F443927

General Info

Members Datasets Scaffolds Average Seq Length
438 226 438 102

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100217573|Ga0070680_1002175734
Length 107
Sequence MRDFMKILQQAQEMQGKFQKIQDDLQNITVTGTAGGGMVTAEVSGTGQIRRMKIDPSVINSADPEMLEDLIVVALADAQKKAQEQAQAEMGKLTGGMNLPFKIPGLG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
129 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
130 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
132 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
143 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
144 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
159 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
168 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
210 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
213 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
214 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
223 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
224 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.46
Rhizosphere 99.32
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10002218 3300005327 Bacteria 16306
2 Ga0070658_10012680 3300005327 Bacteria 6761
3 Ga0070658_10765452 3300005327 Bacteria 839
4 Ga0070658_12000743 3300005327 Unclassified 500
5 Ga0070683_100027942 3300005329 Bacteria 5093
6 Ga0070683_100037675 3300005329 Bacteria 4427
7 Ga0070683_100038843 3300005329 Bacteria 4366
8 Ga0070683_100943513 3300005329 Bacteria 828
9 Ga0070683_102333605 3300005329 Bacteria 513
10 Ga0070670_100128350 3300005331 Unclassified 2188
11 Ga0068869_100549192 3300005334 Unclassified 970
12 Ga0070680_100000489 3300005336 Bacteria 27191
13 Ga0070680_100217573 3300005336 Bacteria 1612
14 Ga0070680_100226430 3300005336 Bacteria 1579
15 Ga0070680_100450956 3300005336 Bacteria 1099
16 Ga0070680_101322738 3300005336 Unclassified 624
17 Ga0070682_101328397 3300005337 Unclassified 612
18 Ga0070682_101710418 3300005337 Bacteria 547
19 Ga0070660_100009663 3300005339 Bacteria 6794
20 Ga0070661_100056125 3300005344 Bacteria 2885
21 Ga0070692_10140142 3300005345 Bacteria 1368
22 Ga0070692_10410647 3300005345 Bacteria 857
23 Ga0070669_100614908 3300005353 Unclassified 911
24 Ga0070675_100244444 3300005354 Unclassified 1569
25 Ga0070675_100918423 3300005354 Bacteria 803
26 Ga0070671_101012607 3300005355 Unclassified 728
27 Ga0070673_100635063 3300005364 Unclassified 976
28 Ga0070688_100166103 3300005365 Unclassified 1519
29 Ga0070659_100095000 3300005366 Bacteria 2394
30 Ga0070659_100911120 3300005366 Bacteria 769
31 Ga0070667_100403864 3300005367 Unclassified 1244
32 Ga0070709_10017799 3300005434 Bacteria 4083
33 Ga0070709_10018231 3300005434 Bacteria 4039
34 Ga0070709_10058024 3300005434 Bacteria 2454
35 Ga0070714_100068125 3300005435 Bacteria 3070
36 Ga0070714_100075709 3300005435 Bacteria 2920
37 Ga0070714_100094285 3300005435 Bacteria 2627
38 Ga0070714_100125045 3300005435 Bacteria 2292
39 Ga0070713_100004812 3300005436 Bacteria 9146
40 Ga0070713_100040990 3300005436 Bacteria 3769
41 Ga0070713_100116868 3300005436 Bacteria 2333
42 Ga0070713_100244989 3300005436 Bacteria 1633
43 Ga0070713_100253136 3300005436 Bacteria 1607
44 Ga0070710_10172595 3300005437 Bacteria 1348
45 Ga0070711_100022216 3300005439 Bacteria 4110
46 Ga0070711_100392493 3300005439 Unclassified 1124
47 Ga0070681_10016753 3300005458 Bacteria 7317
48 Ga0070681_10053415 3300005458 Bacteria 4026
49 Ga0070681_10205983 3300005458 Bacteria 1884
50 Ga0068867_101015849 3300005459 Bacteria 753
51 Ga0070706_100199070 3300005467 Unclassified 1871
52 Ga0070707_100720004 3300005468 Unclassified 961
53 Ga0070707_100844529 3300005468 Unclassified 880
54 Ga0070707_101101819 3300005468 Bacteria 760
55 Ga0070698_100001204 3300005471 Bacteria 28711
56 Ga0070698_100733441 3300005471 Unclassified 931
57 Ga0070698_101040125 3300005471 Bacteria 766
58 Ga0070679_100041068 3300005530 Bacteria 4605
59 Ga0070679_100059112 3300005530 Bacteria 3821
60 Ga0070679_100120075 3300005530 Bacteria 2613
61 Ga0070679_100337244 3300005530 Bacteria 1456
62 Ga0070679_100346332 3300005530 Bacteria 1434
63 Ga0070679_102111277 3300005530 Bacteria 513
64 Ga0070684_100029967 3300005535 Bacteria 4618
65 Ga0070684_100083786 3300005535 Bacteria 2826
66 Ga0068853_100736612 3300005539 Bacteria 942
67 Ga0070695_100209891 3300005545 Bacteria 1397
68 Ga0070696_100525364 3300005546 Bacteria 945
69 Ga0070693_100019501 3300005547 Bacteria 3556
70 Ga0070693_100667587 3300005547 Unclassified 758
71 Ga0068855_100029666 3300005563 Bacteria 6539
72 Ga0068855_101143712 3300005563 Unclassified 812
73 Ga0068857_100650120 3300005577 Bacteria 999
74 Ga0068857_102522236 3300005577 Unclassified 505
75 Ga0068856_100304764 3300005614 Bacteria 1611
76 Ga0068856_100386061 3300005614 Unclassified 1420
77 Ga0068859_100015924 3300005617 Bacteria 7557
78 Ga0068864_100248435 3300005618 Bacteria 1651
79 Ga0068861_100376921 3300005719 Bacteria 1252
80 Ga0068862_100063271 3300005844 Bacteria 3184
81 Ga0068862_100959299 3300005844 Bacteria 844
82 Ga0070717_10006900 3300006028 Bacteria 8386
83 Ga0070717_10169639 3300006028 Bacteria 1897
84 Ga0070715_10159425 3300006163 Unclassified 1114
85 Ga0070716_100197370 3300006173 Bacteria 1335
86 Ga0070716_100254868 3300006173 Unclassified 1197
87 Ga0070712_100037643 3300006175 Bacteria 3300
88 Ga0070712_100078935 3300006175 Bacteria 2378
89 Ga0070712_100086933 3300006175 Bacteria 2279
90 Ga0075430_100000259 3300006846 Bacteria 37106
91 Ga0075430_100086380 3300006846 Bacteria 2626
92 Ga0075430_100114678 3300006846 Bacteria 2245
93 Ga0075431_100378472 3300006847 Bacteria 1420
94 Ga0075431_101155398 3300006847 Bacteria 738
95 Ga0075433_10351788 3300006852 Unclassified 1302
96 Ga0075434_102001026 3300006871 Unclassified 585
97 Ga0075429_100211085 3300006880 Bacteria 1701
98 Ga0075429_101582524 3300006880 Unclassified 570
99 Ga0068865_100410761 3300006881 Bacteria 1111
100 Ga0097620_100015924 3300006931 Bacteria 7557
101 Ga0075435_100206650 3300007076 Bacteria 1665
102 Ga0075435_100652822 3300007076 Bacteria 913
103 Ga0105240_10533847 3300009093 Bacteria 1300
104 Ga0105240_11176844 3300009093 Unclassified 813
105 Ga0105240_12482760 3300009093 Bacteria 536
106 Ga0111539_10038811 3300009094 Bacteria 5744
107 Ga0105245_10063178 3300009098 Bacteria 3343
