F443902

General Info

Members Datasets Scaffolds Average Seq Length
437 248 874 232

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2921643360|2921649280
Length 260
Sequence TTTIVLIEDDRHVRRFVRTSLEADGMTVCDAETGAQGLAEAATRRPDLVIVDLGLPDMDGIEVIRELRKWSTVPVIVLSARSREEHKVAALDAGADDYLTKPFGLPELTARIRAHLRRHTCGSGPQSARVFFGAVTIDLAGRTVMRDGQTIHLTPIEYRLLSALVSRAGWVLTHRQLLQEVWGPTHTTNDHYLRVYMGHLRQKLEDDPAQPEHIITETGVGYRLVGVSDHQGSRSRRFDSRAKDARFRDDGFEASLPVGL

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
27 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
45 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
75 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
76 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
79 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
80 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
83 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
84 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
101 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
102 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
103 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
104 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
109 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
118 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
128 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
129 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
132 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
133 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
134 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
135 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
136 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
144 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
145 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
146 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
147 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
148 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
149 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
152 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
156 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
162 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
165 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
185 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
188 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
189 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
192 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
195 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
209 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
210 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
211 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
212 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
213 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
214 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
219 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
232 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
235 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
236 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
237 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
238 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
239 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
240 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
241 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
242 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
243 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
244 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
245 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
246 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
247 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
248 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.8
Metatranscriptomes 0
Isolates 3.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 1.37
Rhizoplane 7.32
Rhizosphere 82.38
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000633 3300001979 Bacteria 15172
2 JGI24735J21928_10000817 3300002067 Bacteria 11069
3 Ga0055531_10012950 3300003794 Bacteria 3882
4 Ga0070658_10011049 3300005327 Bacteria 7236
5 Ga0070658_10016024 3300005327 Bacteria 5996
6 Ga0070683_100052842 3300005329 Bacteria 3765
7 Ga0070680_100003931 3300005336 Bacteria 11111
8 Ga0070660_100009107 3300005339 Bacteria 6968
9 Ga0070660_100051434 3300005339 Bacteria 3173
10 Ga0070691_10002838 3300005341 Bacteria 7750
