F443927
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 438 | 226 | 438 | 102 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100217573|Ga0070680_1002175734 |
| Length | 107 |
| Sequence | MRDFMKILQQAQEMQGKFQKIQDDLQNITVTGTAGGGMVTAEVSGTGQIRRMKIDPSVINSADPEMLEDLIVVALADAQKKAQEQAQAEMGKLTGGMNLPFKIPGLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 45 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 46 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 47 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 48 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 77 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 78 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 116 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 117 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 118 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 119 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 120 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 121 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 122 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 123 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 124 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 125 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 126 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 127 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 128 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 129 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 130 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 131 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 132 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 133 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 134 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 135 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 136 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 137 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 138 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 139 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 140 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 141 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 143 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 144 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 145 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 146 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 147 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 148 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 149 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 150 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 197 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 210 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 211 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 213 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 214 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 215 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 225 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 226 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.32 |
| Metatranscriptomes | 0.68 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.46 |
| Rhizosphere | 99.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10002218 | 3300005327 | Bacteria | 16306 |
| 2 | Ga0070658_10012680 | 3300005327 | Bacteria | 6761 |
| 3 | Ga0070658_10765452 | 3300005327 | Bacteria | 839 |
| 4 | Ga0070658_12000743 | 3300005327 | Unclassified | 500 |
| 5 | Ga0070683_100027942 | 3300005329 | Bacteria | 5093 |
| 6 | Ga0070683_100037675 | 3300005329 | Bacteria | 4427 |
| 7 | Ga0070683_100038843 | 3300005329 | Bacteria | 4366 |
| 8 | Ga0070683_100943513 | 3300005329 | Bacteria | 828 |
| 9 | Ga0070683_102333605 | 3300005329 | Bacteria | 513 |
| 10 | Ga0070670_100128350 | 3300005331 | Unclassified | 2188 |
| 11 | Ga0068869_100549192 | 3300005334 | Unclassified | 970 |
| 12 | Ga0070680_100000489 | 3300005336 | Bacteria | 27191 |
| 13 | Ga0070680_100217573 | 3300005336 | Bacteria | 1612 |
| 14 | Ga0070680_100226430 | 3300005336 | Bacteria | 1579 |
| 15 | Ga0070680_100450956 | 3300005336 | Bacteria | 1099 |
| 16 | Ga0070680_101322738 | 3300005336 | Unclassified | 624 |
| 17 | Ga0070682_101328397 | 3300005337 | Unclassified | 612 |
| 18 | Ga0070682_101710418 | 3300005337 | Bacteria | 547 |
| 19 | Ga0070660_100009663 | 3300005339 | Bacteria | 6794 |
| 20 | Ga0070661_100056125 | 3300005344 | Bacteria | 2885 |
| 21 | Ga0070692_10140142 | 3300005345 | Bacteria | 1368 |
| 22 | Ga0070692_10410647 | 3300005345 | Bacteria | 857 |
| 23 | Ga0070669_100614908 | 3300005353 | Unclassified | 911 |
| 24 | Ga0070675_100244444 | 3300005354 | Unclassified | 1569 |
| 25 | Ga0070675_100918423 | 3300005354 | Bacteria | 803 |
| 26 | Ga0070671_101012607 | 3300005355 | Unclassified | 728 |
| 27 | Ga0070673_100635063 | 3300005364 | Unclassified | 976 |
| 28 | Ga0070688_100166103 | 3300005365 | Unclassified | 1519 |
| 29 | Ga0070659_100095000 | 3300005366 | Bacteria | 2394 |
| 30 | Ga0070659_100911120 | 3300005366 | Bacteria | 769 |
| 31 | Ga0070667_100403864 | 3300005367 | Unclassified | 1244 |
| 32 | Ga0070709_10017799 | 3300005434 | Bacteria | 4083 |
| 33 | Ga0070709_10018231 | 3300005434 | Bacteria | 4039 |
| 34 | Ga0070709_10058024 | 3300005434 | Bacteria | 2454 |
| 35 | Ga0070714_100068125 | 3300005435 | Bacteria | 3070 |
| 36 | Ga0070714_100075709 | 3300005435 | Bacteria | 2920 |
| 37 | Ga0070714_100094285 | 3300005435 | Bacteria | 2627 |
| 38 | Ga0070714_100125045 | 3300005435 | Bacteria | 2292 |
| 39 | Ga0070713_100004812 | 3300005436 | Bacteria | 9146 |
| 40 | Ga0070713_100040990 | 3300005436 | Bacteria | 3769 |
| 41 | Ga0070713_100116868 | 3300005436 | Bacteria | 2333 |
| 42 | Ga0070713_100244989 | 3300005436 | Bacteria | 1633 |
| 43 | Ga0070713_100253136 | 3300005436 | Bacteria | 1607 |
| 44 | Ga0070710_10172595 | 3300005437 | Bacteria | 1348 |
| 45 | Ga0070711_100022216 | 3300005439 | Bacteria | 4110 |
| 46 | Ga0070711_100392493 | 3300005439 | Unclassified | 1124 |
| 47 | Ga0070681_10016753 | 3300005458 | Bacteria | 7317 |
| 48 | Ga0070681_10053415 | 3300005458 | Bacteria | 4026 |
| 49 | Ga0070681_10205983 | 3300005458 | Bacteria | 1884 |
| 50 | Ga0068867_101015849 | 3300005459 | Bacteria | 753 |
| 51 | Ga0070706_100199070 | 3300005467 | Unclassified | 1871 |
| 52 | Ga0070707_100720004 | 3300005468 | Unclassified | 961 |
| 53 | Ga0070707_100844529 | 3300005468 | Unclassified | 880 |
| 54 | Ga0070707_101101819 | 3300005468 | Bacteria | 760 |
| 55 | Ga0070698_100001204 | 3300005471 | Bacteria | 28711 |
| 56 | Ga0070698_100733441 | 3300005471 | Unclassified | 931 |
| 57 | Ga0070698_101040125 | 3300005471 | Bacteria | 766 |
| 58 | Ga0070679_100041068 | 3300005530 | Bacteria | 4605 |
| 59 | Ga0070679_100059112 | 3300005530 | Bacteria | 3821 |
| 60 | Ga0070679_100120075 | 3300005530 | Bacteria | 2613 |
| 61 | Ga0070679_100337244 | 3300005530 | Bacteria | 1456 |
| 62 | Ga0070679_100346332 | 3300005530 | Bacteria | 1434 |
| 63 | Ga0070679_102111277 | 3300005530 | Bacteria | 513 |
| 64 | Ga0070684_100029967 | 3300005535 | Bacteria | 4618 |
| 65 | Ga0070684_100083786 | 3300005535 | Bacteria | 2826 |
| 66 | Ga0068853_100736612 | 3300005539 | Bacteria | 942 |
| 67 | Ga0070695_100209891 | 3300005545 | Bacteria | 1397 |
| 68 | Ga0070696_100525364 | 3300005546 | Bacteria | 945 |
| 69 | Ga0070693_100019501 | 3300005547 | Bacteria | 3556 |
| 70 | Ga0070693_100667587 | 3300005547 | Unclassified | 758 |
| 71 | Ga0068855_100029666 | 3300005563 | Bacteria | 6539 |
| 72 | Ga0068855_101143712 | 3300005563 | Unclassified | 812 |
| 73 | Ga0068857_100650120 | 3300005577 | Bacteria | 999 |
| 74 | Ga0068857_102522236 | 3300005577 | Unclassified | 505 |
| 75 | Ga0068856_100304764 | 3300005614 | Bacteria | 1611 |
| 76 | Ga0068856_100386061 | 3300005614 | Unclassified | 1420 |