108 Ga0114129_10120865 3300009147 Bacteria 3606
109 Ga0114129_10733797 3300009147 Bacteria 1266
110 Ga0105243_10315093 3300009148 Unclassified 1423
111 Ga0105242_10002665 3300009176 Bacteria 13989
112 Ga0105248_11038613 3300009177 Unclassified 926
113 Ga0105248_11583189 3300009177 Unclassified 742
114 Ga0105237_10216182 3300009545 Bacteria 1917
115 Ga0105237_10495389 3300009545 Unclassified 1228
116 Ga0105238_10529453 3300009551 Bacteria 1181
117 Ga0105238_10697574 3300009551 Unclassified 1027
118 Ga0105238_11816209 3300009551 Bacteria 642
119 Ga0105249_10418351 3300009553 Unclassified 1373
120 Ga0105249_11513758 3300009553 Archaea 743
121 Ga0157373_10412887 3300013100 Bacteria 968
122 Ga0157373_10481818 3300013100 Bacteria 895
123 Ga0157373_10621453 3300013100 Bacteria 787
124 Ga0157371_10676613 3300013102 Bacteria 771
125 Ga0157370_10000605 3300013104 Bacteria 44752
126 Ga0157370_10012699 3300013104 Bacteria 8716
127 Ga0157370_10890130 3300013104 Bacteria 808
128 Ga0157369_10019497 3300013105 Bacteria 7590
129 Ga0157369_10140190 3300013105 Bacteria 2559
130 Ga0157369_10811233 3300013105 Unclassified 961
131 Ga0157369_10863337 3300013105 Bacteria 929
132 Ga0157374_12353994 3300013296 Bacteria 560
133 Ga0157378_10159840 3300013297 Bacteria 2106
134 Ga0157372_10018865 3300013307 Bacteria 7422
135 Ga0157372_10029467 3300013307 Bacteria 5994
136 Ga0157372_10131651 3300013307 Bacteria 2878
137 Ga0157372_10220472 3300013307 Bacteria 2199
138 Ga0157372_10557871 3300013307 Bacteria 1335
139 Ga0157372_10680270 3300013307 Bacteria 1198
140 Ga0157372_10708126 3300013307 Bacteria 1172
141 Ga0157372_11952938 3300013307 Bacteria 674
142 Ga0157372_12714169 3300013307 Unclassified 568
143 Ga0157375_10013766 3300013308 Bacteria 7212
144 Ga0157375_10437223 3300013308 Unclassified 1474
145 Ga0163163_11011028 3300014325 Unclassified 895
146 Ga0157380_10046152 3300014326 Bacteria 3421
147 Ga0157377_11193663 3300014745 Bacteria 589
148 Ga0157376_10563823 3300014969 Bacteria 1129
149 Ga0157376_10759215 3300014969 Unclassified 980
150 Ga0157376_11035788 3300014969 Bacteria 844
151 Ga0206356_10864105 3300020070 Unclassified 719
152 Ga0206353_10177759 3300020082 Unclassified 1658
153 Ga0154015_1252081 3300020610 Bacteria 524
154 Ga0213875_10346935 3300021388 Bacteria 705
155 Ga0207699_10010750 3300025906 Bacteria 4604
156 Ga0207699_10016232 3300025906 Bacteria 3889
157 Ga0207699_10030012 3300025906 Bacteria 3038
158 Ga0207699_10576354 3300025906 Bacteria 818
159 Ga0207705_10005895 3300025909 Bacteria 9109
160 Ga0207705_10034774 3300025909 Bacteria 3604
161 Ga0207705_10103163 3300025909 Bacteria 2100
162 Ga0207705_10338992 3300025909 Bacteria 1157
163 Ga0207705_10626568 3300025909 Bacteria 836
164 Ga0207684_10304677 3300025910 Unclassified 1373
165 Ga0207654_10444875 3300025911 Bacteria 908
166 Ga0207707_10012181 3300025912 Bacteria 7477
167 Ga0207707_10381929 3300025912 Bacteria 1211
168 Ga0207695_10013093 3300025913 Bacteria 9903
169 Ga0207695_10929402 3300025913 Bacteria 749
170 Ga0207671_10377209 3300025914 Unclassified 1126
171 Ga0207693_10034616 3300025915 Bacteria 3984
172 Ga0207693_10055003 3300025915 Bacteria 3123
173 Ga0207693_10075428 3300025915 Unclassified 2641
174 Ga0207663_10067280 3300025916 Bacteria 2297
175 Ga0207663_10399046 3300025916 Unclassified 1051
176 Ga0207660_10000027 3300025917 Bacteria 68840
177 Ga0207660_10129971 3300025917 Bacteria 1916
178 Ga0207660_10153680 3300025917 Bacteria 1770
179 Ga0207660_11253198 3300025917 Bacteria 603
180 Ga0207657_10001987 3300025919 Bacteria 22084
181 Ga0207657_10587832 3300025919 Bacteria 869
182 Ga0207649_10440800 3300025920 Bacteria 981
183 Ga0207652_10020744 3300025921 Bacteria 5415
184 Ga0207652_10131901 3300025921 Bacteria 2229
185 Ga0207652_10154426 3300025921 Bacteria 2056
186 Ga0207652_10523131 3300025921 Unclassified 1067
187 Ga0207646_10506059 3300025922 Unclassified 1088
188 Ga0207646_11528046 3300025922 Unclassified 578
189 Ga0207681_10870529 3300025923 Bacteria 754
190 Ga0207694_11212669 3300025924 Bacteria 638
191 Ga0207650_10045046 3300025925 Bacteria 3245
192 Ga0207659_10056660 3300025926 Bacteria 2808
193 Ga0207687_10176292 3300025927 Unclassified 1653
194 Ga0207700_10025133 3300025928 Bacteria 4132
195 Ga0207700_10051368 3300025928 Bacteria 3077
196 Ga0207700_10523568 3300025928 Unclassified 1051
197 Ga0207664_10182655 3300025929 Bacteria 1802
198 Ga0207664_10396963 3300025929 Bacteria 1226
199 Ga0207664_10405706 3300025929 Bacteria 1213
200 Ga0207664_11189119 3300025929 Unclassified 680
201 Ga0207664_11284213 3300025929 Unclassified 651
202 Ga0207690_10028668 3300025932 Bacteria 3530
203 Ga0207690_10626724 3300025932 Bacteria 880
204 Ga0207690_10838130 3300025932 Bacteria 761
205 Ga0207690_10997444 3300025932 Bacteria 697
206 Ga0207690_11527991 3300025932 Bacteria 558
207 Ga0207686_10011704 3300025934 Bacteria 4812
208 Ga0207665_10043757 3300025939 Unclassified 2995
209 Ga0207665_10466401 3300025939 Unclassified 971
210 Ga0207691_10457982 3300025940 Bacteria 1085
211 Ga0207689_10095699 3300025942 Bacteria 2439
212 Ga0207661_10008108 3300025944 Bacteria 7493
213 Ga0207661_10039675 3300025944 Bacteria 3698
214 Ga0207661_10233566 3300025944 Bacteria 1629
215 Ga0207661_10614129 3300025944 Unclassified 998
216 Ga0207661_11953886 3300025944 Unclassified 532
217 Ga0207667_10038837 3300025949 Bacteria 5078
218 Ga0207667_11297946 3300025949 Unclassified 704
219 Ga0207651_11406941 3300025960 Bacteria 628
220 Ga0207712_12011773 3300025961 Archaea 517
221 Ga0207658_10989524 3300025986 Bacteria 767
222 Ga0207639_10192108 3300026041 Bacteria 1745
223 Ga0207639_11089491 3300026041 Bacteria 749
224 Ga0207702_10124640 3300026078 Bacteria 2310
225 Ga0207702_11168496 3300026078 Bacteria 764
226 Ga0207702_11457617 3300026078 Bacteria 678
227 Ga0207702_12146018 3300026078 Bacteria 548
228 Ga0207676_10139007 3300026095 Bacteria 2077
229 Ga0207674_11232961 3300026116 Bacteria 717
230 Ga0207674_11602619 3300026116 Unclassified 620
231 Ga0207683_11381630 3300026121 Bacteria 651
232 Ga0207698_10462775 3300026142 Bacteria 1227
233 Ga0207428_10223654 3300027907 Unclassified 1410
234 Ga0307408_100002495 3300031548 Bacteria 12879
235 Ga0307408_100023172 3300031548 Bacteria 4227
236 Ga0307408_100746762 3300031548 Unclassified 883