11 Ga0070661_100009037 3300005344 Bacteria 6894
12 Ga0070692_10086900 3300005345 Bacteria 1693
13 Ga0070667_100090596 3300005367 Bacteria 2629
14 Ga0070667_100120627 3300005367 Bacteria 2280
15 Ga0070713_100054165 3300005436 Bacteria 3327
16 Ga0070663_100005099 3300005455 Bacteria 7769
17 Ga0070663_100074454 3300005455 Bacteria 2480
18 Ga0070681_10012389 3300005458 Bacteria 8457
19 Ga0070679_100017908 3300005530 Bacteria 6862
20 Ga0068853_100386418 3300005539 Bacteria 1308
21 Ga0070686_100141192 3300005544 Bacteria 1677
22 Ga0068855_100001711 3300005563 Bacteria 27434
23 Ga0068855_100004438 3300005563 Bacteria 17140
24 Ga0068855_100013586 3300005563 Bacteria 9818
25 Ga0068854_100006091 3300005578 Bacteria 7648
26 Ga0068856_100008998 3300005614 Bacteria 9716
27 Ga0068856_100020405 3300005614 Bacteria 6436
28 Ga0068852_100007571 3300005616 Bacteria 7934
29 Ga0068858_100090801 3300005842 Bacteria 2843
30 Ga0075430_100145948 3300006846 Bacteria 1971
31 Ga0075434_100092920 3300006871 Bacteria 3019
32 Ga0075434_100612358 3300006871 Bacteria 1108
33 Ga0075436_100001060 3300006914 Bacteria 18543
34 Ga0105251_10006973 3300009011 Bacteria 7071
35 Ga0105251_10068682 3300009011 Bacteria 1653
36 Ga0105244_10036443 3300009036 Bacteria 2576
37 Ga0105244_10089538 3300009036 Bacteria 1515
38 Ga0105240_10030599 3300009093 Bacteria 6995
39 Ga0105240_10041247 3300009093 Bacteria 5893
40 Ga0105240_10177385 3300009093 Bacteria 2518
41 Ga0105240_11326701 3300009093 Bacteria 758
42 Ga0105245_10048604 3300009098 Unclassified 3795
43 Ga0114129_10289508 3300009147 Bacteria 2186
44 Ga0105248_10050371 3300009177 Bacteria 4670
45 Ga0105248_10320146 3300009177 Bacteria 1747
46 Ga0105237_10061510 3300009545 Bacteria 3754
47 Ga0105238_10019402 3300009551 Bacteria 6924
48 Ga0105238_10593706 3300009551 Bacteria 1115
49 Ga0105246_10360154 3300011119 Bacteria 1195
50 Ga0157371_10005418 3300013102 Bacteria 10770
51 Ga0157370_10008669 3300013104 Bacteria 10942
52 Ga0157369_10008185 3300013105 Bacteria 11995
53 Ga0157374_10375959 3300013296 Bacteria 1415
54 Ga0163162_10000197 3300013306 Bacteria 55860
55 Ga0163162_10190756 3300013306 Bacteria 2177
56 Ga0157372_10008542 3300013307 Bacteria 10877
57 Ga0157375_10011265 3300013308 Bacteria 7892
58 Ga0157375_10060136 3300013308 Bacteria 3766
59 Ga0157380_10022488 3300014326 Bacteria 4749
60 Ga0163161_10047223 3300017792 Bacteria 3110
61 Ga0163161_10299191 3300017792 Bacteria 1267
62 Ga0209435_101572 3300025206 Bacteria 2824
63 Ga0207426_1028808 3300025302 Bacteria 1837
64 Ga0207655_1063485 3300025728 Bacteria 1414
65 Ga0207713_1010728 3300025735 Bacteria 5047
66 Ga0207680_10018080 3300025903 Bacteria 3739
67 Ga0207680_10114795 3300025903 Bacteria 1753
68 Ga0207647_10008093 3300025904 Bacteria 7555
69 Ga0207705_10000771 3300025909 Bacteria 26342
70 Ga0207705_10003122 3300025909 Bacteria 12620
71 Ga0207707_10004878 3300025912 Bacteria 11779
72 Ga0207695_10003326 3300025913 Bacteria 22789
73 Ga0207695_10644750 3300025913 Bacteria 940
74 Ga0207695_10670445 3300025913 Bacteria 918
75 Ga0207671_10222794 3300025914 Bacteria 1478
76 Ga0207671_10730557 3300025914 Bacteria 787
77 Ga0207660_10007110 3300025917 Bacteria 7249
78 Ga0207657_10008789 3300025919 Bacteria 10219
79 Ga0207649_10008653 3300025920 Bacteria 5557
80 Ga0207652_10008344 3300025921 Bacteria 8331
81 Ga0207694_10011767 3300025924 Bacteria 6601
82 Ga0207687_10064928 3300025927 Bacteria 2590
83 Ga0207686_10038059 3300025934 Bacteria 2908
84 Ga0207661_10029313 3300025944 Bacteria 4226
85 Ga0207667_10000347 3300025949 Bacteria 63149
86 Ga0207667_10008405 3300025949 Bacteria 12270
87 Ga0207667_10299279 3300025949 Bacteria 1643
88 Ga0207640_10001461 3300025981 Bacteria 12760
89 Ga0207658_10071214 3300025986 Bacteria 2632
90 Ga0207639_10471847 3300026041 Bacteria 1142
91 Ga0207678_10005430 3300026067 Bacteria 11416
92 Ga0207702_10000884 3300026078 Bacteria 31193
93 Ga0207702_10014963 3300026078 Bacteria 6436
94 Ga0207698_10006780 3300026142 Bacteria 7160
95 Ga0209969_1021483 3300027360 Bacteria 964
96 Ga0209981_1001733 3300027378 Bacteria 2760
97 Ga0210000_1002131 3300027462 Bacteria 2807
98 Ga0209995_1004712 3300027471 Bacteria 2189
99 Ga0209999_1003844 3300027543 Bacteria 2699
100 Ga0209813_10055077 3300027866 Bacteria 1255
101 Ga0265318_10136258 3300028577 Bacteria 902
102 Ga0307515_10077776 3300028794 Bacteria 4375
103 Ga0265338_10010430 3300028800 Bacteria 10896
104 Ga0265330_10000116 3300031235 Bacteria 64622