| 77 | Ga0068859_100015924 | 3300005617 | Bacteria | 7557 |
| 78 | Ga0068864_100248435 | 3300005618 | Bacteria | 1651 |
| 79 | Ga0068861_100376921 | 3300005719 | Bacteria | 1252 |
| 80 | Ga0068862_100063271 | 3300005844 | Bacteria | 3184 |
| 81 | Ga0068862_100959299 | 3300005844 | Bacteria | 844 |
| 82 | Ga0070717_10006900 | 3300006028 | Bacteria | 8386 |
| 83 | Ga0070717_10169639 | 3300006028 | Bacteria | 1897 |
| 84 | Ga0070715_10159425 | 3300006163 | Unclassified | 1114 |
| 85 | Ga0070716_100197370 | 3300006173 | Bacteria | 1335 |
| 86 | Ga0070716_100254868 | 3300006173 | Unclassified | 1197 |
| 87 | Ga0070712_100037643 | 3300006175 | Bacteria | 3300 |
| 88 | Ga0070712_100078935 | 3300006175 | Bacteria | 2378 |
| 89 | Ga0070712_100086933 | 3300006175 | Bacteria | 2279 |
| 90 | Ga0075430_100000259 | 3300006846 | Bacteria | 37106 |
| 91 | Ga0075430_100086380 | 3300006846 | Bacteria | 2626 |
| 92 | Ga0075430_100114678 | 3300006846 | Bacteria | 2245 |
| 93 | Ga0075431_100378472 | 3300006847 | Bacteria | 1420 |
| 94 | Ga0075431_101155398 | 3300006847 | Bacteria | 738 |
| 95 | Ga0075433_10351788 | 3300006852 | Unclassified | 1302 |
| 96 | Ga0075434_102001026 | 3300006871 | Unclassified | 585 |
| 97 | Ga0075429_100211085 | 3300006880 | Bacteria | 1701 |
| 98 | Ga0075429_101582524 | 3300006880 | Unclassified | 570 |
| 99 | Ga0068865_100410761 | 3300006881 | Bacteria | 1111 |
| 100 | Ga0097620_100015924 | 3300006931 | Bacteria | 7557 |
| 101 | Ga0075435_100206650 | 3300007076 | Bacteria | 1665 |
| 102 | Ga0075435_100652822 | 3300007076 | Bacteria | 913 |
| 103 | Ga0105240_10533847 | 3300009093 | Bacteria | 1300 |
| 104 | Ga0105240_11176844 | 3300009093 | Unclassified | 813 |
| 105 | Ga0105240_12482760 | 3300009093 | Bacteria | 536 |
| 106 | Ga0111539_10038811 | 3300009094 | Bacteria | 5744 |
| 107 | Ga0105245_10063178 | 3300009098 | Bacteria | 3343 |
| 108 | Ga0114129_10120865 | 3300009147 | Bacteria | 3606 |
| 109 | Ga0114129_10733797 | 3300009147 | Bacteria | 1266 |
| 110 | Ga0105243_10315093 | 3300009148 | Unclassified | 1423 |
| 111 | Ga0105242_10002665 | 3300009176 | Bacteria | 13989 |
| 112 | Ga0105248_11038613 | 3300009177 | Unclassified | 926 |
| 113 | Ga0105248_11583189 | 3300009177 | Unclassified | 742 |
| 114 | Ga0105237_10216182 | 3300009545 | Bacteria | 1917 |
| 115 | Ga0105237_10495389 | 3300009545 | Unclassified | 1228 |
| 116 | Ga0105238_10529453 | 3300009551 | Bacteria | 1181 |
| 117 | Ga0105238_10697574 | 3300009551 | Unclassified | 1027 |
| 118 | Ga0105238_11816209 | 3300009551 | Bacteria | 642 |
| 119 | Ga0105249_10418351 | 3300009553 | Unclassified | 1373 |
| 120 | Ga0105249_11513758 | 3300009553 | Archaea | 743 |
| 121 | Ga0157373_10412887 | 3300013100 | Bacteria | 968 |
| 122 | Ga0157373_10481818 | 3300013100 | Bacteria | 895 |
| 123 | Ga0157373_10621453 | 3300013100 | Bacteria | 787 |
| 124 | Ga0157371_10676613 | 3300013102 | Bacteria | 771 |
| 125 | Ga0157370_10000605 | 3300013104 | Bacteria | 44752 |
| 126 | Ga0157370_10012699 | 3300013104 | Bacteria | 8716 |
| 127 | Ga0157370_10890130 | 3300013104 | Bacteria | 808 |
| 128 | Ga0157369_10019497 | 3300013105 | Bacteria | 7590 |
| 129 | Ga0157369_10140190 | 3300013105 | Bacteria | 2559 |
| 130 | Ga0157369_10811233 | 3300013105 | Unclassified | 961 |
| 131 | Ga0157369_10863337 | 3300013105 | Bacteria | 929 |
| 132 | Ga0157374_12353994 | 3300013296 | Bacteria | 560 |
| 133 | Ga0157378_10159840 | 3300013297 | Bacteria | 2106 |
| 134 | Ga0157372_10018865 | 3300013307 | Bacteria | 7422 |
| 135 | Ga0157372_10029467 | 3300013307 | Bacteria | 5994 |
| 136 | Ga0157372_10131651 | 3300013307 | Bacteria | 2878 |
| 137 | Ga0157372_10220472 | 3300013307 | Bacteria | 2199 |
| 138 | Ga0157372_10557871 | 3300013307 | Bacteria | 1335 |
| 139 | Ga0157372_10680270 | 3300013307 | Bacteria | 1198 |
| 140 | Ga0157372_10708126 | 3300013307 | Bacteria | 1172 |
| 141 | Ga0157372_11952938 | 3300013307 | Bacteria | 674 |
| 142 | Ga0157372_12714169 | 3300013307 | Unclassified | 568 |
| 143 | Ga0157375_10013766 | 3300013308 | Bacteria | 7212 |
| 144 | Ga0157375_10437223 | 3300013308 | Unclassified | 1474 |
| 145 | Ga0163163_11011028 | 3300014325 | Unclassified | 895 |
| 146 | Ga0157380_10046152 | 3300014326 | Bacteria | 3421 |
| 147 | Ga0157377_11193663 | 3300014745 | Bacteria | 589 |
| 148 | Ga0157376_10563823 | 3300014969 | Bacteria | 1129 |
| 149 | Ga0157376_10759215 | 3300014969 | Unclassified | 980 |
| 150 | Ga0157376_11035788 | 3300014969 | Bacteria | 844 |
| 151 | Ga0206356_10864105 | 3300020070 | Unclassified | 719 |
| 152 | Ga0206353_10177759 | 3300020082 | Unclassified | 1658 |
| 153 | Ga0154015_1252081 | 3300020610 | Bacteria | 524 |
| 154 | Ga0213875_10346935 | 3300021388 | Bacteria | 705 |
| 155 | Ga0207699_10010750 | 3300025906 | Bacteria | 4604 |
| 156 | Ga0207699_10016232 | 3300025906 | Bacteria | 3889 |
| 157 | Ga0207699_10030012 | 3300025906 | Bacteria | 3038 |
| 158 | Ga0207699_10576354 | 3300025906 | Bacteria | 818 |
| 159 | Ga0207705_10005895 | 3300025909 | Bacteria | 9109 |
| 160 | Ga0207705_10034774 | 3300025909 | Bacteria | 3604 |
| 161 | Ga0207705_10103163 | 3300025909 | Bacteria | 2100 |
| 162 | Ga0207705_10338992 | 3300025909 | Bacteria | 1157 |
| 163 | Ga0207705_10626568 | 3300025909 | Bacteria | 836 |
| 164 | Ga0207684_10304677 | 3300025910 | Unclassified | 1373 |
| 165 | Ga0207654_10444875 | 3300025911 | Bacteria | 908 |
| 166 | Ga0207707_10012181 | 3300025912 | Bacteria | 7477 |
| 167 | Ga0207707_10381929 | 3300025912 | Bacteria | 1211 |
| 168 | Ga0207695_10013093 | 3300025913 | Bacteria | 9903 |
| 169 | Ga0207695_10929402 | 3300025913 | Bacteria | 749 |
| 170 | Ga0207671_10377209 | 3300025914 | Unclassified | 1126 |
| 171 | Ga0207693_10034616 | 3300025915 | Bacteria | 3984 |
| 172 | Ga0207693_10055003 | 3300025915 | Bacteria | 3123 |
| 173 | Ga0207693_10075428 | 3300025915 | Unclassified | 2641 |
| 174 | Ga0207663_10067280 | 3300025916 | Bacteria | 2297 |
| 175 | Ga0207663_10399046 | 3300025916 | Unclassified | 1051 |
| 176 | Ga0207660_10000027 | 3300025917 | Bacteria | 68840 |
| 177 | Ga0207660_10129971 | 3300025917 | Bacteria | 1916 |
| 178 | Ga0207660_10153680 | 3300025917 | Bacteria | 1770 |
| 179 | Ga0207660_11253198 | 3300025917 | Bacteria | 603 |
| 180 | Ga0207657_10001987 | 3300025919 | Bacteria | 22084 |
| 181 | Ga0207657_10587832 | 3300025919 | Bacteria | 869 |
| 182 | Ga0207649_10440800 | 3300025920 | Bacteria | 981 |
| 183 | Ga0207652_10020744 | 3300025921 | Bacteria | 5415 |
| 184 | Ga0207652_10131901 | 3300025921 | Bacteria | 2229 |
| 185 | Ga0207652_10154426 | 3300025921 | Bacteria | 2056 |
| 186 | Ga0207652_10523131 | 3300025921 | Unclassified | 1067 |
| 187 | Ga0207646_10506059 | 3300025922 | Unclassified | 1088 |
| 188 | Ga0207646_11528046 | 3300025922 | Unclassified | 578 |
| 189 | Ga0207681_10870529 | 3300025923 | Bacteria | 754 |
| 190 | Ga0207694_11212669 | 3300025924 | Bacteria | 638 |
| 191 | Ga0207650_10045046 | 3300025925 | Bacteria | 3245 |
| 192 | Ga0207659_10056660 | 3300025926 | Bacteria | 2808 |
| 193 | Ga0207687_10176292 | 3300025927 | Unclassified | 1653 |
| 194 | Ga0207700_10025133 | 3300025928 | Bacteria | 4132 |
| 195 | Ga0207700_10051368 | 3300025928 | Bacteria | 3077 |
| 196 | Ga0207700_10523568 | 3300025928 | Unclassified | 1051 |
| 197 | Ga0207664_10182655 | 3300025929 | Bacteria | 1802 |
| 198 | Ga0207664_10396963 | 3300025929 | Bacteria | 1226 |
| 199 | Ga0207664_10405706 | 3300025929 | Bacteria | 1213 |
| 200 | Ga0207664_11189119 | 3300025929 | Unclassified | 680 |
| 201 | Ga0207664_11284213 | 3300025929 | Unclassified | 651 |
| 202 | Ga0207690_10028668 | 3300025932 | Bacteria | 3530 |
| 203 | Ga0207690_10626724 | 3300025932 | Bacteria | 880 |
| 204 | Ga0207690_10838130 | 3300025932 | Bacteria | 761 |
| 205 | Ga0207690_10997444 | 3300025932 | Bacteria | 697 |
| 206 | Ga0207690_11527991 | 3300025932 | Bacteria | 558 |