237 Ga0307408_100974442 3300031548 Bacteria 780
238 Ga0307408_102122047 3300031548 Unclassified 542
239 Ga0307405_10001869 3300031731 Bacteria 9044
240 Ga0307405_10065224 3300031731 Bacteria 2317
241 Ga0307405_10550713 3300031731 Bacteria 933
242 Ga0307413_10005797 3300031824 Bacteria 5561
243 Ga0307413_10086146 3300031824 Bacteria 2030
244 Ga0307413_11267634 3300031824 Bacteria 644
245 Ga0307410_10000180 3300031852 Bacteria 23276
246 Ga0307410_10250768 3300031852 Bacteria 1376
247 Ga0307410_11069722 3300031852 Bacteria 698
248 Ga0307410_11315729 3300031852 Unclassified 632
249 Ga0307406_10126493 3300031901 Bacteria 1787
250 Ga0307406_10161168 3300031901 Bacteria 1612
251 Ga0307407_10000167 3300031903 Bacteria 20365
252 Ga0307407_10506225 3300031903 Unclassified 886
253 Ga0307407_10923830 3300031903 Bacteria 671
254 Ga0307407_11006396 3300031903 Bacteria 644
255 Ga0307412_10005332 3300031911 Bacteria 7217
256 Ga0307412_10010365 3300031911 Bacteria 5366
257 Ga0307412_10716688 3300031911 Unclassified 860
258 Ga0307412_10824569 3300031911 Bacteria 807
259 Ga0307409_100022642 3300031995 Bacteria 4334
260 Ga0307409_100410641 3300031995 Bacteria 1296
261 Ga0307409_101775588 3300031995 Unclassified 646
262 Ga0307416_100002080 3300032002 Bacteria 11293
263 Ga0307416_100030510 3300032002 Bacteria 4046
264 Ga0307416_100046301 3300032002 Bacteria 3431
265 Ga0307416_100125672 3300032002 Bacteria 2297
266 Ga0307416_100920622 3300032002 Bacteria 975
267 Ga0307416_101667541 3300032002 Bacteria 742
268 Ga0307416_101784451 3300032002 Bacteria 719
269 Ga0307416_102741478 3300032002 Unclassified 589
270 Ga0307416_102975430 3300032002 Bacteria 567
271 Ga0307416_103020279 3300032002 Bacteria 563
272 Ga0307414_10018633 3300032004 Bacteria 4280
273 Ga0307414_10055073 3300032004 Bacteria 2783
274 Ga0307411_10016106 3300032005 Bacteria 4224
275 Ga0307411_10504606 3300032005 Bacteria 1023
276 Ga0307411_11382016 3300032005 Bacteria 644
277 Ga0307415_100001791 3300032126 Bacteria 10515
278 Ga0307415_101363485 3300032126 Bacteria 674
279 Ga0373934_0005588 3300035086 Bacteria 4654
280 Ga0373934_0132359 3300035086 Bacteria 1017
281 Ga0373944_0009072 3300035089 Bacteria 2691
282 Ga0373923_0281554 3300035111 Unclassified 784
283 Ga0373945_0007089 3300035116 Bacteria 3627
284 Ga0373945_0554977 3300035116 Bacteria 516
285 Ga0373954_0046173 3300035118 Bacteria 2036
286 Ga0373954_0283217 3300035118 Bacteria 817
287 Ga0373943_0041484 3300035170 Bacteria 2226
288 Ga0373943_0584741 3300035170 Bacteria 657
289 Ga0373946_0011028 3300035171 Bacteria 3360
290 Ga0373955_0154566 3300035172 Bacteria 1351
291 Ga0373955_0203499 3300035172 Bacteria 1179
292 Ga0373935_0051643 3300035692 Bacteria 2611
293 Ga0373935_0065967 3300035692 Bacteria 2324
294 Ga0373927_0001791 3300035695 Bacteria 16037
295 Ga0373927_0043633 3300035695 Bacteria 2903
296 Ga0373927_0044523 3300035695 Bacteria 2871
297 Ga0373927_0048924 3300035695 Bacteria 2734
298 Ga0373933_0207302 3300035724 Bacteria 1255
299 Ga0373947_0000698 3300035725 Bacteria 20023
300 Ga0373947_0035976 3300035725 Bacteria 2934
301 Ga0373947_0773717 3300035725 Bacteria 655
302 Ga0373937_0044088 3300036401 Bacteria 4073
303 Ga0373937_0205309 3300036401 Bacteria 1853
304 Ga0373937_0781524 3300036401 Bacteria 902
305 Ga0373937_0871171 3300036401 Bacteria 849
306 Ga0373925_0025527 3300037068 Bacteria 4318
307 Ga0373925_0136561 3300037068 Bacteria 1916
308 Ga0451795_0934992 3300041456 Unclassified 798
309 Ga0439433_0168688 3300041999 Unclassified 569
310 Ga0439462_0180557 3300042015 Unclassified 598
311 Ga0466961_0219903 3300044693 Bacteria 1171
312 Ga0466970_0862998 3300044765 Bacteria 532
313 Ga0466959_0188957 3300045049 Bacteria 1438
314 Ga0466958_0538804 3300045836 Bacteria 758
315 Ga0466967_0117364 3300045976 Bacteria 2453
316 Ga0466967_0679659 3300045976 Bacteria 1019
317 Ga0495592_0215941 3300046454 Bacteria 1285
318 Ga0495603_0023733 3300046455 Bacteria 3710
319 Ga0495603_0067417 3300046455 Bacteria 2107
320 Ga0495629_0004819 3300046459 Bacteria 10121
321 Ga0495629_0076125 3300046459 Bacteria 2343
322 Ga0495629_0147280 3300046459 Bacteria 1637
323 Ga0495651_0082219 3300046462 Bacteria 2430
324 Ga0495651_0222810 3300046462 Bacteria 1304
325 Ga0495651_0379747 3300046462 Archaea 927
326 Ga0495653_0356075 3300046463 Bacteria 940
327 Ga0495580_0022053 3300046472 Bacteria 4692
328 Ga0495580_0046065 3300046472 Bacteria 3096
329 Ga0495582_0000142 3300046473 Bacteria 38514
330 Ga0495582_0008245 3300046473 Bacteria 5749
331 Ga0495582_0080457 3300046473 Unclassified 1809
332 Ga0495639_0000663 3300046475 Bacteria 15927
333 Ga0495639_0100599 3300046475 Bacteria 1364
334 Ga0495662_0535822 3300046476 Bacteria 574
335 Ga0495664_0099514 3300046477 Bacteria 1751
336 Ga0495664_0457718 3300046477 Bacteria 764
337 Ga0495594_0097956 3300046499 Bacteria 1648
338 Ga0495594_0161732 3300046499 Bacteria 1273
339 Ga0495608_0082608 3300046511 Bacteria 2086
340 Ga0495608_0274760 3300046511 Bacteria 1047
341 Ga0495618_0595620 3300046514 Bacteria 658
342 Ga0495628_0176257 3300046516 Bacteria 1619
343 Ga0495630_0003191 3300046517 Bacteria 11401
344 Ga0495630_1026797 3300046517 Bacteria 626
345 Ga0495666_0176026 3300046526 Bacteria 989
346 Ga0495666_0265598 3300046526 Bacteria 780
347 Ga0495652_0022200 3300046529 Bacteria 5634
348 Ga0495665_0000009 3300046531 Bacteria 75094
349 Ga0495665_0111297 3300046531 Unclassified 1436
350 Ga0495665_0216022 3300046531 Unclassified 992
351 Ga0495640_0093884 3300046533 Bacteria 1977
352 Ga0495640_0312137 3300046533 Bacteria 975
353 Ga0495586_0099808 3300046535 Bacteria 1610
354 Ga0495586_0135281 3300046535 Bacteria 1381
355 Ga0495587_0010256 3300046536 Bacteria 5972
356 Ga0495587_0045850 3300046536 Bacteria 2597
357 Ga0495645_0007759 3300046543 Bacteria 7462
358 Ga0495645_0048493 3300046543 Bacteria 3093
359 Ga0495622_0280948 3300046557 Unclassified 728
360 Ga0495622_0343186 3300046557 Bacteria 647
361 Ga0495667_0024739 3300046559 Bacteria 4044
362 Ga0495667_0609994 3300046559 Bacteria 679
363 Ga0495634_0158282 3300046642 Bacteria 1429
364 Ga0495635_0596169 3300046663 Unclassified 722
365 Ga0495635_0678347 3300046663 Unclassified 669
366 Ga0495588_0003761 3300046674 Bacteria 6639
367 Ga0495588_0070212 3300046674 Bacteria 1821
368 Ga0495657_0411590 3300046675 Bacteria 795