105 Ga0265328_10050350 3300031239 Bacteria 1529
106 Ga0265320_10078930 3300031240 Bacteria 1539
107 Ga0265320_10140092 3300031240 Bacteria 1096
108 Ga0265325_10005950 3300031241 Bacteria 7474
109 Ga0265340_10102215 3300031247 Bacteria 1331
110 Ga0265339_10031520 3300031249 Bacteria 2995
111 Ga0265316_10267197 3300031344 Bacteria 1253
112 Ga0307513_10510657 3300031456 Bacteria 918
113 Ga0307408_100000135 3300031548 Bacteria 81612
114 Ga0307408_100007521 3300031548 Bacteria 7202
115 Ga0265313_10085905 3300031595 Bacteria 1421
116 Ga0307508_10008386 3300031616 Bacteria 9551
117 Ga0265314_10001779 3300031711 Bacteria 23257
118 Ga0265314_10044003 3300031711 Bacteria 3169
119 Ga0265342_10007709 3300031712 Bacteria 7839
120 Ga0307411_10059998 3300032005 Bacteria 2524
121 Ga0373941_0038591 3300035115 Bacteria 1463
122 Ga0373931_0130548 3300035691 Bacteria 1446
123 Ga0373935_0636639 3300035692 Bacteria 782
124 Ga0395899_0000036 3300037312 Bacteria 289502
125 Ga0395899_0008226 3300037312 Bacteria 8034
126 Ga0395899_0028815 3300037312 Bacteria 4178
127 Ga0395900_0014305 3300037418 Bacteria 8099
128 Ga0395900_0015609 3300037418 Bacteria 7741
129 Ga0395900_0138119 3300037418 Bacteria 2497
130 Ga0395898_0000626 3300037466 Bacteria 64794
131 Ga0395898_0038905 3300037466 Bacteria 4710
132 Ga0395905_0027621 3300037471 Bacteria 5351
133 Ga0395901_0000231 3300038443 Bacteria 70033
134 Ga0395901_0252915 3300038443 Bacteria 1835
135 Ga0439453_0008582 3300041408 Bacteria 1644
136 Ga0451800_0954647 3300041459 Bacteria 891
137 Ga0466969_0008544 3300044656 Bacteria 5433
138 Ga0466972_0110517 3300044658 Bacteria 1299
139 Ga0466965_0006316 3300044683 Bacteria 5370
140 Ga0466965_0008415 3300044683 Bacteria 4774
141 Ga0466966_0002330 3300044684 Bacteria 12390
142 Ga0466966_0014892 3300044684 Bacteria 5145
143 Ga0466966_0027374 3300044684 Bacteria 3717
144 Ga0466966_0203649 3300044684 Bacteria 1197
145 Ga0466961_0068430 3300044693 Bacteria 2254
146 Ga0466963_0087639 3300044694 Bacteria 2117
147 Ga0466964_0015374 3300044706 Bacteria 2912
148 Ga0466971_0073925 3300044719 Bacteria 1549
149 Ga0466970_0021858 3300044765 Bacteria 3337
150 Ga0466970_0071668 3300044765 Bacteria 1864
151 Ga0466957_0000104 3300044842 Bacteria 34466
152 Ga0466957_0031369 3300044842 Bacteria 3176
153 Ga0466957_0038831 3300044842 Bacteria 2870
154 Ga0466957_0118809 3300044842 Bacteria 1684
155 Ga0466957_0172217 3300044842 Bacteria 1410
156 Ga0466959_0022585 3300045049 Bacteria 4652
157 Ga0466959_0031194 3300045049 Bacteria 3944
158 Ga0466958_0002037 3300045836 Bacteria 9979
159 Ga0466958_0003808 3300045836 Bacteria 7878
160 Ga0466967_0020517 3300045976 Bacteria 5345
161 Ga0466967_0181850 3300045976 Bacteria 1983
162 Ga0495592_0098456 3300046454 Bacteria 2087
163 Ga0495603_0014964 3300046455 Bacteria 4690
164 Ga0495590_0000045 3300046457 Bacteria 119667
165 Ga0495590_0001038 3300046457 Bacteria 12250
166 Ga0495590_0009082 3300046457 Bacteria 3776
167 Ga0495591_018223 3300046458 Bacteria 2385
168 Ga0495629_0000279 3300046459 Bacteria 44358
169 Ga0495629_0001915 3300046459 Bacteria 16215
170 Ga0495629_0052770 3300046459 Bacteria 2845
171 Ga0495629_0132697 3300046459 Bacteria 1735
172 Ga0495638_0021094 3300046460 Bacteria 4297
173 Ga0495638_0103019 3300046460 Bacteria 1704
174 Ga0495641_0105836 3300046461 Bacteria 1255
175 Ga0495651_0207564 3300046462 Bacteria 1366
176 Ga0495653_0017169 3300046463 Bacteria 5886
177 Ga0495653_0078246 3300046463 Bacteria 2453
178 Ga0495650_0004462 3300046471 Bacteria 9576
179 Ga0495650_0008576 3300046471 Bacteria 5938
180 Ga0495650_0044079 3300046471 Bacteria 1888
181 Ga0495650_0071545 3300046471 Bacteria 1360
182 Ga0495580_0000486 3300046472 Bacteria 33202
183 Ga0495580_0000715 3300046472 Bacteria 28331
184 Ga0495580_0013119 3300046472 Bacteria 6342
185 Ga0495582_0009257 3300046473 Bacteria 5433
186 Ga0495605_0001507 3300046474 Bacteria 15177
187 Ga0495605_0005264 3300046474 Bacteria 7550
188 Ga0495605_0005838 3300046474 Bacteria 7119
189 Ga0495605_0023302 3300046474 Bacteria 3258
190 Ga0495605_0052459 3300046474 Bacteria 1981
191 Ga0495605_0179440 3300046474 Bacteria 932
192 Ga0495639_0039264 3300046475 Bacteria 2128
193 Ga0495662_0196888 3300046476 Bacteria 993
194 Ga0495662_0294945 3300046476 Bacteria 798
195 Ga0495664_0024811 3300046477 Bacteria 3486
196 Ga0495664_0028676 3300046477 Bacteria 3251
197 Ga0495664_0065324 3300046477 Bacteria 2169
198 Ga0495664_0569791 3300046477 Bacteria 674
199 Ga0495584_0027190 3300046491 Bacteria 2899