| 207 | Ga0207686_10011704 | 3300025934 | Bacteria | 4812 |
| 208 | Ga0207665_10043757 | 3300025939 | Unclassified | 2995 |
| 209 | Ga0207665_10466401 | 3300025939 | Unclassified | 971 |
| 210 | Ga0207691_10457982 | 3300025940 | Bacteria | 1085 |
| 211 | Ga0207689_10095699 | 3300025942 | Bacteria | 2439 |
| 212 | Ga0207661_10008108 | 3300025944 | Bacteria | 7493 |
| 213 | Ga0207661_10039675 | 3300025944 | Bacteria | 3698 |
| 214 | Ga0207661_10233566 | 3300025944 | Bacteria | 1629 |
| 215 | Ga0207661_10614129 | 3300025944 | Unclassified | 998 |
| 216 | Ga0207661_11953886 | 3300025944 | Unclassified | 532 |
| 217 | Ga0207667_10038837 | 3300025949 | Bacteria | 5078 |
| 218 | Ga0207667_11297946 | 3300025949 | Unclassified | 704 |
| 219 | Ga0207651_11406941 | 3300025960 | Bacteria | 628 |
| 220 | Ga0207712_12011773 | 3300025961 | Archaea | 517 |
| 221 | Ga0207658_10989524 | 3300025986 | Bacteria | 767 |
| 222 | Ga0207639_10192108 | 3300026041 | Bacteria | 1745 |
| 223 | Ga0207639_11089491 | 3300026041 | Bacteria | 749 |
| 224 | Ga0207702_10124640 | 3300026078 | Bacteria | 2310 |
| 225 | Ga0207702_11168496 | 3300026078 | Bacteria | 764 |
| 226 | Ga0207702_11457617 | 3300026078 | Bacteria | 678 |
| 227 | Ga0207702_12146018 | 3300026078 | Bacteria | 548 |
| 228 | Ga0207676_10139007 | 3300026095 | Bacteria | 2077 |
| 229 | Ga0207674_11232961 | 3300026116 | Bacteria | 717 |
| 230 | Ga0207674_11602619 | 3300026116 | Unclassified | 620 |
| 231 | Ga0207683_11381630 | 3300026121 | Bacteria | 651 |
| 232 | Ga0207698_10462775 | 3300026142 | Bacteria | 1227 |
| 233 | Ga0207428_10223654 | 3300027907 | Unclassified | 1410 |
| 234 | Ga0307408_100002495 | 3300031548 | Bacteria | 12879 |
| 235 | Ga0307408_100023172 | 3300031548 | Bacteria | 4227 |
| 236 | Ga0307408_100746762 | 3300031548 | Unclassified | 883 |
| 237 | Ga0307408_100974442 | 3300031548 | Bacteria | 780 |
| 238 | Ga0307408_102122047 | 3300031548 | Unclassified | 542 |
| 239 | Ga0307405_10001869 | 3300031731 | Bacteria | 9044 |
| 240 | Ga0307405_10065224 | 3300031731 | Bacteria | 2317 |
| 241 | Ga0307405_10550713 | 3300031731 | Bacteria | 933 |
| 242 | Ga0307413_10005797 | 3300031824 | Bacteria | 5561 |
| 243 | Ga0307413_10086146 | 3300031824 | Bacteria | 2030 |
| 244 | Ga0307413_11267634 | 3300031824 | Bacteria | 644 |
| 245 | Ga0307410_10000180 | 3300031852 | Bacteria | 23276 |
| 246 | Ga0307410_10250768 | 3300031852 | Bacteria | 1376 |
| 247 | Ga0307410_11069722 | 3300031852 | Bacteria | 698 |
| 248 | Ga0307410_11315729 | 3300031852 | Unclassified | 632 |
| 249 | Ga0307406_10126493 | 3300031901 | Bacteria | 1787 |
| 250 | Ga0307406_10161168 | 3300031901 | Bacteria | 1612 |
| 251 | Ga0307407_10000167 | 3300031903 | Bacteria | 20365 |
| 252 | Ga0307407_10506225 | 3300031903 | Unclassified | 886 |
| 253 | Ga0307407_10923830 | 3300031903 | Bacteria | 671 |
| 254 | Ga0307407_11006396 | 3300031903 | Bacteria | 644 |
| 255 | Ga0307412_10005332 | 3300031911 | Bacteria | 7217 |
| 256 | Ga0307412_10010365 | 3300031911 | Bacteria | 5366 |
| 257 | Ga0307412_10716688 | 3300031911 | Unclassified | 860 |
| 258 | Ga0307412_10824569 | 3300031911 | Bacteria | 807 |
| 259 | Ga0307409_100022642 | 3300031995 | Bacteria | 4334 |
| 260 | Ga0307409_100410641 | 3300031995 | Bacteria | 1296 |
| 261 | Ga0307409_101775588 | 3300031995 | Unclassified | 646 |
| 262 | Ga0307416_100002080 | 3300032002 | Bacteria | 11293 |
| 263 | Ga0307416_100030510 | 3300032002 | Bacteria | 4046 |
| 264 | Ga0307416_100046301 | 3300032002 | Bacteria | 3431 |
| 265 | Ga0307416_100125672 | 3300032002 | Bacteria | 2297 |
| 266 | Ga0307416_100920622 | 3300032002 | Bacteria | 975 |
| 267 | Ga0307416_101667541 | 3300032002 | Bacteria | 742 |
| 268 | Ga0307416_101784451 | 3300032002 | Bacteria | 719 |
| 269 | Ga0307416_102741478 | 3300032002 | Unclassified | 589 |
| 270 | Ga0307416_102975430 | 3300032002 | Bacteria | 567 |
| 271 | Ga0307416_103020279 | 3300032002 | Bacteria | 563 |
| 272 | Ga0307414_10018633 | 3300032004 | Bacteria | 4280 |
| 273 | Ga0307414_10055073 | 3300032004 | Bacteria | 2783 |
| 274 | Ga0307411_10016106 | 3300032005 | Bacteria | 4224 |
| 275 | Ga0307411_10504606 | 3300032005 | Bacteria | 1023 |
| 276 | Ga0307411_11382016 | 3300032005 | Bacteria | 644 |
| 277 | Ga0307415_100001791 | 3300032126 | Bacteria | 10515 |
| 278 | Ga0307415_101363485 | 3300032126 | Bacteria | 674 |
| 279 | Ga0373934_0005588 | 3300035086 | Bacteria | 4654 |
| 280 | Ga0373934_0132359 | 3300035086 | Bacteria | 1017 |
| 281 | Ga0373944_0009072 | 3300035089 | Bacteria | 2691 |
| 282 | Ga0373923_0281554 | 3300035111 | Unclassified | 784 |
| 283 | Ga0373945_0007089 | 3300035116 | Bacteria | 3627 |
| 284 | Ga0373945_0554977 | 3300035116 | Bacteria | 516 |
| 285 | Ga0373954_0046173 | 3300035118 | Bacteria | 2036 |
| 286 | Ga0373954_0283217 | 3300035118 | Bacteria | 817 |
| 287 | Ga0373943_0041484 | 3300035170 | Bacteria | 2226 |
| 288 | Ga0373943_0584741 | 3300035170 | Bacteria | 657 |
| 289 | Ga0373946_0011028 | 3300035171 | Bacteria | 3360 |
| 290 | Ga0373955_0154566 | 3300035172 | Bacteria | 1351 |
| 291 | Ga0373955_0203499 | 3300035172 | Bacteria | 1179 |
| 292 | Ga0373935_0051643 | 3300035692 | Bacteria | 2611 |
| 293 | Ga0373935_0065967 | 3300035692 | Bacteria | 2324 |
| 294 | Ga0373927_0001791 | 3300035695 | Bacteria | 16037 |
| 295 | Ga0373927_0043633 | 3300035695 | Bacteria | 2903 |
| 296 | Ga0373927_0044523 | 3300035695 | Bacteria | 2871 |
| 297 | Ga0373927_0048924 | 3300035695 | Bacteria | 2734 |
| 298 | Ga0373933_0207302 | 3300035724 | Bacteria | 1255 |
| 299 | Ga0373947_0000698 | 3300035725 | Bacteria | 20023 |
| 300 | Ga0373947_0035976 | 3300035725 | Bacteria | 2934 |
| 301 | Ga0373947_0773717 | 3300035725 | Bacteria | 655 |
| 302 | Ga0373937_0044088 | 3300036401 | Bacteria | 4073 |
| 303 | Ga0373937_0205309 | 3300036401 | Bacteria | 1853 |
| 304 | Ga0373937_0781524 | 3300036401 | Bacteria | 902 |
| 305 | Ga0373937_0871171 | 3300036401 | Bacteria | 849 |
| 306 | Ga0373925_0025527 | 3300037068 | Bacteria | 4318 |
| 307 | Ga0373925_0136561 | 3300037068 | Bacteria | 1916 |
| 308 | Ga0451795_0934992 | 3300041456 | Unclassified | 798 |
| 309 | Ga0439433_0168688 | 3300041999 | Unclassified | 569 |
| 310 | Ga0439462_0180557 | 3300042015 | Unclassified | 598 |
| 311 | Ga0466961_0219903 | 3300044693 | Bacteria | 1171 |
| 312 | Ga0466970_0862998 | 3300044765 | Bacteria | 532 |
| 313 | Ga0466959_0188957 | 3300045049 | Bacteria | 1438 |
| 314 | Ga0466958_0538804 | 3300045836 | Bacteria | 758 |
| 315 | Ga0466967_0117364 | 3300045976 | Bacteria | 2453 |
| 316 | Ga0466967_0679659 | 3300045976 | Bacteria | 1019 |
| 317 | Ga0495592_0215941 | 3300046454 | Bacteria | 1285 |
| 318 | Ga0495603_0023733 | 3300046455 | Bacteria | 3710 |
| 319 | Ga0495603_0067417 | 3300046455 | Bacteria | 2107 |
| 320 | Ga0495629_0004819 | 3300046459 | Bacteria | 10121 |
| 321 | Ga0495629_0076125 | 3300046459 | Bacteria | 2343 |
| 322 | Ga0495629_0147280 | 3300046459 | Bacteria | 1637 |
| 323 | Ga0495651_0082219 | 3300046462 | Bacteria | 2430 |
| 324 | Ga0495651_0222810 | 3300046462 | Bacteria | 1304 |
| 325 | Ga0495651_0379747 | 3300046462 | Archaea | 927 |
| 326 | Ga0495653_0356075 | 3300046463 | Bacteria | 940 |
| 327 | Ga0495580_0022053 | 3300046472 | Bacteria | 4692 |
| 328 | Ga0495580_0046065 | 3300046472 | Bacteria | 3096 |
| 329 | Ga0495582_0000142 | 3300046473 | Bacteria | 38514 |
| 330 | Ga0495582_0008245 | 3300046473 | Bacteria | 5749 |
| 331 | Ga0495582_0080457 | 3300046473 | Unclassified | 1809 |
| 332 | Ga0495639_0000663 | 3300046475 | Bacteria | 15927 |
| 333 | Ga0495639_0100599 | 3300046475 | Bacteria | 1364 |
| 334 | Ga0495662_0535822 | 3300046476 | Bacteria | 574 |
| 335 | Ga0495664_0099514 | 3300046477 | Bacteria | 1751 |
| 336 | Ga0495664_0457718 | 3300046477 | Bacteria | 764 |
| 337 | Ga0495594_0097956 | 3300046499 | Bacteria | 1648 |
| 338 | Ga0495594_0161732 | 3300046499 | Bacteria | 1273 |