369 Ga0495599_0046121 3300046678 Bacteria 2733
370 Ga0495599_0320111 3300046678 Bacteria 934
371 Ga0495623_0256082 3300046679 Bacteria 982
372 Ga0495646_0102701 3300046680 Bacteria 1637
373 Ga0495646_0293174 3300046680 Archaea 862
374 Ga0495658_0000131 3300046683 Bacteria 41245
375 Ga0495658_0007971 3300046683 Bacteria 5246
376 Ga0495613_0058723 3300046689 Unclassified 2823
377 Ga0495624_0261817 3300046690 Bacteria 1045
378 Ga0495600_0058098 3300046809 Bacteria 2527
379 Ga0495600_0420637 3300046809 Bacteria 829
380 Ga0495581_0000366 3300047315 Bacteria 22649
381 Ga0495581_0023066 3300047315 Bacteria 3607
382 Ga0495581_0034043 3300047315 Bacteria 2947
383 Ga0495604_0146979 3300047317 Bacteria 1679
384 Ga0495604_0289296 3300047317 Bacteria 1104
385 Ga0495674_0029296 3300047319 Bacteria 5015
386 Ga0495674_1261248 3300047319 Bacteria 556
387 Ga0495672_0010420 3300047320 Bacteria 6620
388 Ga0495676_0772159 3300047321 Unclassified 620
389 Ga0495680_0030834 3300047322 Bacteria 4371
390 Ga0495675_0145465 3300047444 Bacteria 1467
391 Ga0495675_0381430 3300047444 Bacteria 824
392 Ga0495684_0024813 3300047471 Bacteria 4610
393 Ga0495684_0263715 3300047471 Bacteria 1249
394 Ga0495593_0000040 3300047673 Bacteria 52326
395 Ga0495593_0253577 3300047673 Bacteria 881
396 Ga0495602_0996612 3300048088 Bacteria 553
397 Ga0495614_0007600 3300048089 Bacteria 4820
398 Ga0495614_0205331 3300048089 Bacteria 893
399 Ga0496115_0373763 3300048918 Unclassified 1160
400 Ga0501031_1043785 3300049568 Bacteria 522
401 Ga0501032_0228392 3300049569 Bacteria 1210
402 Ga0501033_0009596 3300049570 Bacteria 7447
403 Ga0501033_0831136 3300049570 Unclassified 623
404 Ga0501036_0034927 3300049572 Bacteria 4253
405 Ga0501036_0062364 3300049572 Bacteria 3158
406 Ga0501037_0427458 3300049573 Bacteria 906
407 Ga0501038_0344612 3300049574 Bacteria 1161
408 Ga0501039_0283883 3300049575 Unclassified 1301
409 Ga0501047_0197204 3300049581 Bacteria 1875
410 Ga0501047_0577610 3300049581 Bacteria 947
411 Ga0501069_0826414 3300049585 Bacteria 562
412 Ga0501071_0443731 3300049587 Unclassified 993
413 Ga0501075_0079919 3300049591 Bacteria 2475
414 Ga0501076_0406764 3300049592 Unclassified 1119
415 Ga0501249_141811 3300049679 Unclassified 599
416 Ga0501251_046043 3300049681 Bacteria 677
417 Ga0501079_0443623 3300049741 Unclassified 1019
418 Ga0501079_1634973 3300049741 Bacteria 507
419 Ga0501264_011863 3300049761 Bacteria 851
420 Ga0501268_042430 3300049765 Bacteria 860
421 Ga0501273_027869 3300049770 Bacteria 793
422 Ga0501035_0125632 3300049822 Unclassified 2239
423 Ga0501035_0817023 3300049822 Bacteria 744
424 Ga0501035_1386150 3300049822 Unclassified 539
425 Ga0501044_0002752 3300049823 Bacteria 20012
426 nmdc:mga05p37_88384_c1 3300050507 Bacteria 3819
427 nmdc:mga09592_206656_c1 3300050508 Bacteria 1701
428 nmdc:mga0qj67_10071_c1 3300050509 Bacteria 7054
429 nmdc:mga0qj67_208589_c1 3300050509 Bacteria 1587
430 nmdc:mga0qj67_931_c1 3300050509 Bacteria 20144
431 nmdc:mga06r32_485099_c1 3300050510 Bacteria 1214
432 nmdc:mga0n895_879753_c1 3300050512 Unclassified 882
433 Ga0495612_0172080 3300053078 Bacteria 949
434 Ga0495595_0331810 3300053084 Bacteria 767
435 Ga0590071_012394 3300059421 Bacteria 1997
436 Ga0590071_064938 3300059421 Bacteria 895
437 Ga0590074_033986 3300059423 Bacteria 906
438 Ga0501082_0075863 3300060353 Bacteria 2897

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_10159840 Ga0157378_101598402 72
2 3300025914 Ga0207671_10377209 Ga0207671_103772092 73
3 3300009093 Ga0105240_11176844 Ga0105240_111768442 87
4 3300009545 Ga0105237_10495389 Ga0105237_104953892 87
5 3300025913 Ga0207695_10929402 Ga0207695_109294022 87
6 3300031548 Ga0307408_100974442 Ga0307408_1009744421 88
7 3300031852 Ga0307410_11069722 Ga0307410_110697222 88
8 3300044765 Ga0466970_0862998 Ga0466970_0862998_158_472 88
9 3300049761 Ga0501264_011863 Ga0501264_011863_254_571 88
10 3300049770 Ga0501273_027869 Ga0501273_027869_374_691 88
11 3300005336 Ga0070680_100000489 Ga0070680_10000048918 89
12 3300005467 Ga0070706_100199070 Ga0070706_1001990702 89
13 3300005468 Ga0070707_100720004 Ga0070707_1007200041 89
14 3300005471 Ga0070698_100733441 Ga0070698_1007334411 89
15 3300025910 Ga0207684_10304677 Ga0207684_103046772 89
16 3300025922 Ga0207646_10506059 Ga0207646_105060592 89
17 3300036401 Ga0373937_0781524 Ga0373937_0781524_72_389 89
18 3300045049 Ga0466959_0188957 Ga0466959_0188957_1079_1396 89
19 3300045836 Ga0466958_0538804 Ga0466958_0538804_421_738 89
20 3300046536 Ga0495587_0045850 Ga0495587_0045850_1210_1527 89
21 3300046678 Ga0495599_0320111 Ga0495599_0320111_551_868 89
22 3300025917 Ga0207660_10000027 Ga0207660_1000002718 90
23 3300035111 Ga0373923_0281554 Ga0373923_0281554_161_478 91
24 3300035172 Ga0373955_0203499 Ga0373955_0203499_719_1036 91
25 3300036401 Ga0373937_0871171 Ga0373937_0871171_299_616 91
26 3300046454 Ga0495592_0215941 Ga0495592_0215941_830_1147 91
27 3300046455 Ga0495603_0067417 Ga0495603_0067417_450_767 91
28 3300046462 Ga0495651_0222810 Ga0495651_0222810_907_1224 91
29 3300046463 Ga0495653_0356075 Ga0495653_0356075_220_537 91
30 3300046476 Ga0495662_0535822 Ga0495662_0535822_163_480 91
31 3300046477 Ga0495664_0099514 Ga0495664_0099514_21_338 91
32 3300046511 Ga0495608_0082608 Ga0495608_0082608_868_1185 91
33 3300046514 Ga0495618_0595620 Ga0495618_0595620_331_648 91
34 3300046516 Ga0495628_0176257 Ga0495628_0176257_1001_1318 91
35 3300046526 Ga0495666_0265598 Ga0495666_0265598_243_560 91
36 3300046529 Ga0495652_0022200 Ga0495652_0022200_4136_4453 91
37 3300046531 Ga0495665_0216022 Ga0495665_0216022_150_467 91
38 3300046533 Ga0495640_0093884 Ga0495640_0093884_1290_1607 91
39 3300046543 Ga0495645_0048493 Ga0495645_0048493_546_863 91
40 3300046559 Ga0495667_0024739 Ga0495667_0024739_674_991 91
41 3300046642 Ga0495634_0158282 Ga0495634_0158282_14_331 91
42 3300046663 Ga0495635_0596169 Ga0495635_0596169_97_414 91
43 3300046680 Ga0495646_0102701 Ga0495646_0102701_179_496 91
44 3300046690 Ga0495624_0261817 Ga0495624_0261817_527_844 91
45 3300046809 Ga0495600_0420637 Ga0495600_0420637_118_435 91
46 3300047317 Ga0495604_0146979 Ga0495604_0146979_801_1118 91
47 3300047319 Ga0495674_0029296 Ga0495674_0029296_1325_1642 91
48 3300047321 Ga0495676_0772159 Ga0495676_0772159_13_330 91
49 3300047322 Ga0495680_0030834 Ga0495680_0030834_3583_3900 91
