552
463 Ga0070689_100115674
464 Ga0070691_10120628
465 Ga0070687_100100468
466 Ga0070661_100039017
467 Ga0070661_100272524
468 Ga0070692_10105575
469 Ga0070668_101219581
470 Ga0070669_100010039
471 Ga0070675_100953710
472 Ga0070671_100012161
473 Ga0070671_100981394
474 Ga0070674_100075896
475 Ga0070674_100091188
476 Ga0070674_101129293
477 Ga0070673_100005413
478 Ga0070673_100466989
479 Ga0070688_100358820
480 Ga0070659_100055022
481 Ga0070659_100060181
482 Ga0070659_101124322
483 Ga0070667_100049870
484 Ga0070667_100496451
485 Ga0070713_100023937
486 Ga0070701_10166276
487 Ga0070705_100194490
488 Ga0070700_100081591
489 Ga0070700_100435665
490 Ga0070700_101779815
491 Ga0070694_100050227
492 Ga0070694_101836075
493 Ga0070708_101893587
494 Ga0070708_101907422
495 Ga0070663_100551897
496 Ga0070663_100662173
497 Ga0070662_100108133
498 Ga0070662_100329589
499 Ga0070662_100636591
500 Ga0070662_101533399
501 Ga0070681_10123235
502 Ga0070681_10697443
503 Ga0070681_10711862
504 Ga0068867_100005343
505 Ga0070685_10063199
506 Ga0070706_100390378
507 Ga0070706_100863088
508 Ga0070706_101252675
509 Ga0070699_100236079
510 Ga0070699_100560620
511 Ga0070679_100426014
512 Ga0070684_100039030
513 Ga0070684_100059958
514 Ga0068853_101029629
515 Ga0068853_101832517
516 Ga0070672_100030719
517 Ga0070672_100063227
518 Ga0070672_100087024
519 Ga0070672_100411096
520 Ga0070672_101912410
521 Ga0070686_100037742
522 Ga0070686_100339023
523 Ga0070686_100776311
524 Ga0070695_100130163
525 Ga0070696_100014062
526 Ga0070693_100050883
527 Ga0070665_101711664
528 Ga0070704_100089356
529 Ga0070664_100018870
530 Ga0070664_102295693
531 Ga0068857_100106337
532 Ga0068857_101358537
533 Ga0068854_100383927
534 Ga0070702_100199468
535 Ga0070702_100351593
536 Ga0070702_100557547
537 Ga0068852_100019869
538 Ga0068859_102399706
539 Ga0068859_102647527
540 Ga0068864_100170486
541 Ga0068864_100717233
542 Ga0068864_102442343
543 Ga0068861_100187947
544 Ga0068861_100388901
545 Ga0068861_101655298
546 Ga0068851_10110500
547 Ga0068863_100046891
548 Ga0068858_100057413
549 Ga0068858_100292037
550 Ga0068860_100167793
551 Ga0068862_100027311
552 Ga0068862_100516890
553 Ga0081455_10050373
554 Ga0070717_10568092
555 Ga0070717_11477888
556 Ga0075365_10006570
557 Ga0075365_10011444
558 Ga0075368_10010318
559 Ga0075368_10204699
560 Ga0075363_100208144
561 Ga0075364_10014105
562 Ga0075364_10020730
563 Ga0075364_10023949
564 Ga0075364_10663866
565 Ga0070715_10437662
566 Ga0075362_10000473
567 Ga0075367_10037472
568 Ga0075367_10046142
569 Ga0075367_10144766
570 Ga0075367_10267891
571 Ga0075366_10034147
572 Ga0075366_10102588
573 Ga0075366_10123490
574 Ga0075366_10684647
575 Ga0097621_100898105
576 Ga0075370_10001536
577 Ga0075428_100015955
578 Ga0075428_100376031
579 Ga0075428_101366519
580 Ga0075430_100010033
581 Ga0075430_100094111
582 Ga0075430_100198189
583 Ga0075430_100269396
584 Ga0075430_100986611
585 Ga0075431_100022945
586 Ga0075431_100176545
587 Ga0075431_100916108
588 Ga0075433_10243606
589 Ga0075434_100338674
590 Ga0075434_100764666
591 Ga0075429_100017456
592 Ga0075429_100651327
593 Ga0068865_100017137
594 Ga0068865_100879749
595 Ga0075436_100270396
596 Ga0097620_102400111
597 Ga0097620_102647493
598 Ga0075435_100058895