| 339 | Ga0495608_0082608 | 3300046511 | Bacteria | 2086 |
| 340 | Ga0495608_0274760 | 3300046511 | Bacteria | 1047 |
| 341 | Ga0495618_0595620 | 3300046514 | Bacteria | 658 |
| 342 | Ga0495628_0176257 | 3300046516 | Bacteria | 1619 |
| 343 | Ga0495630_0003191 | 3300046517 | Bacteria | 11401 |
| 344 | Ga0495630_1026797 | 3300046517 | Bacteria | 626 |
| 345 | Ga0495666_0176026 | 3300046526 | Bacteria | 989 |
| 346 | Ga0495666_0265598 | 3300046526 | Bacteria | 780 |
| 347 | Ga0495652_0022200 | 3300046529 | Bacteria | 5634 |
| 348 | Ga0495665_0000009 | 3300046531 | Bacteria | 75094 |
| 349 | Ga0495665_0111297 | 3300046531 | Unclassified | 1436 |
| 350 | Ga0495665_0216022 | 3300046531 | Unclassified | 992 |
| 351 | Ga0495640_0093884 | 3300046533 | Bacteria | 1977 |
| 352 | Ga0495640_0312137 | 3300046533 | Bacteria | 975 |
| 353 | Ga0495586_0099808 | 3300046535 | Bacteria | 1610 |
| 354 | Ga0495586_0135281 | 3300046535 | Bacteria | 1381 |
| 355 | Ga0495587_0010256 | 3300046536 | Bacteria | 5972 |
| 356 | Ga0495587_0045850 | 3300046536 | Bacteria | 2597 |
| 357 | Ga0495645_0007759 | 3300046543 | Bacteria | 7462 |
| 358 | Ga0495645_0048493 | 3300046543 | Bacteria | 3093 |
| 359 | Ga0495622_0280948 | 3300046557 | Unclassified | 728 |
| 360 | Ga0495622_0343186 | 3300046557 | Bacteria | 647 |
| 361 | Ga0495667_0024739 | 3300046559 | Bacteria | 4044 |
| 362 | Ga0495667_0609994 | 3300046559 | Bacteria | 679 |
| 363 | Ga0495634_0158282 | 3300046642 | Bacteria | 1429 |
| 364 | Ga0495635_0596169 | 3300046663 | Unclassified | 722 |
| 365 | Ga0495635_0678347 | 3300046663 | Unclassified | 669 |
| 366 | Ga0495588_0003761 | 3300046674 | Bacteria | 6639 |
| 367 | Ga0495588_0070212 | 3300046674 | Bacteria | 1821 |
| 368 | Ga0495657_0411590 | 3300046675 | Bacteria | 795 |
| 369 | Ga0495599_0046121 | 3300046678 | Bacteria | 2733 |
| 370 | Ga0495599_0320111 | 3300046678 | Bacteria | 934 |
| 371 | Ga0495623_0256082 | 3300046679 | Bacteria | 982 |
| 372 | Ga0495646_0102701 | 3300046680 | Bacteria | 1637 |
| 373 | Ga0495646_0293174 | 3300046680 | Archaea | 862 |
| 374 | Ga0495658_0000131 | 3300046683 | Bacteria | 41245 |
| 375 | Ga0495658_0007971 | 3300046683 | Bacteria | 5246 |
| 376 | Ga0495613_0058723 | 3300046689 | Unclassified | 2823 |
| 377 | Ga0495624_0261817 | 3300046690 | Bacteria | 1045 |
| 378 | Ga0495600_0058098 | 3300046809 | Bacteria | 2527 |
| 379 | Ga0495600_0420637 | 3300046809 | Bacteria | 829 |
| 380 | Ga0495581_0000366 | 3300047315 | Bacteria | 22649 |
| 381 | Ga0495581_0023066 | 3300047315 | Bacteria | 3607 |
| 382 | Ga0495581_0034043 | 3300047315 | Bacteria | 2947 |
| 383 | Ga0495604_0146979 | 3300047317 | Bacteria | 1679 |
| 384 | Ga0495604_0289296 | 3300047317 | Bacteria | 1104 |
| 385 | Ga0495674_0029296 | 3300047319 | Bacteria | 5015 |
| 386 | Ga0495674_1261248 | 3300047319 | Bacteria | 556 |
| 387 | Ga0495672_0010420 | 3300047320 | Bacteria | 6620 |
| 388 | Ga0495676_0772159 | 3300047321 | Unclassified | 620 |
| 389 | Ga0495680_0030834 | 3300047322 | Bacteria | 4371 |
| 390 | Ga0495675_0145465 | 3300047444 | Bacteria | 1467 |
| 391 | Ga0495675_0381430 | 3300047444 | Bacteria | 824 |
| 392 | Ga0495684_0024813 | 3300047471 | Bacteria | 4610 |
| 393 | Ga0495684_0263715 | 3300047471 | Bacteria | 1249 |
| 394 | Ga0495593_0000040 | 3300047673 | Bacteria | 52326 |
| 395 | Ga0495593_0253577 | 3300047673 | Bacteria | 881 |
| 396 | Ga0495602_0996612 | 3300048088 | Bacteria | 553 |
| 397 | Ga0495614_0007600 | 3300048089 | Bacteria | 4820 |
| 398 | Ga0495614_0205331 | 3300048089 | Bacteria | 893 |
| 399 | Ga0496115_0373763 | 3300048918 | Unclassified | 1160 |
| 400 | Ga0501031_1043785 | 3300049568 | Bacteria | 522 |
| 401 | Ga0501032_0228392 | 3300049569 | Bacteria | 1210 |
| 402 | Ga0501033_0009596 | 3300049570 | Bacteria | 7447 |
| 403 | Ga0501033_0831136 | 3300049570 | Unclassified | 623 |
| 404 | Ga0501036_0034927 | 3300049572 | Bacteria | 4253 |
| 405 | Ga0501036_0062364 | 3300049572 | Bacteria | 3158 |
| 406 | Ga0501037_0427458 | 3300049573 | Bacteria | 906 |
| 407 | Ga0501038_0344612 | 3300049574 | Bacteria | 1161 |
| 408 | Ga0501039_0283883 | 3300049575 | Unclassified | 1301 |
| 409 | Ga0501047_0197204 | 3300049581 | Bacteria | 1875 |
| 410 | Ga0501047_0577610 | 3300049581 | Bacteria | 947 |
| 411 | Ga0501069_0826414 | 3300049585 | Bacteria | 562 |
| 412 | Ga0501071_0443731 | 3300049587 | Unclassified | 993 |
| 413 | Ga0501075_0079919 | 3300049591 | Bacteria | 2475 |
| 414 | Ga0501076_0406764 | 3300049592 | Unclassified | 1119 |
| 415 | Ga0501249_141811 | 3300049679 | Unclassified | 599 |
| 416 | Ga0501251_046043 | 3300049681 | Bacteria | 677 |
| 417 | Ga0501079_0443623 | 3300049741 | Unclassified | 1019 |
| 418 | Ga0501079_1634973 | 3300049741 | Bacteria | 507 |
| 419 | Ga0501264_011863 | 3300049761 | Bacteria | 851 |
| 420 | Ga0501268_042430 | 3300049765 | Bacteria | 860 |
| 421 | Ga0501273_027869 | 3300049770 | Bacteria | 793 |
| 422 | Ga0501035_0125632 | 3300049822 | Unclassified | 2239 |
| 423 | Ga0501035_0817023 | 3300049822 | Bacteria | 744 |
| 424 | Ga0501035_1386150 | 3300049822 | Unclassified | 539 |
| 425 | Ga0501044_0002752 | 3300049823 | Bacteria | 20012 |
| 426 | nmdc:mga05p37_88384_c1 | 3300050507 | Bacteria | 3819 |
| 427 | nmdc:mga09592_206656_c1 | 3300050508 | Bacteria | 1701 |
| 428 | nmdc:mga0qj67_10071_c1 | 3300050509 | Bacteria | 7054 |
| 429 | nmdc:mga0qj67_208589_c1 | 3300050509 | Bacteria | 1587 |
| 430 | nmdc:mga0qj67_931_c1 | 3300050509 | Bacteria | 20144 |
| 431 | nmdc:mga06r32_485099_c1 | 3300050510 | Bacteria | 1214 |
| 432 | nmdc:mga0n895_879753_c1 | 3300050512 | Unclassified | 882 |
| 433 | Ga0495612_0172080 | 3300053078 | Bacteria | 949 |
| 434 | Ga0495595_0331810 | 3300053084 | Bacteria | 767 |
| 435 | Ga0590071_012394 | 3300059421 | Bacteria | 1997 |
| 436 | Ga0590071_064938 | 3300059421 | Bacteria | 895 |
| 437 | Ga0590074_033986 | 3300059423 | Bacteria | 906 |
| 438 | Ga0501082_0075863 | 3300060353 | Bacteria | 2897 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013297 | Ga0157378_10159840 | Ga0157378_101598402 | 72 |
| 2 | 3300025914 | Ga0207671_10377209 | Ga0207671_103772092 | 73 |
| 3 | 3300009093 | Ga0105240_11176844 | Ga0105240_111768442 | 87 |
| 4 | 3300009545 | Ga0105237_10495389 | Ga0105237_104953892 | 87 |
| 5 | 3300025913 | Ga0207695_10929402 | Ga0207695_109294022 | 87 |
| 6 | 3300031548 | Ga0307408_100974442 | Ga0307408_1009744421 | 88 |
| 7 | 3300031852 | Ga0307410_11069722 | Ga0307410_110697222 | 88 |
| 8 | 3300044765 | Ga0466970_0862998 | Ga0466970_0862998_158_472 | 88 |
| 9 | 3300049761 | Ga0501264_011863 | Ga0501264_011863_254_571 | 88 |
| 10 | 3300049770 | Ga0501273_027869 | Ga0501273_027869_374_691 | 88 |
| 11 | 3300005336 | Ga0070680_100000489 | Ga0070680_10000048918 | 89 |
| 12 | 3300005467 | Ga0070706_100199070 | Ga0070706_1001990702 | 89 |
| 13 | 3300005468 | Ga0070707_100720004 | Ga0070707_1007200041 | 89 |
| 14 | 3300005471 | Ga0070698_100733441 | Ga0070698_1007334411 | 89 |
| 15 | 3300025910 | Ga0207684_10304677 | Ga0207684_103046772 | 89 |
| 16 | 3300025922 | Ga0207646_10506059 | Ga0207646_105060592 | 89 |
| 17 | 3300036401 | Ga0373937_0781524 | Ga0373937_0781524_72_389 | 89 |
| 18 | 3300045049 | Ga0466959_0188957 | Ga0466959_0188957_1079_1396 | 89 |
| 19 | 3300045836 | Ga0466958_0538804 | Ga0466958_0538804_421_738 | 89 |
| 20 | 3300046536 | Ga0495587_0045850 | Ga0495587_0045850_1210_1527 | 89 |
| 21 | 3300046678 | Ga0495599_0320111 | Ga0495599_0320111_551_868 | 89 |
| 22 | 3300025917 | Ga0207660_10000027 | Ga0207660_1000002718 | 90 |
| 23 | 3300035111 | Ga0373923_0281554 | Ga0373923_0281554_161_478 | 91 |
| 24 | 3300035172 | Ga0373955_0203499 | Ga0373955_0203499_719_1036 | 91 |
| 25 | 3300036401 | Ga0373937_0871171 | Ga0373937_0871171_299_616 | 91 |
| 26 | 3300046454 | Ga0495592_0215941 | Ga0495592_0215941_830_1147 | 91 |
| 27 | 3300046455 | Ga0495603_0067417 | Ga0495603_0067417_450_767 | 91 |