50 3300047444 Ga0495675_0145465 Ga0495675_0145465_541_858 91
51 3300047471 Ga0495684_0024813 Ga0495684_0024813_2834_3151 91
52 3300048089 Ga0495614_0205331 Ga0495614_0205331_278_595 91
53 3300041999 Ga0439433_0168688 Ga0439433_0168688_25_303 92
54 3300046535 Ga0495586_0135281 Ga0495586_0135281_11_289 92
55 3300005435 Ga0070714_100075709 Ga0070714_1000757092 93
56 3300005458 Ga0070681_10205983 Ga0070681_102059832 93
57 3300005530 Ga0070679_102111277 Ga0070679_1021112772 93
58 3300006175 Ga0070712_100078935 Ga0070712_1000789355 93
59 3300005545 Ga0070695_100209891 Ga0070695_1002098913 94
60 3300006846 Ga0075430_100114678 Ga0075430_1001146782 94
61 3300006847 Ga0075431_101155398 Ga0075431_1011553982 94
62 3300031903 Ga0307407_11006396 Ga0307407_110063961 94
63 3300031995 Ga0307409_100410641 Ga0307409_1004106413 94
64 3300049741 Ga0501079_1634973 Ga0501079_1634973_135_452 94
65 3300050509 nmdc:mga0qj67_208589_c1 nmdc:mga0qj67_208589_c1_971_1288 94
66 3300050510 nmdc:mga06r32_485099_c1 nmdc:mga06r32_485099_c1_739_1056 94
67 3300005435 Ga0070714_100068125 Ga0070714_1000681252 95
68 3300005437 Ga0070710_10172595 Ga0070710_101725953 95
69 3300006028 Ga0070717_10169639 Ga0070717_101696394 95
70 3300007076 Ga0075435_100206650 Ga0075435_1002066502 95
71 3300025928 Ga0207700_10523568 Ga0207700_105235682 95
72 3300025929 Ga0207664_10396963 Ga0207664_103969632 95
73 3300005468 Ga0070707_100844529 Ga0070707_1008445291 96
74 3300005471 Ga0070698_101040125 Ga0070698_1010401251 96
75 3300005844 Ga0068862_100959299 Ga0068862_1009592992 96
76 3300025922 Ga0207646_11528046 Ga0207646_115280461 96
77 3300032002 Ga0307416_101667541 Ga0307416_1016675412 96
78 3300005436 Ga0070713_100253136 Ga0070713_1002531362 97
79 3300005439 Ga0070711_100392493 Ga0070711_1003924932 97
80 3300005471 Ga0070698_100001204 Ga0070698_10000120420 97
81 3300006163 Ga0070715_10159425 Ga0070715_101594251 97
82 3300006175 Ga0070712_100086933 Ga0070712_1000869333 97
83 3300006852 Ga0075433_10351788 Ga0075433_103517882 97
84 3300006880 Ga0075429_100211085 Ga0075429_1002110852 97
85 3300009147 Ga0114129_10733797 Ga0114129_107337972 97
86 3300025929 Ga0207664_10405706 Ga0207664_104057062 97
87 3300025929 Ga0207664_11284213 Ga0207664_112842132 97
88 3300031731 Ga0307405_10550713 Ga0307405_105507132 97
89 3300031824 Ga0307413_11267634 Ga0307413_112676342 97
90 3300032002 Ga0307416_100125672 Ga0307416_1001256722 97
91 3300032005 Ga0307411_11382016 Ga0307411_113820162 97
92 3300045976 Ga0466967_0679659 Ga0466967_0679659_630_947 97
93 3300050508 nmdc:mga09592_206656_c1 nmdc:mga09592_206656_c1_954_1271 97
94 3300009553 Ga0105249_11513758 Ga0105249_115137582 98
95 3300025906 Ga0207699_10576354 Ga0207699_105763542 98
96 3300025911 Ga0207654_10444875 Ga0207654_104448752 98
97 3300025915 Ga0207693_10075428 Ga0207693_100754282 98
98 3300025939 Ga0207665_10466401 Ga0207665_104664012 98
99 3300025961 Ga0207712_12011773 Ga0207712_120117731 98
100 3300026142 Ga0207698_10462775 Ga0207698_104627751 98
101 3300035089 Ga0373944_0009072 Ga0373944_0009072_1843_2169 98
102 3300035116 Ga0373945_0007089 Ga0373945_0007089_1038_1364 98
103 3300035170 Ga0373943_0041484 Ga0373943_0041484_1723_2049 98
104 3300035171 Ga0373946_0011028 Ga0373946_0011028_1947_2273 98
105 3300035692 Ga0373935_0051643 Ga0373935_0051643_39_365 98
106 3300035695 Ga0373927_0001791 Ga0373927_0001791_6512_6838 98
107 3300035725 Ga0373947_0000698 Ga0373947_0000698_10310_10636 98
108 3300037068 Ga0373925_0136561 Ga0373925_0136561_1398_1724 98
109 3300046455 Ga0495603_0023733 Ga0495603_0023733_1483_1809 98
110 3300046459 Ga0495629_0076125 Ga0495629_0076125_1886_2212 98
111 3300046472 Ga0495580_0022053 Ga0495580_0022053_1501_1827 98
112 3300046473 Ga0495582_0000142 Ga0495582_0000142_11582_11908 98
113 3300046475 Ga0495639_0000663 Ga0495639_0000663_6998_7324 98
114 3300046517 Ga0495630_0003191 Ga0495630_0003191_1961_2287 98
115 3300046557 Ga0495622_0280948 Ga0495622_0280948_77_403 98
116 3300046663 Ga0495635_0678347 Ga0495635_0678347_267_593 98
117 3300046674 Ga0495588_0003761 Ga0495588_0003761_1880_2206 98
118 3300046683 Ga0495658_0000131 Ga0495658_0000131_26381_26707 98
119 3300047315 Ga0495581_0000366 Ga0495581_0000366_10459_10785 98
120 3300047673 Ga0495593_0000040 Ga0495593_0000040_29083_29409 98
121 3300059423 Ga0590074_033986 Ga0590074_033986_367_684 98
122 3300006871 Ga0075434_102001026 Ga0075434_1020010262 99
123 3300026078 Ga0207702_10124640 Ga0207702_101246402 99
124 3300026121 Ga0207683_11381630 Ga0207683_113816301 99
125 3300031548 Ga0307408_100023172 Ga0307408_1000231724 99
126 3300031731 Ga0307405_10065224 Ga0307405_100652242 99
127 3300031852 Ga0307410_11315729 Ga0307410_113157292 99
128 3300031903 Ga0307407_10506225 Ga0307407_105062251 99
129 3300031911 Ga0307412_10010365 Ga0307412_100103654 99
130 3300032002 Ga0307416_100046301 Ga0307416_1000463013 99
131 3300050512 nmdc:mga0n895_879753_c1 nmdc:mga0n895_879753_c1_202_525 99
132 3300005331 Ga0070670_100128350 Ga0070670_1001283502 101
133 3300005336 Ga0070680_100450956 Ga0070680_1004509562 101
134 3300005337 Ga0070682_101328397 Ga0070682_1013283972 101
135 3300005337 Ga0070682_101710418 Ga0070682_1017104181 101
136 3300005344 Ga0070661_100056125 Ga0070661_1000561255 101
137 3300005345 Ga0070692_10410647 Ga0070692_104106472 101
138 3300005355 Ga0070671_101012607 Ga0070671_1010126072 101
139 3300005458 Ga0070681_10053415 Ga0070681_100534154 101
140 3300005530 Ga0070679_100041068 Ga0070679_1000410682 101
141 3300005530 Ga0070679_100337244 Ga0070679_1003372442 101
142 3300005530 Ga0070679_100346332 Ga0070679_1003463322 101
143 3300005539 Ga0068853_100736612 Ga0068853_1007366122 101
144 3300005547 Ga0070693_100667587 Ga0070693_1006675871 101
145 3300005563 Ga0068855_101143712 Ga0068855_1011437122 101
146 3300013307 Ga0157372_10680270 Ga0157372_106802702 101
147 3300021388 Ga0213875_10346935 Ga0213875_103469352 101
148 3300025909 Ga0207705_10103163 Ga0207705_101031632 101
149 3300025912 Ga0207707_10012181 Ga0207707_100121812 101
150 3300025912 Ga0207707_10381929 Ga0207707_103819291 101
151 3300025917 Ga0207660_10153680 Ga0207660_101536802 101
152 3300025917 Ga0207660_11253198 Ga0207660_112531982 101
153 3300025919 Ga0207657_10001987 Ga0207657_1000198725 101
154 3300025921 Ga0207652_10131901 Ga0207652_101319012 101