200 Ga0495585_0000025 3300046492 Bacteria 148326
201 Ga0495585_0131257 3300046492 Bacteria 1318
202 Ga0495585_0203282 3300046492 Bacteria 1007
203 Ga0495594_0075139 3300046499 Bacteria 1883
204 Ga0495596_0051024 3300046500 Bacteria 1621
205 Ga0495607_0000194 3300046501 Bacteria 64377
206 Ga0495607_0044821 3300046501 Bacteria 2605
207 Ga0495607_0067458 3300046501 Bacteria 2010
208 Ga0495583_0000011 3300046506 Bacteria 350215
209 Ga0495583_0007099 3300046506 Bacteria 7156
210 Ga0495606_0010690 3300046507 Bacteria 7580
211 Ga0495606_0038128 3300046507 Bacteria 3254
212 Ga0495606_0041273 3300046507 Bacteria 3095
213 Ga0495616_0000780 3300046513 Bacteria 23278
214 Ga0495618_0043510 3300046514 Bacteria 2833
215 Ga0495620_0012217 3300046515 Bacteria 4447
216 Ga0495628_0004238 3300046516 Bacteria 12750
217 Ga0495628_0095620 3300046516 Bacteria 2295
218 Ga0495630_0003840 3300046517 Bacteria 10483
219 Ga0495630_0667999 3300046517 Bacteria 795
220 Ga0495631_0000058 3300046518 Bacteria 68730
221 Ga0495637_0030103 3300046520 Bacteria 2409
222 Ga0495643_0015897 3300046522 Bacteria 4432
223 Ga0495644_0027025 3300046523 Bacteria 2176
224 Ga0495644_0078562 3300046523 Bacteria 1243
225 Ga0495648_0003011 3300046524 Bacteria 15101
226 Ga0495648_0003904 3300046524 Bacteria 12922
227 Ga0495648_0010191 3300046524 Bacteria 7182
228 Ga0495648_0038708 3300046524 Bacteria 3044
229 Ga0495648_0077915 3300046524 Bacteria 1897
230 Ga0495666_0023332 3300046526 Bacteria 3059
231 Ga0495666_0048311 3300046526 Bacteria 2049
232 Ga0495642_0015900 3300046528 Bacteria 2930
233 Ga0495642_0018229 3300046528 Bacteria 2746
234 Ga0495642_0082020 3300046528 Bacteria 1359
235 Ga0495642_0166389 3300046528 Bacteria 957
236 Ga0495642_0216765 3300046528 Bacteria 835
237 Ga0495652_0063943 3300046529 Bacteria 3097
238 Ga0495652_0107793 3300046529 Bacteria 2247
239 Ga0495652_0116479 3300046529 Bacteria 2139
240 Ga0495654_0005965 3300046530 Bacteria 6999
241 Ga0495654_0044758 3300046530 Bacteria 2187
242 Ga0495654_0046783 3300046530 Bacteria 2129
243 Ga0495654_0098604 3300046530 Bacteria 1348
244 Ga0495665_0028333 3300046531 Bacteria 3003
245 Ga0495665_0069901 3300046531 Bacteria 1850
246 Ga0495665_0071443 3300046531 Bacteria 1828
247 Ga0495586_0099380 3300046535 Bacteria 1614
248 Ga0495587_0001570 3300046536 Bacteria 15194
249 Ga0495609_0000026 3300046538 Bacteria 251973
250 Ga0495609_0028431 3300046538 Bacteria 2551
251 Ga0495609_0059516 3300046538 Bacteria 1689
252 Ga0495597_0004404 3300046542 Bacteria 7750
253 Ga0495597_0010600 3300046542 Bacteria 4498
254 Ga0495597_0064674 3300046542 Bacteria 1588
255 Ga0495597_0072253 3300046542 Bacteria 1484
256 Ga0495645_0016057 3300046543 Bacteria 5338
257 Ga0495645_0028732 3300046543 Bacteria 4041
258 Ga0495645_0031034 3300046543 Bacteria 3892
259 Ga0495645_0051003 3300046543 Bacteria 3011
260 Ga0495633_0075720 3300046558 Bacteria 1567
261 Ga0495633_0175689 3300046558 Bacteria 986
262 Ga0495667_0060414 3300046559 Bacteria 2486
263 Ga0495668_0002225 3300046616 Bacteria 16462
264 Ga0495634_0001741 3300046642 Bacteria 18849
265 Ga0495611_0133433 3300046648 Bacteria 1159
266 Ga0495611_0254768 3300046648 Bacteria 813
267 Ga0495625_0011608 3300046660 Bacteria 7167
268 Ga0495625_0033576 3300046660 Bacteria 3793
269 Ga0495661_0000152 3300046665 Bacteria 81192
270 Ga0495661_0130673 3300046665 Bacteria 1376
271 Ga0495661_0209238 3300046665 Bacteria 1016
272 Ga0495588_0045736 3300046674 Bacteria 2245
273 Ga0495588_0106137 3300046674 Bacteria 1478
274 Ga0495588_0214372 3300046674 Bacteria 1016
275 Ga0495599_0053991 3300046678 Bacteria 2517
276 Ga0495623_0120917 3300046679 Bacteria 1576
277 Ga0495623_0368840 3300046679 Bacteria 778
278 Ga0495646_0001925 3300046680 Bacteria 12483
279 Ga0495646_0006019 3300046680 Bacteria 7689
280 Ga0495658_0448727 3300046683 Bacteria 824
281 Ga0495669_0011499 3300046684 Bacteria 3759
282 Ga0495669_0044855 3300046684 Bacteria 1970
283 Ga0495669_0091306 3300046684 Bacteria 1406
284 Ga0495613_0011281 3300046689 Bacteria 6637
285 Ga0495624_0009382 3300046690 Bacteria 6778
286 Ga0495624_0015720 3300046690 Bacteria 5103
287 Ga0495670_0000930 3300046691 Bacteria 14148
288 Ga0495670_0010898 3300046691 Bacteria 4467
289 Ga0495670_0028172 3300046691 Bacteria 2784
290 Ga0495670_0040683 3300046691 Bacteria 2318
291 Ga0495671_0007637 3300046692 Bacteria 6142
292 Ga0495671_0029078 3300046692 Bacteria 2841
293 Ga0495671_0084927 3300046692 Bacteria 1551
294 Ga0495671_0100890 3300046692 Bacteria 1411