| 28 | 3300046462 | Ga0495651_0222810 | Ga0495651_0222810_907_1224 | 91 |
| 29 | 3300046463 | Ga0495653_0356075 | Ga0495653_0356075_220_537 | 91 |
| 30 | 3300046476 | Ga0495662_0535822 | Ga0495662_0535822_163_480 | 91 |
| 31 | 3300046477 | Ga0495664_0099514 | Ga0495664_0099514_21_338 | 91 |
| 32 | 3300046511 | Ga0495608_0082608 | Ga0495608_0082608_868_1185 | 91 |
| 33 | 3300046514 | Ga0495618_0595620 | Ga0495618_0595620_331_648 | 91 |
| 34 | 3300046516 | Ga0495628_0176257 | Ga0495628_0176257_1001_1318 | 91 |
| 35 | 3300046526 | Ga0495666_0265598 | Ga0495666_0265598_243_560 | 91 |
| 36 | 3300046529 | Ga0495652_0022200 | Ga0495652_0022200_4136_4453 | 91 |
| 37 | 3300046531 | Ga0495665_0216022 | Ga0495665_0216022_150_467 | 91 |
| 38 | 3300046533 | Ga0495640_0093884 | Ga0495640_0093884_1290_1607 | 91 |
| 39 | 3300046543 | Ga0495645_0048493 | Ga0495645_0048493_546_863 | 91 |
| 40 | 3300046559 | Ga0495667_0024739 | Ga0495667_0024739_674_991 | 91 |
| 41 | 3300046642 | Ga0495634_0158282 | Ga0495634_0158282_14_331 | 91 |
| 42 | 3300046663 | Ga0495635_0596169 | Ga0495635_0596169_97_414 | 91 |
| 43 | 3300046680 | Ga0495646_0102701 | Ga0495646_0102701_179_496 | 91 |
| 44 | 3300046690 | Ga0495624_0261817 | Ga0495624_0261817_527_844 | 91 |
| 45 | 3300046809 | Ga0495600_0420637 | Ga0495600_0420637_118_435 | 91 |
| 46 | 3300047317 | Ga0495604_0146979 | Ga0495604_0146979_801_1118 | 91 |
| 47 | 3300047319 | Ga0495674_0029296 | Ga0495674_0029296_1325_1642 | 91 |
| 48 | 3300047321 | Ga0495676_0772159 | Ga0495676_0772159_13_330 | 91 |
| 49 | 3300047322 | Ga0495680_0030834 | Ga0495680_0030834_3583_3900 | 91 |
| 50 | 3300047444 | Ga0495675_0145465 | Ga0495675_0145465_541_858 | 91 |
| 51 | 3300047471 | Ga0495684_0024813 | Ga0495684_0024813_2834_3151 | 91 |
| 52 | 3300048089 | Ga0495614_0205331 | Ga0495614_0205331_278_595 | 91 |
| 53 | 3300041999 | Ga0439433_0168688 | Ga0439433_0168688_25_303 | 92 |
| 54 | 3300046535 | Ga0495586_0135281 | Ga0495586_0135281_11_289 | 92 |
| 55 | 3300005435 | Ga0070714_100075709 | Ga0070714_1000757092 | 93 |
| 56 | 3300005458 | Ga0070681_10205983 | Ga0070681_102059832 | 93 |
| 57 | 3300005530 | Ga0070679_102111277 | Ga0070679_1021112772 | 93 |
| 58 | 3300006175 | Ga0070712_100078935 | Ga0070712_1000789355 | 93 |
| 59 | 3300005545 | Ga0070695_100209891 | Ga0070695_1002098913 | 94 |
| 60 | 3300006846 | Ga0075430_100114678 | Ga0075430_1001146782 | 94 |
| 61 | 3300006847 | Ga0075431_101155398 | Ga0075431_1011553982 | 94 |
| 62 | 3300031903 | Ga0307407_11006396 | Ga0307407_110063961 | 94 |
| 63 | 3300031995 | Ga0307409_100410641 | Ga0307409_1004106413 | 94 |
| 64 | 3300049741 | Ga0501079_1634973 | Ga0501079_1634973_135_452 | 94 |
| 65 | 3300050509 | nmdc:mga0qj67_208589_c1 | nmdc:mga0qj67_208589_c1_971_1288 | 94 |
| 66 | 3300050510 | nmdc:mga06r32_485099_c1 | nmdc:mga06r32_485099_c1_739_1056 | 94 |
| 67 | 3300005435 | Ga0070714_100068125 | Ga0070714_1000681252 | 95 |
| 68 | 3300005437 | Ga0070710_10172595 | Ga0070710_101725953 | 95 |
| 69 | 3300006028 | Ga0070717_10169639 | Ga0070717_101696394 | 95 |
| 70 | 3300007076 | Ga0075435_100206650 | Ga0075435_1002066502 | 95 |
| 71 | 3300025928 | Ga0207700_10523568 | Ga0207700_105235682 | 95 |
| 72 | 3300025929 | Ga0207664_10396963 | Ga0207664_103969632 | 95 |
| 73 | 3300005468 | Ga0070707_100844529 | Ga0070707_1008445291 | 96 |
| 74 | 3300005471 | Ga0070698_101040125 | Ga0070698_1010401251 | 96 |
| 75 | 3300005844 | Ga0068862_100959299 | Ga0068862_1009592992 | 96 |
| 76 | 3300025922 | Ga0207646_11528046 | Ga0207646_115280461 | 96 |
| 77 | 3300032002 | Ga0307416_101667541 | Ga0307416_1016675412 | 96 |
| 78 | 3300005436 | Ga0070713_100253136 | Ga0070713_1002531362 | 97 |
| 79 | 3300005439 | Ga0070711_100392493 | Ga0070711_1003924932 | 97 |
| 80 | 3300005471 | Ga0070698_100001204 | Ga0070698_10000120420 | 97 |
| 81 | 3300006163 | Ga0070715_10159425 | Ga0070715_101594251 | 97 |
| 82 | 3300006175 | Ga0070712_100086933 | Ga0070712_1000869333 | 97 |
| 83 | 3300006852 | Ga0075433_10351788 | Ga0075433_103517882 | 97 |
| 84 | 3300006880 | Ga0075429_100211085 | Ga0075429_1002110852 | 97 |
| 85 | 3300009147 | Ga0114129_10733797 | Ga0114129_107337972 | 97 |
| 86 | 3300025929 | Ga0207664_10405706 | Ga0207664_104057062 | 97 |
| 87 | 3300025929 | Ga0207664_11284213 | Ga0207664_112842132 | 97 |
| 88 | 3300031731 | Ga0307405_10550713 | Ga0307405_105507132 | 97 |
| 89 | 3300031824 | Ga0307413_11267634 | Ga0307413_112676342 | 97 |
| 90 | 3300032002 | Ga0307416_100125672 | Ga0307416_1001256722 | 97 |
| 91 | 3300032005 | Ga0307411_11382016 | Ga0307411_113820162 | 97 |
| 92 | 3300045976 | Ga0466967_0679659 | Ga0466967_0679659_630_947 | 97 |
| 93 | 3300050508 | nmdc:mga09592_206656_c1 | nmdc:mga09592_206656_c1_954_1271 | 97 |
| 94 | 3300009553 | Ga0105249_11513758 | Ga0105249_115137582 | 98 |
| 95 | 3300025906 | Ga0207699_10576354 | Ga0207699_105763542 | 98 |
| 96 | 3300025911 | Ga0207654_10444875 | Ga0207654_104448752 | 98 |
| 97 | 3300025915 | Ga0207693_10075428 | Ga0207693_100754282 | 98 |
| 98 | 3300025939 | Ga0207665_10466401 | Ga0207665_104664012 | 98 |
| 99 | 3300025961 | Ga0207712_12011773 | Ga0207712_120117731 | 98 |
| 100 | 3300026142 | Ga0207698_10462775 | Ga0207698_104627751 | 98 |
| 101 | 3300035089 | Ga0373944_0009072 | Ga0373944_0009072_1843_2169 | 98 |
| 102 | 3300035116 | Ga0373945_0007089 | Ga0373945_0007089_1038_1364 | 98 |
| 103 | 3300035170 | Ga0373943_0041484 | Ga0373943_0041484_1723_2049 | 98 |
| 104 | 3300035171 | Ga0373946_0011028 | Ga0373946_0011028_1947_2273 | 98 |
| 105 | 3300035692 | Ga0373935_0051643 | Ga0373935_0051643_39_365 | 98 |
| 106 | 3300035695 | Ga0373927_0001791 | Ga0373927_0001791_6512_6838 | 98 |
| 107 | 3300035725 | Ga0373947_0000698 | Ga0373947_0000698_10310_10636 | 98 |
| 108 | 3300037068 | Ga0373925_0136561 | Ga0373925_0136561_1398_1724 | 98 |
| 109 | 3300046455 | Ga0495603_0023733 | Ga0495603_0023733_1483_1809 | 98 |
| 110 | 3300046459 | Ga0495629_0076125 | Ga0495629_0076125_1886_2212 | 98 |
| 111 | 3300046472 | Ga0495580_0022053 | Ga0495580_0022053_1501_1827 | 98 |
| 112 | 3300046473 | Ga0495582_0000142 | Ga0495582_0000142_11582_11908 | 98 |
| 113 | 3300046475 | Ga0495639_0000663 | Ga0495639_0000663_6998_7324 | 98 |
| 114 | 3300046517 | Ga0495630_0003191 | Ga0495630_0003191_1961_2287 | 98 |
| 115 | 3300046557 | Ga0495622_0280948 | Ga0495622_0280948_77_403 | 98 |
| 116 | 3300046663 | Ga0495635_0678347 | Ga0495635_0678347_267_593 | 98 |
| 117 | 3300046674 | Ga0495588_0003761 | Ga0495588_0003761_1880_2206 | 98 |
| 118 | 3300046683 | Ga0495658_0000131 | Ga0495658_0000131_26381_26707 | 98 |
| 119 | 3300047315 | Ga0495581_0000366 | Ga0495581_0000366_10459_10785 | 98 |
| 120 | 3300047673 | Ga0495593_0000040 | Ga0495593_0000040_29083_29409 | 98 |
| 121 | 3300059423 | Ga0590074_033986 | Ga0590074_033986_367_684 | 98 |
| 122 | 3300006871 | Ga0075434_102001026 | Ga0075434_1020010262 | 99 |
| 123 | 3300026078 | Ga0207702_10124640 | Ga0207702_101246402 | 99 |
| 124 | 3300026121 | Ga0207683_11381630 | Ga0207683_113816301 | 99 |
| 125 | 3300031548 | Ga0307408_100023172 | Ga0307408_1000231724 | 99 |
| 126 | 3300031731 | Ga0307405_10065224 | Ga0307405_100652242 | 99 |
| 127 | 3300031852 | Ga0307410_11315729 | Ga0307410_113157292 | 99 |
| 128 | 3300031903 | Ga0307407_10506225 | Ga0307407_105062251 | 99 |
| 129 | 3300031911 | Ga0307412_10010365 | Ga0307412_100103654 | 99 |
| 130 | 3300032002 | Ga0307416_100046301 | Ga0307416_1000463013 | 99 |
| 131 | 3300050512 | nmdc:mga0n895_879753_c1 | nmdc:mga0n895_879753_c1_202_525 | 99 |
| 132 | 3300005331 | Ga0070670_100128350 | Ga0070670_1001283502 | 101 |
| 133 | 3300005336 | Ga0070680_100450956 | Ga0070680_1004509562 | 101 |
| 134 | 3300005337 | Ga0070682_101328397 | Ga0070682_1013283972 | 101 |
| 135 | 3300005337 | Ga0070682_101710418 | Ga0070682_1017104181 | 101 |
| 136 | 3300005344 | Ga0070661_100056125 | Ga0070661_1000561255 | 101 |