599 Ga0075435_101875956
600 Ga0105240_11138771
601 Ga0111539_10003266
602 Ga0111539_10176463
603 Ga0111539_11026215
604 Ga0111539_12244160
605 Ga0111539_13135577
606 Ga0111539_13480770
607 Ga0105245_10076557
608 Ga0114129_10001304
609 Ga0114129_10050070
610 Ga0114129_10196624
611 Ga0114129_10253981
612 Ga0105243_10034426
613 Ga0105243_10203542
614 Ga0105241_10021453
615 Ga0105242_10038062
616 Ga0105242_12738637
617 Ga0105248_10027467
618 Ga0105248_10068335
619 Ga0105248_13261816
620 Ga0105238_11594449
621 Ga0105249_10003894
622 Ga0105249_10053185
623 Ga0105249_10315345
624 Ga0105239_10099239
625 Ga0105239_12369762
626 Ga0105246_10390073
627 Ga0157378_10458840
628 Ga0157375_10856602
629 Ga0157375_11209008
630 Ga0157380_10022266
631 Ga0157380_10338919
632 Ga0157380_10375807
633 Ga0157379_10059935
634 Ga0163161_10448191
635 Ga0207697_10147046
636 Ga0207653_10379251
637 Ga0207682_10270603
638 Ga0207642_10209317
639 Ga0207680_10047218
640 Ga0207680_11132109
641 Ga0207645_10012548
642 Ga0207684_10189347
643 Ga0207684_10525752
644 Ga0207663_10955551
645 Ga0207662_10032101
646 Ga0207657_10346464
647 Ga0207657_10486485
648 Ga0207649_10062273
649 Ga0207652_11327924
650 Ga0207646_10405685
651 Ga0207681_10331835
652 Ga0207681_11233614
653 Ga0207650_10015559
654 Ga0207650_10069721
655 Ga0207659_10286742
656 Ga0207659_10313585
657 Ga0207700_10050339
658 Ga0207644_10131017
659 Ga0207644_10772116
660 Ga0207690_10072461
661 Ga0207690_10156620
662 Ga0207690_11265935
663 Ga0207706_10028642
664 Ga0207706_10087034
665 Ga0207706_11139089
666 Ga0207686_10678003
667 Ga0207709_10195321
668 Ga0207709_10303842
669 Ga0207709_11566207
670 Ga0207670_10088168
671 Ga0207670_10123091
672 Ga0207669_10068142
673 Ga0207669_10084865
674 Ga0207669_10986286
675 Ga0207704_10310802
676 Ga0207704_10400622
677 Ga0207691_10018959
678 Ga0207691_10121296
679 Ga0207691_10136658
680 Ga0207691_10544194
681 Ga0207711_10008567
682 Ga0207711_10062657
683 Ga0207661_10021090
684 Ga0207661_10141713
685 Ga0207679_10083813
686 Ga0207679_10277901
687 Ga0207679_10332994
688 Ga0207651_10006971
689 Ga0207651_10437308
690 Ga0207651_10440386
691 Ga0207712_10032026
692 Ga0207712_10306664
693 Ga0207640_10042898
694 Ga0207640_11125173
695 Ga0207658_10648757
696 Ga0207703_10162646
697 Ga0207703_10242397
698 Ga0207639_10510016
699 Ga0207639_10740441
700 Ga0207639_11584331
701 Ga0207678_10743655
702 Ga0207708_10008694
703 Ga0207708_10439260
704 Ga0207708_10968127
705 Ga0207641_10019471
706 Ga0207648_10000709
707 Ga0207648_10271029
708 Ga0207676_10153636
709 Ga0207676_11006365
710 Ga0207674_10743720
711 Ga0207675_100012864
712 Ga0207675_100556960
713 Ga0207683_10109746
714 Ga0209813_10046849
715 Ga0209813_10178636
716 Ga0207428_10129642
717 Ga0268266_12248491
718 Ga0268265_10213502
719 Ga0268265_10792731
720 Ga0268264_11001057
721 Ga0307408_100032094
722 Ga0307408_100445637
723 Ga0307405_10049228
724 Ga0307413_10160906
725 Ga0307410_10463782
726 Ga0307406_10023635
727 Ga0307407_10636579
728 Ga0307412_10713030
729 Ga0307412_10960936
730 Ga0307409_100046491
731 Ga0307416_100160452
732 Ga0307416_100389143
733 Ga0307416_100954845
734 Ga0307414_10044174
735 Ga0307411_10051758
736 Ga0307411_10216448
737 Ga0307411_10627186
738 Ga0307415_100519783