155 3300025921 Ga0207652_10154426 Ga0207652_101544262 101
156 3300025924 Ga0207694_11212669 Ga0207694_112126691 101
157 3300025944 Ga0207661_11953886 Ga0207661_119538862 101
158 3300025949 Ga0207667_11297946 Ga0207667_112979462 101
159 3300031903 Ga0307407_10923830 Ga0307407_109238301 101
160 3300032002 Ga0307416_103020279 Ga0307416_1030202792 101
161 3300013100 Ga0157373_10481818 Ga0157373_104818182 103
162 3300031548 Ga0307408_100746762 Ga0307408_1007467622 103
163 3300031901 Ga0307406_10126493 Ga0307406_101264934 103
164 3300031911 Ga0307412_10716688 Ga0307412_107166882 103
165 3300032002 Ga0307416_100920622 Ga0307416_1009206221 103
166 3300032002 Ga0307416_101784451 Ga0307416_1017844512 103
167 3300032126 Ga0307415_101363485 Ga0307415_1013634852 103
168 3300049570 Ga0501033_0831136 Ga0501033_0831136_203_514 103
169 3300049572 Ga0501036_0062364 Ga0501036_0062364_372_683 103
170 3300049575 Ga0501039_0283883 Ga0501039_0283883_858_1169 103
171 3300049587 Ga0501071_0443731 Ga0501071_0443731_41_352 103
172 3300049591 Ga0501075_0079919 Ga0501075_0079919_618_929 103
173 3300049592 Ga0501076_0406764 Ga0501076_0406764_31_342 103
174 3300049741 Ga0501079_0443623 Ga0501079_0443623_442_753 103
175 3300049822 Ga0501035_1386150 Ga0501035_1386150_209_520 103
176 3300060353 Ga0501082_0075863 Ga0501082_0075863_345_656 103
177 3300005327 Ga0070658_10002218 Ga0070658_100022182 105
178 3300005327 Ga0070658_10012680 Ga0070658_100126806 105
179 3300005327 Ga0070658_10765452 Ga0070658_107654521 105
180 3300005327 Ga0070658_12000743 Ga0070658_120007431 105
181 3300005329 Ga0070683_100027942 Ga0070683_1000279424 105
182 3300005329 Ga0070683_100037675 Ga0070683_1000376752 105
183 3300005329 Ga0070683_100038843 Ga0070683_1000388431 105
184 3300005329 Ga0070683_100943513 Ga0070683_1009435131 105
185 3300005329 Ga0070683_102333605 Ga0070683_1023336051 105
186 3300005334 Ga0068869_100549192 Ga0068869_1005491922 105
187 3300005336 Ga0070680_100217573 Ga0070680_1002175734 105
188 3300005336 Ga0070680_100226430 Ga0070680_1002264302 105
189 3300005336 Ga0070680_101322738 Ga0070680_1013227381 105
190 3300005339 Ga0070660_100009663 Ga0070660_10000966310 105
191 3300005345 Ga0070692_10140142 Ga0070692_101401423 105
192 3300005353 Ga0070669_100614908 Ga0070669_1006149082 105
193 3300005354 Ga0070675_100244444 Ga0070675_1002444442 105
194 3300005354 Ga0070675_100918423 Ga0070675_1009184232 105
195 3300005364 Ga0070673_100635063 Ga0070673_1006350631 105
196 3300005365 Ga0070688_100166103 Ga0070688_1001661032 105
197 3300005366 Ga0070659_100095000 Ga0070659_1000950005 105
198 3300005366 Ga0070659_100911120 Ga0070659_1009111202 105
199 3300005367 Ga0070667_100403864 Ga0070667_1004038642 105
200 3300005434 Ga0070709_10017799 Ga0070709_100177997 105
201 3300005434 Ga0070709_10018231 Ga0070709_100182313 105
202 3300005434 Ga0070709_10058024 Ga0070709_100580242 105
203 3300005435 Ga0070714_100094285 Ga0070714_1000942852 105
204 3300005435 Ga0070714_100125045 Ga0070714_1001250452 105
205 3300005436 Ga0070713_100004812 Ga0070713_1000048122 105
206 3300005436 Ga0070713_100040990 Ga0070713_1000409902 105
207 3300005436 Ga0070713_100116868 Ga0070713_1001168682 105
208 3300005436 Ga0070713_100244989 Ga0070713_1002449892 105
209 3300005439 Ga0070711_100022216 Ga0070711_1000222163 105
210 3300005458 Ga0070681_10016753 Ga0070681_100167532 105
211 3300005459 Ga0068867_101015849 Ga0068867_1010158491 105
212 3300005468 Ga0070707_101101819 Ga0070707_1011018192 105
213 3300005530 Ga0070679_100059112 Ga0070679_1000591126 105
214 3300005530 Ga0070679_100120075 Ga0070679_1001200754 105
215 3300005535 Ga0070684_100029967 Ga0070684_1000299672 105
216 3300005535 Ga0070684_100083786 Ga0070684_1000837862 105
217 3300005546 Ga0070696_100525364 Ga0070696_1005253642 105
218 3300005547 Ga0070693_100019501 Ga0070693_1000195012 105
219 3300005563 Ga0068855_100029666 Ga0068855_1000296664 105
220 3300005577 Ga0068857_100650120 Ga0068857_1006501202 105
221 3300005577 Ga0068857_102522236 Ga0068857_1025222362 105
222 3300005614 Ga0068856_100304764 Ga0068856_1003047642 105
223 3300005614 Ga0068856_100386061 Ga0068856_1003860612 105
224 3300005617 Ga0068859_100015924 Ga0068859_1000159242 105
225 3300005618 Ga0068864_100248435 Ga0068864_1002484352 105
226 3300005719 Ga0068861_100376921 Ga0068861_1003769212 105
227 3300005844 Ga0068862_100063271 Ga0068862_1000632714 105
228 3300006028 Ga0070717_10006900 Ga0070717_100069007 105
229 3300006173 Ga0070716_100197370 Ga0070716_1001973702 105
230 3300006173 Ga0070716_100254868 Ga0070716_1002548682 105
231 3300006175 Ga0070712_100037643 Ga0070712_1000376433 105
232 3300006846 Ga0075430_100000259 Ga0075430_10000025927 105
233 3300006846 Ga0075430_100086380 Ga0075430_1000863803 105
234 3300006847 Ga0075431_100378472 Ga0075431_1003784722 105
235 3300006880 Ga0075429_101582524 Ga0075429_1015825242 105
236 3300006881 Ga0068865_100410761 Ga0068865_1004107612 105
237 3300006931 Ga0097620_100015924 Ga0097620_1000159242 105
238 3300007076 Ga0075435_100652822 Ga0075435_1006528222 105
239 3300009093 Ga0105240_10533847 Ga0105240_105338472 105
240 3300009093 Ga0105240_12482760 Ga0105240_124827602 105
241 3300009094 Ga0111539_10038811 Ga0111539_100388115 105
242 3300009098 Ga0105245_10063178 Ga0105245_100631786 105
243 3300009147 Ga0114129_10120865 Ga0114129_101208654 105
244 3300009148 Ga0105243_10315093 Ga0105243_103150932 105
245 3300009176 Ga0105242_10002665 Ga0105242_100026655 105
246 3300009177 Ga0105248_11038613 Ga0105248_110386132 105
247 3300009177 Ga0105248_11583189 Ga0105248_115831892 105
248 3300009545 Ga0105237_10216182 Ga0105237_102161822 105
249 3300009551 Ga0105238_10529453 Ga0105238_105294532 105
250 3300009551 Ga0105238_10697574 Ga0105238_106975742 105
251 3300009551 Ga0105238_11816209 Ga0105238_118162091 105
252 3300009553 Ga0105249_10418351 Ga0105249_104183512 105
253 3300013100 Ga0157373_10412887 Ga0157373_104128872 105
254 3300013100 Ga0157373_10621453 Ga0157373_106214532 105
255 3300013102 Ga0157371_10676613 Ga0157371_106766131 105
256 3300013104 Ga0157370_10000605 Ga0157370_1000060538 105
257 3300013104 Ga0157370_10012699 Ga0157370_1001269910 105
258 3300013104 Ga0157370_10890130 Ga0157370_108901301 105
259 3300013105 Ga0157369_10019497 Ga0157369_100194974 105
260 3300013105 Ga0157369_10140190 Ga0157369_101401902 105