| 137 | 3300005345 | Ga0070692_10410647 | Ga0070692_104106472 | 101 |
| 138 | 3300005355 | Ga0070671_101012607 | Ga0070671_1010126072 | 101 |
| 139 | 3300005458 | Ga0070681_10053415 | Ga0070681_100534154 | 101 |
| 140 | 3300005530 | Ga0070679_100041068 | Ga0070679_1000410682 | 101 |
| 141 | 3300005530 | Ga0070679_100337244 | Ga0070679_1003372442 | 101 |
| 142 | 3300005530 | Ga0070679_100346332 | Ga0070679_1003463322 | 101 |
| 143 | 3300005539 | Ga0068853_100736612 | Ga0068853_1007366122 | 101 |
| 144 | 3300005547 | Ga0070693_100667587 | Ga0070693_1006675871 | 101 |
| 145 | 3300005563 | Ga0068855_101143712 | Ga0068855_1011437122 | 101 |
| 146 | 3300013307 | Ga0157372_10680270 | Ga0157372_106802702 | 101 |
| 147 | 3300021388 | Ga0213875_10346935 | Ga0213875_103469352 | 101 |
| 148 | 3300025909 | Ga0207705_10103163 | Ga0207705_101031632 | 101 |
| 149 | 3300025912 | Ga0207707_10012181 | Ga0207707_100121812 | 101 |
| 150 | 3300025912 | Ga0207707_10381929 | Ga0207707_103819291 | 101 |
| 151 | 3300025917 | Ga0207660_10153680 | Ga0207660_101536802 | 101 |
| 152 | 3300025917 | Ga0207660_11253198 | Ga0207660_112531982 | 101 |
| 153 | 3300025919 | Ga0207657_10001987 | Ga0207657_1000198725 | 101 |
| 154 | 3300025921 | Ga0207652_10131901 | Ga0207652_101319012 | 101 |
| 155 | 3300025921 | Ga0207652_10154426 | Ga0207652_101544262 | 101 |
| 156 | 3300025924 | Ga0207694_11212669 | Ga0207694_112126691 | 101 |
| 157 | 3300025944 | Ga0207661_11953886 | Ga0207661_119538862 | 101 |
| 158 | 3300025949 | Ga0207667_11297946 | Ga0207667_112979462 | 101 |
| 159 | 3300031903 | Ga0307407_10923830 | Ga0307407_109238301 | 101 |
| 160 | 3300032002 | Ga0307416_103020279 | Ga0307416_1030202792 | 101 |
| 161 | 3300013100 | Ga0157373_10481818 | Ga0157373_104818182 | 103 |
| 162 | 3300031548 | Ga0307408_100746762 | Ga0307408_1007467622 | 103 |
| 163 | 3300031901 | Ga0307406_10126493 | Ga0307406_101264934 | 103 |
| 164 | 3300031911 | Ga0307412_10716688 | Ga0307412_107166882 | 103 |
| 165 | 3300032002 | Ga0307416_100920622 | Ga0307416_1009206221 | 103 |
| 166 | 3300032002 | Ga0307416_101784451 | Ga0307416_1017844512 | 103 |
| 167 | 3300032126 | Ga0307415_101363485 | Ga0307415_1013634852 | 103 |
| 168 | 3300049570 | Ga0501033_0831136 | Ga0501033_0831136_203_514 | 103 |
| 169 | 3300049572 | Ga0501036_0062364 | Ga0501036_0062364_372_683 | 103 |
| 170 | 3300049575 | Ga0501039_0283883 | Ga0501039_0283883_858_1169 | 103 |
| 171 | 3300049587 | Ga0501071_0443731 | Ga0501071_0443731_41_352 | 103 |
| 172 | 3300049591 | Ga0501075_0079919 | Ga0501075_0079919_618_929 | 103 |
| 173 | 3300049592 | Ga0501076_0406764 | Ga0501076_0406764_31_342 | 103 |
| 174 | 3300049741 | Ga0501079_0443623 | Ga0501079_0443623_442_753 | 103 |
| 175 | 3300049822 | Ga0501035_1386150 | Ga0501035_1386150_209_520 | 103 |
| 176 | 3300060353 | Ga0501082_0075863 | Ga0501082_0075863_345_656 | 103 |
| 177 | 3300005327 | Ga0070658_10002218 | Ga0070658_100022182 | 105 |
| 178 | 3300005327 | Ga0070658_10012680 | Ga0070658_100126806 | 105 |
| 179 | 3300005327 | Ga0070658_10765452 | Ga0070658_107654521 | 105 |
| 180 | 3300005327 | Ga0070658_12000743 | Ga0070658_120007431 | 105 |
| 181 | 3300005329 | Ga0070683_100027942 | Ga0070683_1000279424 | 105 |
| 182 | 3300005329 | Ga0070683_100037675 | Ga0070683_1000376752 | 105 |
| 183 | 3300005329 | Ga0070683_100038843 | Ga0070683_1000388431 | 105 |
| 184 | 3300005329 | Ga0070683_100943513 | Ga0070683_1009435131 | 105 |
| 185 | 3300005329 | Ga0070683_102333605 | Ga0070683_1023336051 | 105 |
| 186 | 3300005334 | Ga0068869_100549192 | Ga0068869_1005491922 | 105 |
| 187 | 3300005336 | Ga0070680_100217573 | Ga0070680_1002175734 | 105 |
| 188 | 3300005336 | Ga0070680_100226430 | Ga0070680_1002264302 | 105 |
| 189 | 3300005336 | Ga0070680_101322738 | Ga0070680_1013227381 | 105 |
| 190 | 3300005339 | Ga0070660_100009663 | Ga0070660_10000966310 | 105 |
| 191 | 3300005345 | Ga0070692_10140142 | Ga0070692_101401423 | 105 |
| 192 | 3300005353 | Ga0070669_100614908 | Ga0070669_1006149082 | 105 |
| 193 | 3300005354 | Ga0070675_100244444 | Ga0070675_1002444442 | 105 |
| 194 | 3300005354 | Ga0070675_100918423 | Ga0070675_1009184232 | 105 |
| 195 | 3300005364 | Ga0070673_100635063 | Ga0070673_1006350631 | 105 |
| 196 | 3300005365 | Ga0070688_100166103 | Ga0070688_1001661032 | 105 |
| 197 | 3300005366 | Ga0070659_100095000 | Ga0070659_1000950005 | 105 |
| 198 | 3300005366 | Ga0070659_100911120 | Ga0070659_1009111202 | 105 |
| 199 | 3300005367 | Ga0070667_100403864 | Ga0070667_1004038642 | 105 |
| 200 | 3300005434 | Ga0070709_10017799 | Ga0070709_100177997 | 105 |
| 201 | 3300005434 | Ga0070709_10018231 | Ga0070709_100182313 | 105 |
| 202 | 3300005434 | Ga0070709_10058024 | Ga0070709_100580242 | 105 |
| 203 | 3300005435 | Ga0070714_100094285 | Ga0070714_1000942852 | 105 |
| 204 | 3300005435 | Ga0070714_100125045 | Ga0070714_1001250452 | 105 |
| 205 | 3300005436 | Ga0070713_100004812 | Ga0070713_1000048122 | 105 |
| 206 | 3300005436 | Ga0070713_100040990 | Ga0070713_1000409902 | 105 |
| 207 | 3300005436 | Ga0070713_100116868 | Ga0070713_1001168682 | 105 |
| 208 | 3300005436 | Ga0070713_100244989 | Ga0070713_1002449892 | 105 |
| 209 | 3300005439 | Ga0070711_100022216 | Ga0070711_1000222163 | 105 |
| 210 | 3300005458 | Ga0070681_10016753 | Ga0070681_100167532 | 105 |
| 211 | 3300005459 | Ga0068867_101015849 | Ga0068867_1010158491 | 105 |
| 212 | 3300005468 | Ga0070707_101101819 | Ga0070707_1011018192 | 105 |
| 213 | 3300005530 | Ga0070679_100059112 | Ga0070679_1000591126 | 105 |
| 214 | 3300005530 | Ga0070679_100120075 | Ga0070679_1001200754 | 105 |
| 215 | 3300005535 | Ga0070684_100029967 | Ga0070684_1000299672 | 105 |
| 216 | 3300005535 | Ga0070684_100083786 | Ga0070684_1000837862 | 105 |
| 217 | 3300005546 | Ga0070696_100525364 | Ga0070696_1005253642 | 105 |
| 218 | 3300005547 | Ga0070693_100019501 | Ga0070693_1000195012 | 105 |
| 219 | 3300005563 | Ga0068855_100029666 | Ga0068855_1000296664 | 105 |
| 220 | 3300005577 | Ga0068857_100650120 | Ga0068857_1006501202 | 105 |
| 221 | 3300005577 | Ga0068857_102522236 | Ga0068857_1025222362 | 105 |
| 222 | 3300005614 | Ga0068856_100304764 | Ga0068856_1003047642 | 105 |
| 223 | 3300005614 | Ga0068856_100386061 | Ga0068856_1003860612 | 105 |
| 224 | 3300005617 | Ga0068859_100015924 | Ga0068859_1000159242 | 105 |
| 225 | 3300005618 | Ga0068864_100248435 | Ga0068864_1002484352 | 105 |
| 226 | 3300005719 | Ga0068861_100376921 | Ga0068861_1003769212 | 105 |
| 227 | 3300005844 | Ga0068862_100063271 | Ga0068862_1000632714 | 105 |
| 228 | 3300006028 | Ga0070717_10006900 | Ga0070717_100069007 | 105 |
| 229 | 3300006173 | Ga0070716_100197370 | Ga0070716_1001973702 | 105 |
| 230 | 3300006173 | Ga0070716_100254868 | Ga0070716_1002548682 | 105 |
| 231 | 3300006175 | Ga0070712_100037643 | Ga0070712_1000376433 | 105 |
| 232 | 3300006846 | Ga0075430_100000259 | Ga0075430_10000025927 | 105 |
| 233 | 3300006846 | Ga0075430_100086380 | Ga0075430_1000863803 | 105 |
| 234 | 3300006847 | Ga0075431_100378472 | Ga0075431_1003784722 | 105 |
| 235 | 3300006880 | Ga0075429_101582524 | Ga0075429_1015825242 | 105 |
| 236 | 3300006881 | Ga0068865_100410761 | Ga0068865_1004107612 | 105 |
| 237 | 3300006931 | Ga0097620_100015924 | Ga0097620_1000159242 | 105 |
| 238 | 3300007076 | Ga0075435_100652822 | Ga0075435_1006528222 | 105 |
| 239 | 3300009093 | Ga0105240_10533847 | Ga0105240_105338472 | 105 |
| 240 | 3300009093 | Ga0105240_12482760 | Ga0105240_124827602 | 105 |
| 241 | 3300009094 | Ga0111539_10038811 | Ga0111539_100388115 | 105 |
| 242 | 3300009098 | Ga0105245_10063178 | Ga0105245_100631786 | 105 |
| 243 | 3300009147 | Ga0114129_10120865 | Ga0114129_101208654 | 105 |
| 244 | 3300009148 | Ga0105243_10315093 | Ga0105243_103150932 | 105 |
| 245 | 3300009176 | Ga0105242_10002665 | Ga0105242_100026655 | 105 |
| 246 | 3300009177 | Ga0105248_11038613 | Ga0105248_110386132 | 105 |