739 Ga0373959_0015903
740 Ga0373928_0150697
741 Ga0373949_0012314
742 Ga0373951_0082128
743 Ga0373952_0035890
744 Ga0373932_0060048
745 Ga0373939_0109465
746 Ga0373941_0191443
747 Ga0373946_0230436
748 Ga0373962_0163136
749 Ga0373931_0031451
750 Ga0373937_1107569
751 Ga0373925_0004437
752 Ga0373925_0718182
753 Ga0395899_0595566
754 Ga0395905_0245730
755 Ga0395901_0589889
756 Ga0439461_0030577
757 Ga0451807_1644080
758 Ga0439431_0025348
759 Ga0439431_0093831
760 Ga0439442_019244
761 Ga0439455_0050570
762 Ga0450898_013321
763 Ga0439446_0043289
764 Ga0495621_0478271
765 Ga0495658_0263688
766 Ga0495669_0352170
767 Ga0495613_0117230
768 Ga0495680_0338088
769 Ga0496100_0095381
770 Ga0496101_0349898
771 Ga0496102_0171573
772 Ga0496102_0863683
773 Ga0496102_0886892
774 Ga0496104_0002365
775 Ga0496104_0397288
776 Ga0496105_0044674
777 Ga0496106_0051156
778 Ga0496106_0901429
779 Ga0496107_0053882
780 Ga0496108_0088006
781 Ga0496109_0001246
782 Ga0496109_0208565
783 Ga0496109_0346085
784 Ga0496110_0002416
785 Ga0496110_0146121
786 Ga0496111_0007202
787 Ga0496112_0000287
788 Ga0496112_0069036
789 Ga0496112_0137813
790 Ga0496113_0011533
791 Ga0496113_0111106
792 Ga0496113_0263213
793 Ga0501034_0411993
794 Ga0501036_0224126
795 Ga0501036_0838192
796 Ga0501038_0703674
797 Ga0501040_0126423
798 Ga0501041_0407528
799 Ga0501046_0786889
800 Ga0501047_0107607
801 Ga0501048_0723726
802 Ga0501067_0194627
803 Ga0501068_0169100
804 Ga0501068_0445923
805 Ga0501069_0052029
806 Ga0501071_0012747
807 Ga0501071_0100031
808 Ga0501071_0253231
809 Ga0501072_0093520
810 Ga0501074_0377173
811 Ga0501074_0941708
812 Ga0501075_0024456
813 Ga0501076_0014348
814 Ga0501077_0795881
815 Ga0501077_1080682
816 Ga0501233_210117
817 Ga0501079_0214432
818 Ga0501079_0368430
819 Ga0501079_0525048
820 Ga0501079_1359527
821 Ga0501080_0687111
822 Ga0501080_1155990
823 Ga0501081_0269357
824 Ga0501045_0386861
825 Ga0501045_1181979
826 nmdc:mga03683_367_c1
827 nmdc:mga03n38_913673_c1
828 nmdc:mga00v17_165953_c1
829 nmdc:mga00v17_16835_c1
830 nmdc:mga00v17_32981_c1
831 nmdc:mga00v17_510077_c1
832 nmdc:mga0yw44_259468_c1
833 nmdc:mga0yw44_35364_c1
834 nmdc:mga0yw44_37053_c1
835 nmdc:mga0k408_3204_c1
836 nmdc:mga0k408_59503_c1
837 nmdc:mga0k408_62258_c1
838 nmdc:mga06z11_308382_c1
839 nmdc:mga06z11_31053_c1
840 nmdc:mga06z11_5106_c1
841 nmdc:mga04h51_1638_c1
842 nmdc:mga04h51_40236_c1
843 nmdc:mga07m45_3284_c1
844 nmdc:mga05p37_209173_c1
845 nmdc:mga05p37_29948_c1
846 nmdc:mga09592_159341_c1
847 nmdc:mga0qj67_1142445_c1
848 nmdc:mga0qj67_126446_c1
849 nmdc:mga0qj67_180113_c1
850 nmdc:mga0qj67_296164_c1
851 nmdc:mga0qj67_670209_c1
852 nmdc:mga06r32_245105_c1
853 nmdc:mga06r32_28239_c1
854 nmdc:mga06r32_980458_c1
855 nmdc:mga08y16_1103394_c1
856 nmdc:mga08y16_122900_c1
857 nmdc:mga08y16_24508_c1
858 nmdc:mga08y16_582141_c1
859 nmdc:mga0n895_445229_c1
860 nmdc:mga0n895_825743_c1
861 nmdc:mga0rr50_17815_c1
862 nmdc:mga08x19_111608_c1
863 nmdc:mga0a205_56081_c1
864 Ga0495619_0127847
865 Ga0501084_0070132
866 Ga0501084_0109220
867 Ga0501084_1715989
868 Ga0590071_000149
869 Ga0590071_061754
870 Ga0590075_027155
871 Ga0590077_000260
872 Ga0590077_036583
873 Ga0501082_0492504
874 Ga0530510_0221395
875 Ga0530510_0828860
876 Ga0530510_1065039