261 3300013105 Ga0157369_10811233 Ga0157369_108112332 105
262 3300013105 Ga0157369_10863337 Ga0157369_108633371 105
263 3300013296 Ga0157374_12353994 Ga0157374_123539942 105
264 3300013307 Ga0157372_10018865 Ga0157372_100188655 105
265 3300013307 Ga0157372_10029467 Ga0157372_100294677 105
266 3300013307 Ga0157372_10131651 Ga0157372_101316512 105
267 3300013307 Ga0157372_10220472 Ga0157372_102204722 105
268 3300013307 Ga0157372_10557871 Ga0157372_105578712 105
269 3300013307 Ga0157372_10708126 Ga0157372_107081263 105
270 3300013307 Ga0157372_11952938 Ga0157372_119529382 105
271 3300013307 Ga0157372_12714169 Ga0157372_127141691 105
272 3300013308 Ga0157375_10013766 Ga0157375_100137665 105
273 3300013308 Ga0157375_10437223 Ga0157375_104372232 105
274 3300014325 Ga0163163_11011028 Ga0163163_110110282 105
275 3300014326 Ga0157380_10046152 Ga0157380_100461522 105
276 3300014745 Ga0157377_11193663 Ga0157377_111936632 105
277 3300014969 Ga0157376_10563823 Ga0157376_105638232 105
278 3300014969 Ga0157376_10759215 Ga0157376_107592152 105
279 3300014969 Ga0157376_11035788 Ga0157376_110357882 105
280 3300020070 Ga0206356_10864105 Ga0206356_108641052 105
281 3300020082 Ga0206353_10177759 Ga0206353_101777594 105
282 3300020610 Ga0154015_1252081 Ga0154015_12520811 105
283 3300025906 Ga0207699_10010750 Ga0207699_100107504 105
284 3300025906 Ga0207699_10016232 Ga0207699_100162322 105
285 3300025906 Ga0207699_10030012 Ga0207699_100300123 105
286 3300025909 Ga0207705_10005895 Ga0207705_100058953 105
287 3300025909 Ga0207705_10034774 Ga0207705_100347744 105
288 3300025909 Ga0207705_10338992 Ga0207705_103389922 105
289 3300025909 Ga0207705_10626568 Ga0207705_106265682 105
290 3300025913 Ga0207695_10013093 Ga0207695_100130938 105
291 3300025915 Ga0207693_10034616 Ga0207693_100346164 105
292 3300025915 Ga0207693_10055003 Ga0207693_100550032 105
293 3300025916 Ga0207663_10067280 Ga0207663_100672802 105
294 3300025916 Ga0207663_10399046 Ga0207663_103990462 105
295 3300025917 Ga0207660_10129971 Ga0207660_101299712 105
296 3300025919 Ga0207657_10587832 Ga0207657_105878322 105
297 3300025920 Ga0207649_10440800 Ga0207649_104408002 105
298 3300025921 Ga0207652_10020744 Ga0207652_100207442 105
299 3300025921 Ga0207652_10523131 Ga0207652_105231313 105
300 3300025923 Ga0207681_10870529 Ga0207681_108705291 105
301 3300025925 Ga0207650_10045046 Ga0207650_100450462 105
302 3300025926 Ga0207659_10056660 Ga0207659_100566604 105
303 3300025927 Ga0207687_10176292 Ga0207687_101762922 105
304 3300025928 Ga0207700_10025133 Ga0207700_100251331 105
305 3300025928 Ga0207700_10051368 Ga0207700_100513682 105
306 3300025929 Ga0207664_10182655 Ga0207664_101826552 105
307 3300025929 Ga0207664_11189119 Ga0207664_111891192 105
308 3300025932 Ga0207690_10028668 Ga0207690_100286682 105
309 3300025932 Ga0207690_10626724 Ga0207690_106267242 105
310 3300025932 Ga0207690_10838130 Ga0207690_108381302 105
311 3300025932 Ga0207690_10997444 Ga0207690_109974441 105
312 3300025932 Ga0207690_11527991 Ga0207690_115279911 105
313 3300025934 Ga0207686_10011704 Ga0207686_100117045 105
314 3300025939 Ga0207665_10043757 Ga0207665_100437573 105
315 3300025940 Ga0207691_10457982 Ga0207691_104579822 105
316 3300025942 Ga0207689_10095699 Ga0207689_100956994 105
317 3300025944 Ga0207661_10008108 Ga0207661_100081089 105
318 3300025944 Ga0207661_10039675 Ga0207661_100396752 105
319 3300025944 Ga0207661_10233566 Ga0207661_102335664 105
320 3300025944 Ga0207661_10614129 Ga0207661_106141291 105
321 3300025949 Ga0207667_10038837 Ga0207667_100388375 105
322 3300025960 Ga0207651_11406941 Ga0207651_114069412 105
323 3300025986 Ga0207658_10989524 Ga0207658_109895242 105
324 3300026041 Ga0207639_10192108 Ga0207639_101921084 105
325 3300026041 Ga0207639_11089491 Ga0207639_110894912 105
326 3300026078 Ga0207702_11168496 Ga0207702_111684961 105
327 3300026078 Ga0207702_11457617 Ga0207702_114576171 105
328 3300026078 Ga0207702_12146018 Ga0207702_121460181 105
329 3300026095 Ga0207676_10139007 Ga0207676_101390072 105
330 3300026116 Ga0207674_11232961 Ga0207674_112329611 105
331 3300026116 Ga0207674_11602619 Ga0207674_116026192 105
332 3300027907 Ga0207428_10223654 Ga0207428_102236541 105
333 3300031548 Ga0307408_100002495 Ga0307408_1000024957 105
334 3300031548 Ga0307408_102122047 Ga0307408_1021220471 105
335 3300031731 Ga0307405_10001869 Ga0307405_1000186911 105
336 3300031824 Ga0307413_10005797 Ga0307413_100057975 105
337 3300031824 Ga0307413_10086146 Ga0307413_100861464 105
338 3300031852 Ga0307410_10000180 Ga0307410_1000018022 105
339 3300031852 Ga0307410_10250768 Ga0307410_102507682 105
340 3300031901 Ga0307406_10161168 Ga0307406_101611682 105
341 3300031903 Ga0307407_10000167 Ga0307407_100001677 105
342 3300031911 Ga0307412_10005332 Ga0307412_100053326 105
343 3300031911 Ga0307412_10824569 Ga0307412_108245691 105
344 3300031995 Ga0307409_100022642 Ga0307409_1000226427 105
345 3300031995 Ga0307409_101775588 Ga0307409_1017755881 105
346 3300032002 Ga0307416_100002080 Ga0307416_1000020806 105
347 3300032002 Ga0307416_100030510 Ga0307416_1000305103 105
348 3300032002 Ga0307416_102741478 Ga0307416_1027414781 105
349 3300032002 Ga0307416_102975430 Ga0307416_1029754302 105
350 3300032004 Ga0307414_10018633 Ga0307414_100186332 105
351 3300032004 Ga0307414_10055073 Ga0307414_100550732 105
352 3300032005 Ga0307411_10016106 Ga0307411_100161065 105
353 3300032005 Ga0307411_10504606 Ga0307411_105046062 105
354 3300032126 Ga0307415_100001791 Ga0307415_1000017917 105
355 3300035086 Ga0373934_0005588 Ga0373934_0005588_2099_2416 105
356 3300035086 Ga0373934_0132359 Ga0373934_0132359_432_749 105
357 3300035116 Ga0373945_0554977 Ga0373945_0554977_40_357 105
358 3300035118 Ga0373954_0046173 Ga0373954_0046173_1098_1415 105
359 3300035118 Ga0373954_0283217 Ga0373954_0283217_55_372 105
360 3300035170 Ga0373943_0584741 Ga0373943_0584741_238_555 105
361 3300035172 Ga0373955_0154566 Ga0373955_0154566_505_822 105
362 3300035692 Ga0373935_0065967 Ga0373935_0065967_599_916 105
363 3300035695 Ga0373927_0043633 Ga0373927_0043633_1040_1357 105
364 3300035695 Ga0373927_0044523 Ga0373927_0044523_2273_2590 105
365 3300035695 Ga0373927_0048924 Ga0373927_0048924_1100_1417 105
366 3300035724 Ga0373933_0207302 Ga0373933_0207302_201_518 105
367 3300035725 Ga0373947_0035976 Ga0373947_0035976_185_502 105