| 247 | 3300009177 | Ga0105248_11583189 | Ga0105248_115831892 | 105 |
| 248 | 3300009545 | Ga0105237_10216182 | Ga0105237_102161822 | 105 |
| 249 | 3300009551 | Ga0105238_10529453 | Ga0105238_105294532 | 105 |
| 250 | 3300009551 | Ga0105238_10697574 | Ga0105238_106975742 | 105 |
| 251 | 3300009551 | Ga0105238_11816209 | Ga0105238_118162091 | 105 |
| 252 | 3300009553 | Ga0105249_10418351 | Ga0105249_104183512 | 105 |
| 253 | 3300013100 | Ga0157373_10412887 | Ga0157373_104128872 | 105 |
| 254 | 3300013100 | Ga0157373_10621453 | Ga0157373_106214532 | 105 |
| 255 | 3300013102 | Ga0157371_10676613 | Ga0157371_106766131 | 105 |
| 256 | 3300013104 | Ga0157370_10000605 | Ga0157370_1000060538 | 105 |
| 257 | 3300013104 | Ga0157370_10012699 | Ga0157370_1001269910 | 105 |
| 258 | 3300013104 | Ga0157370_10890130 | Ga0157370_108901301 | 105 |
| 259 | 3300013105 | Ga0157369_10019497 | Ga0157369_100194974 | 105 |
| 260 | 3300013105 | Ga0157369_10140190 | Ga0157369_101401902 | 105 |
| 261 | 3300013105 | Ga0157369_10811233 | Ga0157369_108112332 | 105 |
| 262 | 3300013105 | Ga0157369_10863337 | Ga0157369_108633371 | 105 |
| 263 | 3300013296 | Ga0157374_12353994 | Ga0157374_123539942 | 105 |
| 264 | 3300013307 | Ga0157372_10018865 | Ga0157372_100188655 | 105 |
| 265 | 3300013307 | Ga0157372_10029467 | Ga0157372_100294677 | 105 |
| 266 | 3300013307 | Ga0157372_10131651 | Ga0157372_101316512 | 105 |
| 267 | 3300013307 | Ga0157372_10220472 | Ga0157372_102204722 | 105 |
| 268 | 3300013307 | Ga0157372_10557871 | Ga0157372_105578712 | 105 |
| 269 | 3300013307 | Ga0157372_10708126 | Ga0157372_107081263 | 105 |
| 270 | 3300013307 | Ga0157372_11952938 | Ga0157372_119529382 | 105 |
| 271 | 3300013307 | Ga0157372_12714169 | Ga0157372_127141691 | 105 |
| 272 | 3300013308 | Ga0157375_10013766 | Ga0157375_100137665 | 105 |
| 273 | 3300013308 | Ga0157375_10437223 | Ga0157375_104372232 | 105 |
| 274 | 3300014325 | Ga0163163_11011028 | Ga0163163_110110282 | 105 |
| 275 | 3300014326 | Ga0157380_10046152 | Ga0157380_100461522 | 105 |
| 276 | 3300014745 | Ga0157377_11193663 | Ga0157377_111936632 | 105 |
| 277 | 3300014969 | Ga0157376_10563823 | Ga0157376_105638232 | 105 |
| 278 | 3300014969 | Ga0157376_10759215 | Ga0157376_107592152 | 105 |
| 279 | 3300014969 | Ga0157376_11035788 | Ga0157376_110357882 | 105 |
| 280 | 3300020070 | Ga0206356_10864105 | Ga0206356_108641052 | 105 |
| 281 | 3300020082 | Ga0206353_10177759 | Ga0206353_101777594 | 105 |
| 282 | 3300020610 | Ga0154015_1252081 | Ga0154015_12520811 | 105 |
| 283 | 3300025906 | Ga0207699_10010750 | Ga0207699_100107504 | 105 |
| 284 | 3300025906 | Ga0207699_10016232 | Ga0207699_100162322 | 105 |
| 285 | 3300025906 | Ga0207699_10030012 | Ga0207699_100300123 | 105 |
| 286 | 3300025909 | Ga0207705_10005895 | Ga0207705_100058953 | 105 |
| 287 | 3300025909 | Ga0207705_10034774 | Ga0207705_100347744 | 105 |
| 288 | 3300025909 | Ga0207705_10338992 | Ga0207705_103389922 | 105 |
| 289 | 3300025909 | Ga0207705_10626568 | Ga0207705_106265682 | 105 |
| 290 | 3300025913 | Ga0207695_10013093 | Ga0207695_100130938 | 105 |
| 291 | 3300025915 | Ga0207693_10034616 | Ga0207693_100346164 | 105 |
| 292 | 3300025915 | Ga0207693_10055003 | Ga0207693_100550032 | 105 |
| 293 | 3300025916 | Ga0207663_10067280 | Ga0207663_100672802 | 105 |
| 294 | 3300025916 | Ga0207663_10399046 | Ga0207663_103990462 | 105 |
| 295 | 3300025917 | Ga0207660_10129971 | Ga0207660_101299712 | 105 |
| 296 | 3300025919 | Ga0207657_10587832 | Ga0207657_105878322 | 105 |
| 297 | 3300025920 | Ga0207649_10440800 | Ga0207649_104408002 | 105 |
| 298 | 3300025921 | Ga0207652_10020744 | Ga0207652_100207442 | 105 |
| 299 | 3300025921 | Ga0207652_10523131 | Ga0207652_105231313 | 105 |
| 300 | 3300025923 | Ga0207681_10870529 | Ga0207681_108705291 | 105 |
| 301 | 3300025925 | Ga0207650_10045046 | Ga0207650_100450462 | 105 |
| 302 | 3300025926 | Ga0207659_10056660 | Ga0207659_100566604 | 105 |
| 303 | 3300025927 | Ga0207687_10176292 | Ga0207687_101762922 | 105 |
| 304 | 3300025928 | Ga0207700_10025133 | Ga0207700_100251331 | 105 |
| 305 | 3300025928 | Ga0207700_10051368 | Ga0207700_100513682 | 105 |
| 306 | 3300025929 | Ga0207664_10182655 | Ga0207664_101826552 | 105 |
| 307 | 3300025929 | Ga0207664_11189119 | Ga0207664_111891192 | 105 |
| 308 | 3300025932 | Ga0207690_10028668 | Ga0207690_100286682 | 105 |
| 309 | 3300025932 | Ga0207690_10626724 | Ga0207690_106267242 | 105 |
| 310 | 3300025932 | Ga0207690_10838130 | Ga0207690_108381302 | 105 |
| 311 | 3300025932 | Ga0207690_10997444 | Ga0207690_109974441 | 105 |
| 312 | 3300025932 | Ga0207690_11527991 | Ga0207690_115279911 | 105 |
| 313 | 3300025934 | Ga0207686_10011704 | Ga0207686_100117045 | 105 |
| 314 | 3300025939 | Ga0207665_10043757 | Ga0207665_100437573 | 105 |
| 315 | 3300025940 | Ga0207691_10457982 | Ga0207691_104579822 | 105 |
| 316 | 3300025942 | Ga0207689_10095699 | Ga0207689_100956994 | 105 |
| 317 | 3300025944 | Ga0207661_10008108 | Ga0207661_100081089 | 105 |
| 318 | 3300025944 | Ga0207661_10039675 | Ga0207661_100396752 | 105 |
| 319 | 3300025944 | Ga0207661_10233566 | Ga0207661_102335664 | 105 |
| 320 | 3300025944 | Ga0207661_10614129 | Ga0207661_106141291 | 105 |
| 321 | 3300025949 | Ga0207667_10038837 | Ga0207667_100388375 | 105 |
| 322 | 3300025960 | Ga0207651_11406941 | Ga0207651_114069412 | 105 |
| 323 | 3300025986 | Ga0207658_10989524 | Ga0207658_109895242 | 105 |
| 324 | 3300026041 | Ga0207639_10192108 | Ga0207639_101921084 | 105 |
| 325 | 3300026041 | Ga0207639_11089491 | Ga0207639_110894912 | 105 |
| 326 | 3300026078 | Ga0207702_11168496 | Ga0207702_111684961 | 105 |
| 327 | 3300026078 | Ga0207702_11457617 | Ga0207702_114576171 | 105 |
| 328 | 3300026078 | Ga0207702_12146018 | Ga0207702_121460181 | 105 |
| 329 | 3300026095 | Ga0207676_10139007 | Ga0207676_101390072 | 105 |
| 330 | 3300026116 | Ga0207674_11232961 | Ga0207674_112329611 | 105 |
| 331 | 3300026116 | Ga0207674_11602619 | Ga0207674_116026192 | 105 |
| 332 | 3300027907 | Ga0207428_10223654 | Ga0207428_102236541 | 105 |
| 333 | 3300031548 | Ga0307408_100002495 | Ga0307408_1000024957 | 105 |
| 334 | 3300031548 | Ga0307408_102122047 | Ga0307408_1021220471 | 105 |
| 335 | 3300031731 | Ga0307405_10001869 | Ga0307405_1000186911 | 105 |
| 336 | 3300031824 | Ga0307413_10005797 | Ga0307413_100057975 | 105 |
| 337 | 3300031824 | Ga0307413_10086146 | Ga0307413_100861464 | 105 |
| 338 | 3300031852 | Ga0307410_10000180 | Ga0307410_1000018022 | 105 |
| 339 | 3300031852 | Ga0307410_10250768 | Ga0307410_102507682 | 105 |
| 340 | 3300031901 | Ga0307406_10161168 | Ga0307406_101611682 | 105 |
| 341 | 3300031903 | Ga0307407_10000167 | Ga0307407_100001677 | 105 |
| 342 | 3300031911 | Ga0307412_10005332 | Ga0307412_100053326 | 105 |
| 343 | 3300031911 | Ga0307412_10824569 | Ga0307412_108245691 | 105 |
| 344 | 3300031995 | Ga0307409_100022642 | Ga0307409_1000226427 | 105 |
| 345 | 3300031995 | Ga0307409_101775588 | Ga0307409_1017755881 | 105 |
| 346 | 3300032002 | Ga0307416_100002080 | Ga0307416_1000020806 | 105 |
| 347 | 3300032002 | Ga0307416_100030510 | Ga0307416_1000305103 | 105 |
| 348 | 3300032002 | Ga0307416_102741478 | Ga0307416_1027414781 | 105 |
| 349 | 3300032002 | Ga0307416_102975430 | Ga0307416_1029754302 | 105 |
| 350 | 3300032004 | Ga0307414_10018633 | Ga0307414_100186332 | 105 |
| 351 | 3300032004 | Ga0307414_10055073 | Ga0307414_100550732 | 105 |
| 352 | 3300032005 | Ga0307411_10016106 | Ga0307411_100161065 | 105 |
| 353 | 3300032005 | Ga0307411_10504606 | Ga0307411_105046062 | 105 |
| 354 | 3300032126 | Ga0307415_100001791 | Ga0307415_1000017917 | 105 |
| 355 | 3300035086 | Ga0373934_0005588 | Ga0373934_0005588_2099_2416 | 105 |
| 356 | 3300035086 | Ga0373934_0132359 | Ga0373934_0132359_432_749 | 105 |
| 357 | 3300035116 | Ga0373945_0554977 | Ga0373945_0554977_40_357 | 105 |
| 358 | 3300035118 | Ga0373954_0046173 | Ga0373954_0046173_1098_1415 | 105 |