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02643

DUF192

Uncharacterized ACR, COG1430

17

114

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m7a-assembly2.cif.gz_B crystal structure of saro_0823 (yp_496102.1) a protein of unknown function from novosphingobium aromaticivorans dsm 12444 at 1.22 a resolution 0.8262 4 114
3pjy-assembly1.cif.gz_A crystal structure of a putative transcription regulator (r01717) from sinorhizobium meliloti 1021 at 1.55 a resolution 0.8135 2 115
3pjy-assembly1.cif.gz_A crystal structure of a putative transcription regulator (r01717) from sinorhizobium meliloti 1021 at 1.55 a resolution 0.7488 2 115
3m7a-assembly2.cif.gz_B crystal structure of saro_0823 (yp_496102.1) a protein of unknown function from novosphingobium aromaticivorans dsm 12444 at 1.22 a resolution 0.743 4 114
5h3k-assembly1.cif.gz_A crystal structure of a hypothetical protein from synechocystis 0.6286 2 117
ID Description Score Start End Superfamily
3m7aB01 Mainly Beta;Sandwich;Jelly Rolls;Protein of unknown function DUF192 0.812 4 114 2.60.120.1140
af_Q58891_1_113_2.60.120.1140 Mainly Beta;Sandwich;Jelly Rolls;Protein of unknown function DUF192 0.7854 5 116 2.60.120.1140
af_Q58891_1_113_2.60.120.1140 Mainly Beta;Sandwich;Jelly Rolls;Protein of unknown function DUF192 0.7359 5 116 2.60.120.1140
3m7aB01 Mainly Beta;Sandwich;Jelly Rolls;Protein of unknown function DUF192 0.7239 4 114 2.60.120.1140
3pjyA00 Mainly Beta;Sandwich;Jelly Rolls;Protein of unknown function DUF192 0.7017 2 115 2.60.120.1140
ID Description Score Start End GO Terms
AF-A0A7C8AY13-F1-model_v4 deleted 0.9787 44 116
AF-A0A3M1WGP8-F1-model_v4 DUF192 domain-containing protein 0.9747 34 110
AF-A0A7C3NIF3-F1-model_v4 DUF192 domain-containing protein 0.9733 3 116
AF-A0A6M0Q3S4-F1-model_v4 DUF192 domain-containing protein 0.9722 35 116
AF-A0A651H752-F1-model_v4 DUF192 domain-containing protein 0.9715 37 110

Map