368 3300035725 Ga0373947_0773717 Ga0373947_0773717_39_356 105
369 3300036401 Ga0373937_0044088 Ga0373937_0044088_1854_2171 105
370 3300036401 Ga0373937_0205309 Ga0373937_0205309_1423_1740 105
371 3300037068 Ga0373925_0025527 Ga0373925_0025527_2718_3035 105
372 3300041456 Ga0451795_0934992 Ga0451795_0934992_20_337 105
373 3300042015 Ga0439462_0180557 Ga0439462_0180557_43_360 105
374 3300044693 Ga0466961_0219903 Ga0466961_0219903_332_652 105
375 3300045976 Ga0466967_0117364 Ga0466967_0117364_1884_2201 105
376 3300046459 Ga0495629_0004819 Ga0495629_0004819_6749_7066 105
377 3300046459 Ga0495629_0147280 Ga0495629_0147280_831_1148 105
378 3300046462 Ga0495651_0082219 Ga0495651_0082219_646_963 105
379 3300046462 Ga0495651_0379747 Ga0495651_0379747_206_523 105
380 3300046472 Ga0495580_0046065 Ga0495580_0046065_570_887 105
381 3300046473 Ga0495582_0008245 Ga0495582_0008245_2103_2420 105
382 3300046473 Ga0495582_0080457 Ga0495582_0080457_1352_1669 105
383 3300046475 Ga0495639_0100599 Ga0495639_0100599_222_539 105
384 3300046477 Ga0495664_0457718 Ga0495664_0457718_65_382 105
385 3300046499 Ga0495594_0097956 Ga0495594_0097956_234_551 105
386 3300046499 Ga0495594_0161732 Ga0495594_0161732_273_590 105
387 3300046511 Ga0495608_0274760 Ga0495608_0274760_259_576 105
388 3300046517 Ga0495630_1026797 Ga0495630_1026797_248_565 105
389 3300046526 Ga0495666_0176026 Ga0495666_0176026_362_679 105
390 3300046531 Ga0495665_0000009 Ga0495665_0000009_31998_32324 105
391 3300046531 Ga0495665_0111297 Ga0495665_0111297_537_854 105
392 3300046533 Ga0495640_0312137 Ga0495640_0312137_95_412 105
393 3300046535 Ga0495586_0099808 Ga0495586_0099808_725_1042 105
394 3300046536 Ga0495587_0010256 Ga0495587_0010256_477_794 105
395 3300046543 Ga0495645_0007759 Ga0495645_0007759_5826_6143 105
396 3300046557 Ga0495622_0343186 Ga0495622_0343186_91_408 105
397 3300046559 Ga0495667_0609994 Ga0495667_0609994_81_398 105
398 3300046674 Ga0495588_0070212 Ga0495588_0070212_1208_1525 105
399 3300046675 Ga0495657_0411590 Ga0495657_0411590_309_626 105
400 3300046678 Ga0495599_0046121 Ga0495599_0046121_1631_1948 105
401 3300046679 Ga0495623_0256082 Ga0495623_0256082_233_550 105
402 3300046680 Ga0495646_0293174 Ga0495646_0293174_453_770 105
403 3300046683 Ga0495658_0007971 Ga0495658_0007971_1573_1890 105
404 3300046689 Ga0495613_0058723 Ga0495613_0058723_1093_1410 105
405 3300046809 Ga0495600_0058098 Ga0495600_0058098_1838_2155 105
406 3300047315 Ga0495581_0023066 Ga0495581_0023066_446_763 105
407 3300047315 Ga0495581_0034043 Ga0495581_0034043_2461_2778 105
408 3300047317 Ga0495604_0289296 Ga0495604_0289296_127_444 105
409 3300047319 Ga0495674_1261248 Ga0495674_1261248_148_465 105
410 3300047320 Ga0495672_0010420 Ga0495672_0010420_759_1079 105
411 3300047444 Ga0495675_0381430 Ga0495675_0381430_199_516 105
412 3300047471 Ga0495684_0263715 Ga0495684_0263715_825_1142 105
413 3300047673 Ga0495593_0253577 Ga0495593_0253577_420_737 105
414 3300048088 Ga0495602_0996612 Ga0495602_0996612_209_526 105
415 3300048089 Ga0495614_0007600 Ga0495614_0007600_1501_1827 105
416 3300048918 Ga0496115_0373763 Ga0496115_0373763_796_1113 105
417 3300049568 Ga0501031_1043785 Ga0501031_1043785_122_439 105
418 3300049569 Ga0501032_0228392 Ga0501032_0228392_31_348 105
419 3300049570 Ga0501033_0009596 Ga0501033_0009596_232_549 105
420 3300049572 Ga0501036_0034927 Ga0501036_0034927_545_862 105
421 3300049573 Ga0501037_0427458 Ga0501037_0427458_123_440 105
422 3300049574 Ga0501038_0344612 Ga0501038_0344612_128_445 105
423 3300049581 Ga0501047_0197204 Ga0501047_0197204_174_491 105
424 3300049581 Ga0501047_0577610 Ga0501047_0577610_510_827 105
425 3300049585 Ga0501069_0826414 Ga0501069_0826414_201_518 105
426 3300049679 Ga0501249_141811 Ga0501249_141811_88_405 105
427 3300049681 Ga0501251_046043 Ga0501251_046043_80_397 105
428 3300049765 Ga0501268_042430 Ga0501268_042430_408_734 105
429 3300049822 Ga0501035_0125632 Ga0501035_0125632_643_960 105
430 3300049822 Ga0501035_0817023 Ga0501035_0817023_192_512 105
431 3300049823 Ga0501044_0002752 Ga0501044_0002752_232_549 105
432 3300050507 nmdc:mga05p37_88384_c1 nmdc:mga05p37_88384_c1_377_697 105
433 3300050509 nmdc:mga0qj67_10071_c1 nmdc:mga0qj67_10071_c1_3175_3492 105
434 3300050509 nmdc:mga0qj67_931_c1 nmdc:mga0qj67_931_c1_18727_19044 105
435 3300053078 Ga0495612_0172080 Ga0495612_0172080_422_739 105
436 3300053084 Ga0495595_0331810 Ga0495595_0331810_124_441 105
437 3300059421 Ga0590071_012394 Ga0590071_012394_295_612 105
438 3300059421 Ga0590071_064938 Ga0590071_064938_282_599 105

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02575

YbaB_DNA_bd

YbaB/EbfC DNA-binding family

8

98

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f42-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein hp0035 from helicobacter pylori 0.9325 4 95
3f42-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein hp0035 from helicobacter pylori 0.8948 4 95
1pug-assembly2.cif.gz_C structure of e. coli ybab 0.8931 14 92
1pug-assembly2.cif.gz_D structure of e. coli ybab 0.886 19 92
1ybx-assembly1.cif.gz_A conserved hypothetical protein cth-383 from clostridium thermocellum 0.8734 6 93
ID Description Score Start End Superfamily
1ybxA00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8629 6 93 3.30.1310.10
5yrxA00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8524 20 87 3.30.1310.10
1pugB00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.851 18 88 3.30.1310.10
af_P9WNR9_2_108_3.30.1310.10 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8284 3 97 3.30.1310.10
1ybxA00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.827 6 93 3.30.1310.10
ID Description Score Start End GO Terms
AF-A0A7V2KQJ7-F1-model_v4 Nucleoid-associated protein G4O03_08675 0.952 7 97 GO:0003677
GO:0005829
GO:0043590
AF-A0A7V7AGP2-F1-model_v4 YbaB/EbfC family nucleoid-associated protein 0.9511 4 95 GO:0003677
AF-A0A1V6BI26-F1-model_v4 Nucleoid-associated protein 0.9465 8 97 GO:0003677
GO:0005829
AF-A0A2E8B435-F1-model_v4 Nucleoid-associated protein CMJ62_19055 0.9442 2 100 GO:0003677
GO:0005829
GO:0043590
AF-A0A1F7RAK9-F1-model_v4 Nucleoid-associated protein, YbaB/EbfC family 0.9436 17 98 GO:0003677
GO:0005829

Feature Viewer

pLDDT pTM Quality
86.29 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map