295 Ga0495649_0001524 3300046694 Bacteria 17409
296 Ga0495649_0038597 3300046694 Bacteria 2620
297 Ga0495649_0108134 3300046694 Bacteria 1475
298 Ga0495589_0000101 3300046794 Bacteria 82583
299 Ga0495589_0001663 3300046794 Bacteria 12737
300 Ga0495589_0006461 3300046794 Bacteria 6180
301 Ga0495589_0034446 3300046794 Bacteria 2542
302 Ga0495589_0106374 3300046794 Bacteria 1355
303 Ga0495600_0070796 3300046809 Bacteria 2279
304 Ga0495600_0270867 3300046809 Bacteria 1077
305 Ga0495660_0008945 3300046810 Bacteria 5850
306 Ga0495604_0060255 3300047317 Bacteria 2907
307 Ga0495674_0032145 3300047319 Bacteria 4762
308 Ga0495672_0012479 3300047320 Bacteria 5926
309 Ga0495676_0004364 3300047321 Bacteria 12921
310 Ga0495676_0023111 3300047321 Bacteria 5400
311 Ga0495676_0089166 3300047321 Bacteria 2311
312 Ga0495680_0013894 3300047322 Bacteria 7005
313 Ga0495680_0062915 3300047322 Bacteria 2851
314 Ga0495683_0001030 3300047323 Bacteria 19383
315 Ga0495683_0052876 3300047323 Bacteria 2027
316 Ga0495683_0076524 3300047323 Bacteria 1637
317 Ga0495683_0179863 3300047323 Bacteria 966
318 Ga0495683_0191552 3300047323 Bacteria 927
319 Ga0495687_000037 3300047443 Bacteria 252363
320 Ga0495687_000121 3300047443 Bacteria 120336
321 Ga0495687_032102 3300047443 Bacteria 2402
322 Ga0495687_065145 3300047443 Bacteria 1484
323 Ga0495687_074074 3300047443 Bacteria 1355
324 Ga0495675_0017821 3300047444 Bacteria 4503
325 Ga0495675_0117082 3300047444 Bacteria 1661
326 Ga0495675_0152296 3300047444 Bacteria 1428
327 Ga0495677_0000014 3300047445 Bacteria 136236
328 Ga0495679_000036 3300047446 Bacteria 161473
329 Ga0495679_003946 3300047446 Bacteria 6993
330 Ga0495679_004839 3300047446 Bacteria 6086
331 Ga0495685_035007 3300047447 Bacteria 1725
332 Ga0495685_098132 3300047447 Bacteria 968
333 Ga0495684_0160917 3300047471 Bacteria 1674
334 Ga0495686_0003825 3300047472 Bacteria 12758
335 Ga0495593_0046863 3300047673 Bacteria 2302
336 Ga0495593_0057711 3300047673 Bacteria 2038
337 Ga0495602_0007225 3300048088 Bacteria 11635
338 Ga0495602_0019422 3300048088 Bacteria 6748
339 Ga0495602_0050024 3300048088 Bacteria 3738
340 Ga0495602_0060313 3300048088 Bacteria 3306
341 Ga0495602_0197204 3300048088 Bacteria 1539
342 Ga0495614_0017418 3300048089 Bacteria 3121
343 Ga0495614_0079260 3300048089 Bacteria 1422
344 Ga0495626_0000289 3300048091 Bacteria 54458
345 Ga0495626_0008918 3300048091 Bacteria 5445
346 Ga0495626_0107409 3300048091 Bacteria 1211
347 Ga0495626_0148124 3300048091 Bacteria 991
348 Ga0496100_0007189 3300048903 Bacteria 6120
349 Ga0496100_0024220 3300048903 Bacteria 3699
350 Ga0496100_0041379 3300048903 Bacteria 2937
351 Ga0496100_0156721 3300048903 Bacteria 1629
352 Ga0496101_0000497 3300048904 Bacteria 24723
353 Ga0496101_0023521 3300048904 Bacteria 4258
354 Ga0496101_0225242 3300048904 Bacteria 1456
355 Ga0496101_0396765 3300048904 Bacteria 1086
356 Ga0496102_0000500 3300048905 Bacteria 43047
357 Ga0496102_0004712 3300048905 Bacteria 11543
358 Ga0496102_0067540 3300048905 Bacteria 3280
359 Ga0496103_0031868 3300048906 Bacteria 3215
360 Ga0496103_0082394 3300048906 Bacteria 2025
361 Ga0496103_0320725 3300048906 Bacteria 996
362 Ga0496104_0019705 3300048907 Bacteria 6176
363 Ga0496104_0107109 3300048907 Plasmid 2679
364 Ga0496104_0111263 3300048907 Bacteria 2626
365 Ga0496104_0211617 3300048907 Bacteria 1850
366 Ga0496105_0020872 3300048908 Bacteria 5297
367 Ga0496105_0134284 3300048908 Bacteria 2039
368 Ga0496106_0585186 3300048909 Bacteria 894
369 Ga0496107_0062275 3300048910 Bacteria 2702
370 Ga0496107_0129602 3300048910 Bacteria 1862
371 Ga0496107_0176297 3300048910 Bacteria 1587
372 Ga0496110_0047749 3300048913 Bacteria 3750
373 Ga0496110_0370159 3300048913 Bacteria 1306
374 Ga0496110_0565989 3300048913 Bacteria 1032
375 Ga0496112_0210017 3300048915 Bacteria 1904
376 Ga0496114_0000027 3300048917 Bacteria 182506
377 Ga0496114_0050682 3300048917 Bacteria 3455
378 Ga0496115_0009709 3300048918 Bacteria 7166
379 Ga0496116_0005332 3300048919 Bacteria 11983
380 Ga0496117_0056623 3300048920 Bacteria 2729
381 Ga0496118_0043501 3300048921 Bacteria 3529
382 Ga0496118_0081038 3300048921 Bacteria 2281
383 Ga0496119_0150824 3300048922 Bacteria 1246
384 Ga0496121_0001232 3300048924 Bacteria 44479
385 Ga0496121_0011954 3300048924 Bacteria 9551
386 Ga0496121_0025660 3300048924 Bacteria 5585
387 Ga0496121_0112836 3300048924 Bacteria 2070
388 Ga0496121_0129679 3300048924 Bacteria 1890
389 Ga0496122_0007863 3300048925 Bacteria 11713
390 Ga0496122_0010236 3300048925 Bacteria 9715
391 Ga0496123_0010264 3300048926 Bacteria 8307
392 Ga0496123_0016937 3300048926 Bacteria 5888
393 Ga0496124_0027775 3300048927 Bacteria 5071
394 Ga0496124_0096103 3300048927 Bacteria 2407
395 Ga0496124_0111057 3300048927 Bacteria 2206
396 Ga0496125_0091788 3300048928 Bacteria 2273
397 Ga0496126_0000452 3300048929 Bacteria 81928
398 Ga0496126_0001027 3300048929 Bacteria 47410
399 Ga0496126_0014323 3300048929 Bacteria 8019
400 Ga0496126_0406438 3300048929 Bacteria 1103
401 Ga0495678_000045 3300049459 Bacteria 171880
402 Ga0495678_021522 3300049459 Bacteria 2838
403 Ga0495682_0062172 3300049460 Bacteria 1347
404 Ga0495682_0062197 3300049460 Bacteria 1347
405 Ga0501047_0151856 3300049581 Bacteria 2192
406 Ga0501047_0301953 3300049581 Bacteria 1443
407 Ga0501067_0098928 3300049583 Bacteria 1620
408 Ga0501070_0116810 3300049586 Bacteria 2203
409 Ga0501070_0129790 3300049586 Bacteria 2082
410 Ga0501070_0201646 3300049586 Bacteria 1634
411 Ga0501073_0203513 3300049589 Bacteria 1369
412 Ga0501074_0047029 3300049590 Bacteria 3119
413 Ga0501080_0006456 3300049742 Bacteria 10533
414 Ga0501035_0019827 3300049822 Bacteria 6178
415 Ga0501044_0025204 3300049823 Bacteria 6306
416 nmdc:mga0qj67_153435_c1 3300050509 Bacteria 1869
417 nmdc:mga06r32_363584_c1 3300050510 Bacteria 1431
418 nmdc:mga08x19_300_c1 3300050514 Bacteria 36425
419 Ga0500593_000069 3300053117 Bacteria 38110
420 Ga0500622_0170629 3300053156 Bacteria 1013
421 Ga0501084_0128275 3300054114 Bacteria 2135
422 Ga0466962_0065199 3300061719 Bacteria 1739
423 Ga0466962_0199526 3300061719 Bacteria 977
424 2921649280 2921643360 Bacteria 11448031
425 2501075806 2501025501 Bacteria 7768574
426 2501411291 2501025504 Bacteria 8008976
427 2511100067 2510917014 Bacteria 8296963
428 2511104046 2510917015 Bacteria 7950052
429 2512353240 2512047030 Bacteria 9031815
430 2515691535 2515154123 Bacteria 6387382
431 2691332032 2690315857 Bacteria 4396207
432 2792834199 2791355137 Bacteria 9654227
433 2842325330 2842324504 Bacteria 9364110
434 2842349609 2842348783 Bacteria 9002918
435 2842455153 2842454564 Bacteria 8730687
436 2883088994 2883087390 Bacteria 9532701
437 2885278885 2885270888 Bacteria 9831543
438 JGI24740J21852_10000633
439 JGI24735J21928_10000817
440 Ga0055531_10012950
441 Ga0070658_10011049
442 Ga0070658_10016024
443 Ga0070683_100052842
444 Ga0070680_100003931
445 Ga0070660_100009107
446 Ga0070660_100051434
447 Ga0070691_10002838
448 Ga0070661_100009037
449 Ga0070692_10086900
450 Ga0070667_100090596
451 Ga0070667_100120627
452 Ga0070713_100054165
453 Ga0070663_100005099
454 Ga0070663_100074454
455 Ga0070681_10012389
456 Ga0070679_100017908
457 Ga0068853_100386418
458 Ga0070686_100141192
459 Ga0068855_100001711
460 Ga0068855_100004438
461 Ga0068855_100013586
462 Ga0068854_100006091
463 Ga0068856_100008998
464 Ga0068856_100020405
465 Ga0068852_100007571
466 Ga0068858_100090801
467 Ga0075430_100145948
468 Ga0075434_100092920
469 Ga0075434_100612358
470 Ga0075436_100001060
471 Ga0105251_10006973
472 Ga0105251_10068682
473 Ga0105244_10036443
474 Ga0105244_10089538
475 Ga0105240_10030599
476 Ga0105240_10041247
477 Ga0105240_10177385
478 Ga0105240_11326701
479 Ga0105245_10048604
480 Ga0114129_10289508
481 Ga0105248_10050371
482 Ga0105248_10320146
483 Ga0105237_10061510
484 Ga0105238_10019402
485 Ga0105238_10593706
486 Ga0105246_10360154
487 Ga0157371_10005418
488 Ga0157370_10008669
489 Ga0157369_10008185
490 Ga0157374_10375959
491 Ga0163162_10000197
492 Ga0163162_10190756
493 Ga0157372_10008542
494 Ga0157375_10011265
495 Ga0157375_10060136
496 Ga0157380_10022488
497 Ga0163161_10047223
498 Ga0163161_10299191
499 Ga0209435_101572
500 Ga0207426_1028808
501 Ga0207655_1063485
502 Ga0207713_1010728
503 Ga0207680_10018080
504 Ga0207680_10114795
505 Ga0207647_10008093
506 Ga0207705_10000771
507 Ga0207705_10003122
508 Ga0207707_10004878
509 Ga0207695_10003326
510 Ga0207695_10644750
511 Ga0207695_10670445
512 Ga0207671_10222794
513 Ga0207671_10730557
514 Ga0207660_10007110
515 Ga0207657_10008789
516 Ga0207649_10008653
517 Ga0207652_10008344
518 Ga0207694_10011767
519 Ga0207687_10064928
520 Ga0207686_10038059
521 Ga0207661_10029313
522 Ga0207667_10000347
523 Ga0207667_10008405
524 Ga0207667_10299279
525 Ga0207640_10001461
526 Ga0207658_10071214
527 Ga0207639_10471847
528 Ga0207678_10005430
529 Ga0207702_10000884
530 Ga0207702_10014963
531 Ga0207698_10006780
532 Ga0209969_1021483
533 Ga0209981_1001733
534 Ga0210000_1002131
535 Ga0209995_1004712
536 Ga0209999_1003844
537 Ga0209813_10055077
538 Ga0265318_10136258
539 Ga0307515_10077776
540 Ga0265338_10010430
541 Ga0265330_10000116
542 Ga0265328_10050350
543 Ga0265320_10078930
544 Ga0265320_10140092
545 Ga0265325_10005950
546 Ga0265340_10102215
547 Ga0265339_10031520
548 Ga0265316_10267197
549 Ga0307513_10510657
550 Ga0307408_100000135
551 Ga0307408_100007521
552 Ga0265313_10085905
553 Ga0307508_10008386
554 Ga0265314_10001779
555 Ga0265314_10044003
556 Ga0265342_10007709
557 Ga0307411_10059998
558 Ga0373941_0038591
559 Ga0373931_0130548
560 Ga0373935_0636639
561 Ga0395899_0000036
562 Ga0395899_0008226
563 Ga0395899_0028815
564 Ga0395900_0014305
565 Ga0395900_0015609
566 Ga0395900_0138119
567 Ga0395898_0000626
568 Ga0395898_0038905
569 Ga0395905_0027621
570 Ga0395901_0000231
571 Ga0395901_0252915
572 Ga0439453_0008582
573 Ga0451800_0954647
574 Ga0466969_0008544
575 Ga0466972_0110517
576 Ga0466965_0006316
577 Ga0466965_0008415
578 Ga0466966_0002330
579 Ga0466966_0014892
580 Ga0466966_0027374
581 Ga0466966_0203649
582 Ga0466961_0068430
583 Ga0466963_0087639
584 Ga0466964_0015374
585 Ga0466971_0073925
586 Ga0466970_0021858
587 Ga0466970_0071668
588 Ga0466957_0000104
589 Ga0466957_0031369
590 Ga0466957_0038831
591 Ga0466957_0118809
592 Ga0466957_0172217
593 Ga0466959_0022585
594 Ga0466959_0031194
595 Ga0466958_0002037
596 Ga0466958_0003808
597 Ga0466967_0020517
598 Ga0466967_0181850
599 Ga0495592_0098456
600 Ga0495603_0014964
601 Ga0495590_0000045
602 Ga0495590_0001038
603 Ga0495590_0009082
604 Ga0495591_018223
605 Ga0495629_0000279
606 Ga0495629_0001915
607 Ga0495629_0052770
608 Ga0495629_0132697
609 Ga0495638_0021094
610 Ga0495638_0103019
611 Ga0495641_0105836
612 Ga0495651_0207564
613 Ga0495653_0017169
614 Ga0495653_0078246
615 Ga0495650_0004462
616 Ga0495650_0008576
617 Ga0495650_0044079
618 Ga0495650_0071545
619 Ga0495580_0000486
620 Ga0495580_0000715
621 Ga0495580_0013119
622 Ga0495582_0009257
623 Ga0495605_0001507
624 Ga0495605_0005264
625 Ga0495605_0005838
626 Ga0495605_0023302
627 Ga0495605_0052459
628 Ga0495605_0179440
629 Ga0495639_0039264
630 Ga0495662_0196888
631 Ga0495662_0294945
632 Ga0495664_0024811
633 Ga0495664_0028676
634 Ga0495664_0065324
635 Ga0495664_0569791
636 Ga0495584_0027190
637 Ga0495585_0000025
638 Ga0495585_0131257
639 Ga0495585_0203282
640 Ga0495594_0075139
641 Ga0495596_0051024
642 Ga0495607_0000194
643 Ga0495607_0044821
644 Ga0495607_0067458
645 Ga0495583_0000011
646 Ga0495583_0007099
647 Ga0495606_0010690
648 Ga0495606_0038128
649 Ga0495606_0041273
650 Ga0495616_0000780
651 Ga0495618_0043510
652 Ga0495620_0012217
653 Ga0495628_0004238
654 Ga0495628_0095620
655 Ga0495630_0003840
656 Ga0495630_0667999
657 Ga0495631_0000058
658 Ga0495637_0030103
659 Ga0495643_0015897
660 Ga0495644_0027025
661 Ga0495644_0078562
662 Ga0495648_0003011
663 Ga0495648_0003904
664 Ga0495648_0010191
665 Ga0495648_0038708
666 Ga0495648_0077915
667 Ga0495666_0023332
668 Ga0495666_0048311
669 Ga0495642_0015900
670 Ga0495642_0018229
671 Ga0495642_0082020
672 Ga0495642_0166389
673 Ga0495642_0216765
674 Ga0495652_0063943
675 Ga0495652_0107793
676 Ga0495652_0116479
677 Ga0495654_0005965
678 Ga0495654_0044758
679 Ga0495654_0046783
680 Ga0495654_0098604
681 Ga0495665_0028333
682 Ga0495665_0069901
683 Ga0495665_0071443
684 Ga0495586_0099380
685 Ga0495587_0001570
686 Ga0495609_0000026
687 Ga0495609_0028431
688 Ga0495609_0059516
689 Ga0495597_0004404
690 Ga0495597_0010600
691 Ga0495597_0064674
692 Ga0495597_0072253
693 Ga0495645_0016057
694 Ga0495645_0028732
695 Ga0495645_0031034
696 Ga0495645_0051003
697 Ga0495633_0075720
698 Ga0495633_0175689
699 Ga0495667_0060414
700 Ga0495668_0002225
701 Ga0495634_0001741
702 Ga0495611_0133433
703 Ga0495611_0254768
704 Ga0495625_0011608
705 Ga0495625_0033576
706 Ga0495661_0000152
707 Ga0495661_0130673
708 Ga0495661_0209238
709 Ga0495588_0045736
710 Ga0495588_0106137
711 Ga0495588_0214372
712 Ga0495599_0053991
713 Ga0495623_0120917
714 Ga0495623_0368840
715 Ga0495646_0001925
716 Ga0495646_0006019
717 Ga0495658_0448727
718 Ga0495669_0011499
719 Ga0495669_0044855
720 Ga0495669_0091306
721 Ga0495613_0011281
722 Ga0495624_0009382
723 Ga0495624_0015720
724 Ga0495670_0000930
725 Ga0495670_0010898
726 Ga0495670_0028172
727 Ga0495670_0040683
728 Ga0495671_0007637
729 Ga0495671_0029078
730 Ga0495671_0084927
731 Ga0495671_0100890
732 Ga0495649_0001524
733 Ga0495649_0038597
734 Ga0495649_0108134
735 Ga0495589_0000101
736 Ga0495589_0001663
737 Ga0495589_0006461
738 Ga0495589_0034446
739 Ga0495589_0106374
740 Ga0495600_0070796
741 Ga0495600_0270867
742 Ga0495660_0008945
743 Ga0495604_0060255
744 Ga0495674_0032145
745 Ga0495672_0012479
746 Ga0495676_0004364
747 Ga0495676_0023111
748 Ga0495676_0089166
749 Ga0495680_0013894
750 Ga0495680_0062915
751 Ga0495683_0001030
752 Ga0495683_0052876
753 Ga0495683_0076524
754 Ga0495683_0179863
755 Ga0495683_0191552
756 Ga0495687_000037
757 Ga0495687_000121
758 Ga0495687_032102
759 Ga0495687_065145
760 Ga0495687_074074
761 Ga0495675_0017821
762 Ga0495675_0117082
763 Ga0495675_0152296
764 Ga0495677_0000014
765 Ga0495679_000036
766 Ga0495679_003946
767 Ga0495679_004839
768 Ga0495685_035007
769 Ga0495685_098132
770 Ga0495684_0160917
771 Ga0495686_0003825
772 Ga0495593_0046863
773 Ga0495593_0057711
774 Ga0495602_0007225
775 Ga0495602_0019422
776 Ga0495602_0050024
777 Ga0495602_0060313
778 Ga0495602_0197204
779 Ga0495614_0017418
780 Ga0495614_0079260
781 Ga0495626_0000289
782 Ga0495626_0008918
783 Ga0495626_0107409
784 Ga0495626_0148124
785 Ga0496100_0007189
786 Ga0496100_0024220
787 Ga0496100_0041379
788 Ga0496100_0156721
789 Ga0496101_0000497
790 Ga0496101_0023521
791 Ga0496101_0225242
792 Ga0496101_0396765
793 Ga0496102_0000500
794 Ga0496102_0004712
795 Ga0496102_0067540
796 Ga0496103_0031868
797 Ga0496103_0082394
798 Ga0496103_0320725
799 Ga0496104_0019705
800 Ga0496104_0107109
801 Ga0496104_0111263
802 Ga0496104_0211617
803 Ga0496105_0020872
804 Ga0496105_0134284
805 Ga0496106_0585186
806 Ga0496107_0062275
807 Ga0496107_0129602
808 Ga0496107_0176297
809 Ga0496110_0047749
810 Ga0496110_0370159
811 Ga0496110_0565989
812 Ga0496112_0210017
813 Ga0496114_0000027
814 Ga0496114_0050682
815 Ga0496115_0009709
816 Ga0496116_0005332
817 Ga0496117_0056623
818 Ga0496118_0043501
819 Ga0496118_0081038
820 Ga0496119_0150824
821 Ga0496121_0001232
822 Ga0496121_0011954
823 Ga0496121_0025660
824 Ga0496121_0112836
825 Ga0496121_0129679
826 Ga0496122_0007863
827 Ga0496122_0010236
828 Ga0496123_0010264
829 Ga0496123_0016937
830 Ga0496124_0027775
831 Ga0496124_0096103
832 Ga0496124_0111057
833 Ga0496125_0091788
834 Ga0496126_0000452
835 Ga0496126_0001027
836 Ga0496126_0014323
837 Ga0496126_0406438
838 Ga0495678_000045
839 Ga0495678_021522
840 Ga0495682_0062172
841 Ga0495682_0062197
842 Ga0501047_0151856
843 Ga0501047_0301953
844 Ga0501067_0098928
845 Ga0501070_0116810
846 Ga0501070_0129790
847 Ga0501070_0201646
848 Ga0501073_0203513
849 Ga0501074_0047029
850 Ga0501080_0006456
851 Ga0501035_0019827
852 Ga0501044_0025204
853 nmdc:mga0qj67_153435_c1
854 nmdc:mga06r32_363584_c1
855 nmdc:mga08x19_300_c1
856 Ga0500593_000069
857 Ga0500622_0170629
858 Ga0501084_0128275
859 Ga0466962_0065199
860 Ga0466962_0199526
861 2921649280
862 2501075806
863 2501411291
864 2511100067
865 2511104046
866 2512353240
867 2515691535
868 2691332032
869 2792834199
870 2842325330
871 2842349609
872 2842455153
873 2883088994
874 2885278885

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

148

224

0.99

PF00072

Response_reg

Response regulator receiver domain

4

113

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9926 5 120
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9906 3 122
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.99 5 120
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9899 5 120
1zh4-assembly1.cif.gz_A crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe 0.9896 3 122
ID Description Score Start End Superfamily
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.997 3 82 3.40.50.2300
af_Q2FWH6_1_124_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9877 3 121 3.40.50.2300
1nxoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9861 5 121 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9847 3 82 3.40.50.2300
4kfcB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9814 132 227 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4U9U763-F1-model_v4 KDP operon transcriptional regulatory protein KdpE 0.9972 1 125 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A3N5S2B6-F1-model_v4 DNA-binding response regulator 0.9622 1 229 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1F8NR57-F1-model_v4 DNA-binding response regulator 0.9605 5 228 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2V6QXS8-F1-model_v4 Two-component system response regulator KdpE 0.9604 1 227 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A6I6SM25-F1-model_v4 Response regulator transcription factor 0.9596 3 228 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map