| 359 | 3300035118 | Ga0373954_0283217 | Ga0373954_0283217_55_372 | 105 |
| 360 | 3300035170 | Ga0373943_0584741 | Ga0373943_0584741_238_555 | 105 |
| 361 | 3300035172 | Ga0373955_0154566 | Ga0373955_0154566_505_822 | 105 |
| 362 | 3300035692 | Ga0373935_0065967 | Ga0373935_0065967_599_916 | 105 |
| 363 | 3300035695 | Ga0373927_0043633 | Ga0373927_0043633_1040_1357 | 105 |
| 364 | 3300035695 | Ga0373927_0044523 | Ga0373927_0044523_2273_2590 | 105 |
| 365 | 3300035695 | Ga0373927_0048924 | Ga0373927_0048924_1100_1417 | 105 |
| 366 | 3300035724 | Ga0373933_0207302 | Ga0373933_0207302_201_518 | 105 |
| 367 | 3300035725 | Ga0373947_0035976 | Ga0373947_0035976_185_502 | 105 |
| 368 | 3300035725 | Ga0373947_0773717 | Ga0373947_0773717_39_356 | 105 |
| 369 | 3300036401 | Ga0373937_0044088 | Ga0373937_0044088_1854_2171 | 105 |
| 370 | 3300036401 | Ga0373937_0205309 | Ga0373937_0205309_1423_1740 | 105 |
| 371 | 3300037068 | Ga0373925_0025527 | Ga0373925_0025527_2718_3035 | 105 |
| 372 | 3300041456 | Ga0451795_0934992 | Ga0451795_0934992_20_337 | 105 |
| 373 | 3300042015 | Ga0439462_0180557 | Ga0439462_0180557_43_360 | 105 |
| 374 | 3300044693 | Ga0466961_0219903 | Ga0466961_0219903_332_652 | 105 |
| 375 | 3300045976 | Ga0466967_0117364 | Ga0466967_0117364_1884_2201 | 105 |
| 376 | 3300046459 | Ga0495629_0004819 | Ga0495629_0004819_6749_7066 | 105 |
| 377 | 3300046459 | Ga0495629_0147280 | Ga0495629_0147280_831_1148 | 105 |
| 378 | 3300046462 | Ga0495651_0082219 | Ga0495651_0082219_646_963 | 105 |
| 379 | 3300046462 | Ga0495651_0379747 | Ga0495651_0379747_206_523 | 105 |
| 380 | 3300046472 | Ga0495580_0046065 | Ga0495580_0046065_570_887 | 105 |
| 381 | 3300046473 | Ga0495582_0008245 | Ga0495582_0008245_2103_2420 | 105 |
| 382 | 3300046473 | Ga0495582_0080457 | Ga0495582_0080457_1352_1669 | 105 |
| 383 | 3300046475 | Ga0495639_0100599 | Ga0495639_0100599_222_539 | 105 |
| 384 | 3300046477 | Ga0495664_0457718 | Ga0495664_0457718_65_382 | 105 |
| 385 | 3300046499 | Ga0495594_0097956 | Ga0495594_0097956_234_551 | 105 |
| 386 | 3300046499 | Ga0495594_0161732 | Ga0495594_0161732_273_590 | 105 |
| 387 | 3300046511 | Ga0495608_0274760 | Ga0495608_0274760_259_576 | 105 |
| 388 | 3300046517 | Ga0495630_1026797 | Ga0495630_1026797_248_565 | 105 |
| 389 | 3300046526 | Ga0495666_0176026 | Ga0495666_0176026_362_679 | 105 |
| 390 | 3300046531 | Ga0495665_0000009 | Ga0495665_0000009_31998_32324 | 105 |
| 391 | 3300046531 | Ga0495665_0111297 | Ga0495665_0111297_537_854 | 105 |
| 392 | 3300046533 | Ga0495640_0312137 | Ga0495640_0312137_95_412 | 105 |
| 393 | 3300046535 | Ga0495586_0099808 | Ga0495586_0099808_725_1042 | 105 |
| 394 | 3300046536 | Ga0495587_0010256 | Ga0495587_0010256_477_794 | 105 |
| 395 | 3300046543 | Ga0495645_0007759 | Ga0495645_0007759_5826_6143 | 105 |
| 396 | 3300046557 | Ga0495622_0343186 | Ga0495622_0343186_91_408 | 105 |
| 397 | 3300046559 | Ga0495667_0609994 | Ga0495667_0609994_81_398 | 105 |
| 398 | 3300046674 | Ga0495588_0070212 | Ga0495588_0070212_1208_1525 | 105 |
| 399 | 3300046675 | Ga0495657_0411590 | Ga0495657_0411590_309_626 | 105 |
| 400 | 3300046678 | Ga0495599_0046121 | Ga0495599_0046121_1631_1948 | 105 |
| 401 | 3300046679 | Ga0495623_0256082 | Ga0495623_0256082_233_550 | 105 |
| 402 | 3300046680 | Ga0495646_0293174 | Ga0495646_0293174_453_770 | 105 |
| 403 | 3300046683 | Ga0495658_0007971 | Ga0495658_0007971_1573_1890 | 105 |
| 404 | 3300046689 | Ga0495613_0058723 | Ga0495613_0058723_1093_1410 | 105 |
| 405 | 3300046809 | Ga0495600_0058098 | Ga0495600_0058098_1838_2155 | 105 |
| 406 | 3300047315 | Ga0495581_0023066 | Ga0495581_0023066_446_763 | 105 |
| 407 | 3300047315 | Ga0495581_0034043 | Ga0495581_0034043_2461_2778 | 105 |
| 408 | 3300047317 | Ga0495604_0289296 | Ga0495604_0289296_127_444 | 105 |
| 409 | 3300047319 | Ga0495674_1261248 | Ga0495674_1261248_148_465 | 105 |
| 410 | 3300047320 | Ga0495672_0010420 | Ga0495672_0010420_759_1079 | 105 |
| 411 | 3300047444 | Ga0495675_0381430 | Ga0495675_0381430_199_516 | 105 |
| 412 | 3300047471 | Ga0495684_0263715 | Ga0495684_0263715_825_1142 | 105 |
| 413 | 3300047673 | Ga0495593_0253577 | Ga0495593_0253577_420_737 | 105 |
| 414 | 3300048088 | Ga0495602_0996612 | Ga0495602_0996612_209_526 | 105 |
| 415 | 3300048089 | Ga0495614_0007600 | Ga0495614_0007600_1501_1827 | 105 |
| 416 | 3300048918 | Ga0496115_0373763 | Ga0496115_0373763_796_1113 | 105 |
| 417 | 3300049568 | Ga0501031_1043785 | Ga0501031_1043785_122_439 | 105 |
| 418 | 3300049569 | Ga0501032_0228392 | Ga0501032_0228392_31_348 | 105 |
| 419 | 3300049570 | Ga0501033_0009596 | Ga0501033_0009596_232_549 | 105 |
| 420 | 3300049572 | Ga0501036_0034927 | Ga0501036_0034927_545_862 | 105 |
| 421 | 3300049573 | Ga0501037_0427458 | Ga0501037_0427458_123_440 | 105 |
| 422 | 3300049574 | Ga0501038_0344612 | Ga0501038_0344612_128_445 | 105 |
| 423 | 3300049581 | Ga0501047_0197204 | Ga0501047_0197204_174_491 | 105 |
| 424 | 3300049581 | Ga0501047_0577610 | Ga0501047_0577610_510_827 | 105 |
| 425 | 3300049585 | Ga0501069_0826414 | Ga0501069_0826414_201_518 | 105 |
| 426 | 3300049679 | Ga0501249_141811 | Ga0501249_141811_88_405 | 105 |
| 427 | 3300049681 | Ga0501251_046043 | Ga0501251_046043_80_397 | 105 |
| 428 | 3300049765 | Ga0501268_042430 | Ga0501268_042430_408_734 | 105 |
| 429 | 3300049822 | Ga0501035_0125632 | Ga0501035_0125632_643_960 | 105 |
| 430 | 3300049822 | Ga0501035_0817023 | Ga0501035_0817023_192_512 | 105 |
| 431 | 3300049823 | Ga0501044_0002752 | Ga0501044_0002752_232_549 | 105 |
| 432 | 3300050507 | nmdc:mga05p37_88384_c1 | nmdc:mga05p37_88384_c1_377_697 | 105 |
| 433 | 3300050509 | nmdc:mga0qj67_10071_c1 | nmdc:mga0qj67_10071_c1_3175_3492 | 105 |
| 434 | 3300050509 | nmdc:mga0qj67_931_c1 | nmdc:mga0qj67_931_c1_18727_19044 | 105 |
| 435 | 3300053078 | Ga0495612_0172080 | Ga0495612_0172080_422_739 | 105 |
| 436 | 3300053084 | Ga0495595_0331810 | Ga0495595_0331810_124_441 | 105 |
| 437 | 3300059421 | Ga0590071_012394 | Ga0590071_012394_295_612 | 105 |
| 438 | 3300059421 | Ga0590071_064938 | Ga0590071_064938_282_599 | 105 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3f42-assembly1.cif.gz_A-2 | crystal structure of uncharacterized protein hp0035 from helicobacter pylori | 0.9325 | 4 | 95 |
| 3f42-assembly1.cif.gz_A-2 | crystal structure of uncharacterized protein hp0035 from helicobacter pylori | 0.8948 | 4 | 95 |
| 1pug-assembly2.cif.gz_C | structure of e. coli ybab | 0.8931 | 14 | 92 |
| 1pug-assembly2.cif.gz_D | structure of e. coli ybab | 0.886 | 19 | 92 |
| 1ybx-assembly1.cif.gz_A | conserved hypothetical protein cth-383 from clostridium thermocellum | 0.8734 | 6 | 93 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ybxA00 | Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain | 0.8629 | 6 | 93 | 3.30.1310.10 |
| 5yrxA00 | Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain | 0.8524 | 20 | 87 | 3.30.1310.10 |
| 1pugB00 | Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain | 0.851 | 18 | 88 | 3.30.1310.10 |
| af_P9WNR9_2_108_3.30.1310.10 | Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain | 0.8284 | 3 | 97 | 3.30.1310.10 |
| 1ybxA00 | Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain | 0.827 | 6 | 93 | 3.30.1310.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V2KQJ7-F1-model_v4 | Nucleoid-associated protein G4O03_08675 | 0.952 | 7 | 97 |
GO:0003677
GO:0005829 GO:0043590 |
| AF-A0A7V7AGP2-F1-model_v4 | YbaB/EbfC family nucleoid-associated protein | 0.9511 | 4 | 95 |
GO:0003677
|
| AF-A0A1V6BI26-F1-model_v4 | Nucleoid-associated protein | 0.9465 | 8 | 97 |
GO:0003677
GO:0005829 |
| AF-A0A2E8B435-F1-model_v4 | Nucleoid-associated protein CMJ62_19055 | 0.9442 | 2 | 100 |
GO:0003677
GO:0005829 GO:0043590 |
| AF-A0A1F7RAK9-F1-model_v4 | Nucleoid-associated protein, YbaB/EbfC family | 0.9436 | 17 | 98 |
GO:0003677
GO:0005829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar