F443751

General Info

Members Datasets Scaffolds Average Seq Length
437 230 874 154

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10812114|Ga0111539_108121142
Length 181
Sequence MMVVLRRIRRRRASRFREPGLPGEPDAMPTAEKPAFTRKQLIDALNEDLAREYQAIIAYVVYSQTLKGAAYMAIAKELELHAAQELAHALTVAKHIDYLGGSPTVTALPVKETDDAKQMLRADLTNENNTIRAYRERVAQCERLGEYAIAEDIREILRQEQEHQSDLATALGEDVPDVSAK

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
94 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
156 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
160 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.03
Metatranscriptomes 2.97
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 3.66
Rhizosphere 95.42
Stem 0
Stem Tuber 0
Unclassified 31.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10812114 3300009094 Unclassified 1088
2 JGI25406J46586_10023385 3300003203 Unclassified 2442
3 JGI25406J46586_10034328 3300003203 Archaea 1863
4 Ga0058861_11773142 3300004800 Unclassified 748
5 Ga0058861_11984659 3300004800 Bacteria 1145
6 Ga0058862_12815021 3300004803 Bacteria 940
7 Ga0065704_10293843 3300005289 Unclassified 898
8 Ga0065712_10076720 3300005290 Bacteria 3613
9 Ga0065712_10483195 3300005290 Unclassified 661
10 Ga0065715_10108898 3300005293 Bacteria 2696
11 Ga0065715_10163408 3300005293 Unclassified 1608
12 Ga0065715_10220853 3300005293 Unclassified 1269
13 Ga0065707_10124895 3300005295 Bacteria 2035
14 Ga0065707_10260922 3300005295 Bacteria 1097
15 Ga0065707_10337051 3300005295 Bacteria 940
16 Ga0065707_10975517 3300005295 Unclassified 545
17 Ga0070658_10151143 3300005327 Unclassified 1944
18 Ga0070676_10015917 3300005328 Bacteria 4150
19 Ga0070676_10130076 3300005328 Bacteria 1591
20 Ga0070676_10158440 3300005328 Bacteria 1455
21 Ga0070683_100544909 3300005329 Bacteria 1109
22 Ga0070690_100099897 3300005330 Unclassified 1923
23 Ga0070670_100005156 3300005331 Bacteria 10994
24 Ga0070670_100313746 3300005331 Bacteria 1373
25 Ga0070677_10323427 3300005333 Bacteria 791
26 Ga0068869_100014514 3300005334 Bacteria 5264
27 Ga0070680_100590554 3300005336 Bacteria 953
28 Ga0068868_100104079 3300005338 Bacteria 2300
29 Ga0070660_100016864 3300005339 Bacteria 5312
30 Ga0070689_100046684 3300005340 Bacteria 3338
31 Ga0070689_100814180 3300005340 Unclassified 822
32 Ga0070691_10449743 3300005341 Unclassified 735
33 Ga0070661_100157808 3300005344 Bacteria 1717
34 Ga0070661_100376691 3300005344 Unclassified 1118
35 Ga0070692_10647615 3300005345 Bacteria 705
36 Ga0070669_100012947 3300005353 Bacteria 5924
37 Ga0070675_100045494 3300005354 Unclassified 3591
38 Ga0070675_100145132 3300005354 Bacteria 2031
39 Ga0070675_100331999 3300005354 Bacteria 1345
40 Ga0070675_100817853 3300005354 Unclassified 852
41 Ga0070674_100575112 3300005356 Bacteria 949
42 Ga0070674_100971705 3300005356 Bacteria 744
43 Ga0070673_100022404 3300005364 Bacteria 4597
44 Ga0070673_100239643 3300005364 Bacteria 1576
45 Ga0070673_100594346 3300005364 Bacteria 1009
46 Ga0070673_100702105 3300005364 Bacteria 929
47 Ga0070688_100052104 3300005365 Bacteria 2555
48 Ga0070688_100481518 3300005365 Unclassified 933
49 Ga0070659_100324872 3300005366 Bacteria 1287
50 Ga0070667_100083663 3300005367 Bacteria 2734
51 Ga0070701_10147824 3300005438 Bacteria 1350
52 Ga0070708_101128418 3300005445 Bacteria 734
53 Ga0070663_100016567 3300005455 Bacteria 4792
54 Ga0070678_101225328 3300005456 Bacteria 696
55 Ga0070662_100386802 3300005457 Bacteria 1152
56 Ga0070662_100645028 3300005457 Bacteria 893
57 Ga0070681_10001110 3300005458 Bacteria 23029
58 Ga0070681_10089941 3300005458 Bacteria 3021
59 Ga0070681_10785781 3300005458 Bacteria 869
60 Ga0068867_100033402 3300005459 Unclassified 3726
61 Ga0068867_100041366 3300005459 Bacteria 3368
62 Ga0068867_100089180 3300005459 Bacteria 2338
63 Ga0068867_100489867 3300005459 Bacteria 1055
64 Ga0068867_101360947 3300005459 Unclassified 657
65 Ga0070685_10983851 3300005466 Unclassified 632
66 Ga0070706_100716413 3300005467 Unclassified 928
67 Ga0070698_100334375 3300005471 Unclassified 1446
68 Ga0070699_100116906 3300005518 Unclassified 2344
69 Ga0070679_100200544 3300005530 Bacteria 1962
70 Ga0070679_100339485 3300005530 Unclassified 1450
71 Ga0070679_101529798 3300005530 Unclassified 614
72 Ga0068853_100389817 3300005539 Unclassified 1302
73 Ga0070672_100135172 3300005543 Bacteria 2030
74 Ga0070672_100296349 3300005543 Unclassified 1370
75 Ga0070672_100682367 3300005543 Bacteria 899
76 Ga0070686_101168169 3300005544 Unclassified 638
77 Ga0070696_100172909 3300005546 Unclassified 1598
78 Ga0070696_100864540 3300005546 Unclassified 748
79 Ga0070665_100114227 3300005548 Bacteria 2703
80 Ga0070665_100116830 3300005548 Unclassified 2670
81 Ga0068855_100005452 3300005563 Bacteria 15511
82 Ga0070664_100005017 3300005564 Bacteria 10609
83 Ga0070664_100603313 3300005564 Bacteria 1018
84 Ga0070664_101706042 3300005564 Unclassified 597
85 Ga0070664_101864553 3300005564 Unclassified 570
86 Ga0068857_100289510 3300005577 Bacteria 1508
87 Ga0068857_101616220 3300005577 Unclassified 633
88 Ga0068852_101075412 3300005616 Bacteria 824
89 Ga0068859_100105115 3300005617 Bacteria 2883
90 Ga0068859_101232871 3300005617 Bacteria 824
91 Ga0068859_101336311 3300005617 Bacteria 790
92 Ga0068859_101877228 3300005617 Bacteria 662
93 Ga0068864_100251848 3300005618 Unclassified 1640
94 Ga0068864_100364776 3300005618 Bacteria 1366
95 Ga0068861_100060984 3300005719 Bacteria 2893
96 Ga0068861_100073794 3300005719 Bacteria 2651
97 Ga0068861_100210397 3300005719 Unclassified 1638
98 Ga0068861_100335379 3300005719 Bacteria 1322
99 Ga0068851_10571459 3300005834 Bacteria 685
100 Ga0068870_10353879 3300005840 Bacteria 943
101 Ga0068863_100126162 3300005841 Bacteria 2442
102 Ga0068863_100323648 3300005841 Bacteria 1498
103 Ga0068863_100716461 3300005841 Bacteria 995
104 Ga0068863_101448304 3300005841 Unclassified 695
105 Ga0068858_100003770 3300005842 Bacteria 14981
106 Ga0068858_100477427 3300005842 Bacteria 1203
107 Ga0068858_100636431 3300005842 Unclassified 1036
108 Ga0068858_100913511 3300005842 Unclassified 859
109 Ga0068858_101141064 3300005842 Bacteria 765
110 Ga0068860_100072811 3300005843 Bacteria 3266
111 Ga0068860_100143085 3300005843 Bacteria 2299
112 Ga0068860_100326302 3300005843 Bacteria 1507
113 Ga0068860_100669667 3300005843 Bacteria 1046
114 Ga0068860_100947303 3300005843 Unclassified 878
115 Ga0068860_101807807 3300005843 Unclassified 633
116 Ga0068862_100021075 3300005844 Bacteria 5448
117 Ga0068862_100065074 3300005844 Bacteria 3140
118 Ga0068862_100232294 3300005844 Unclassified 1674
119 Ga0068862_100731005 3300005844 Bacteria 961
120 Ga0081455_10635884 3300005937 Bacteria 690
121 Ga0081539_10003605 3300005985 Bacteria 18729
122 Ga0081539_10004285 3300005985 Bacteria 16000
123 Ga0070715_10513858 3300006163 Bacteria 688
124 Ga0070712_100113290 3300006175 Unclassified 2028
125 Ga0097621_100205651 3300006237 Unclassified 1710
126 Ga0097621_100283376 3300006237 Bacteria 1459
127 Ga0068871_100085242 3300006358 Unclassified 2623
128 Ga0068871_100134976 3300006358 Bacteria 2095
129 Ga0068871_100544404 3300006358 Unclassified 1051
130 Ga0068871_100555637 3300006358 Bacteria 1040
131 Ga0068871_100648624 3300006358 Unclassified 964
132 Ga0075433_10447994 3300006852 Unclassified 1138
133 Ga0075434_100103471 3300006871 Unclassified 2856
134 Ga0068865_100037901 3300006881 Unclassified 3259
135 Ga0068865_100038388 3300006881 Bacteria 3242
136 Ga0068865_100082027 3300006881 Bacteria 2317
137 Ga0068865_100107033 3300006881 Unclassified 2056
138 Ga0068865_100702890 3300006881 Bacteria 864
139 Ga0068865_101221631 3300006881 Bacteria 666
140 Ga0097620_100105116 3300006931 Bacteria 2883
141 Ga0097620_101232416 3300006931 Bacteria 824
142 Ga0097620_101336069 3300006931 Bacteria 790
143 Ga0097620_101877334 3300006931 Bacteria 662
144 Ga0075435_100296979 3300007076 Bacteria 1381
145 Ga0105240_10078197 3300009093 Unclassified 4074
146 Ga0111539_10070688 3300009094 Bacteria 4120
147 Ga0111539_10075161 3300009094 Unclassified 3981
148 Ga0111539_10095150 3300009094 Unclassified 3499
149 Ga0111539_10222324 3300009094 Bacteria 2199
150 Ga0111539_10295489 3300009094 Bacteria 1885
151 Ga0111539_10319029 3300009094 Unclassified 1808
152 Ga0111539_10378611 3300009094 Bacteria 1648
153 Ga0105245_10243339 3300009098 Bacteria 1745
154 Ga0105245_10619652 3300009098 Bacteria 1110
155 Ga0105245_10915017 3300009098 Bacteria 919
156 Ga0105245_11352570 3300009098 Unclassified 762
157 Ga0105247_10331065 3300009101 Bacteria 1065
158 Ga0105243_10128517 3300009148 Bacteria 2147
159 Ga0105243_11070240 3300009148 Bacteria 813
160 Ga0105242_10007230 3300009176 Bacteria 8559
161 Ga0105242_10020397 3300009176 Bacteria 5197
162 Ga0105242_10023737 3300009176 Unclassified 4836
163 Ga0105248_10017596 3300009177 Bacteria 7884
164 Ga0105248_10028994 3300009177 Bacteria 6170
165 Ga0105248_10117745 3300009177 Unclassified 2996
166 Ga0105248_10320947 3300009177 Unclassified 1744
167 Ga0105248_10528856 3300009177 Unclassified 1330
168 Ga0105248_10547421 3300009177 Bacteria 1305
169 Ga0105248_10559155 3300009177 Bacteria 1291
170 Ga0105237_10095834 3300009545 Bacteria 2957
171 Ga0105238_10193747 3300009551 Bacteria 2008
172 Ga0105238_10884841 3300009551 Bacteria 911
173 Ga0105238_11015993 3300009551 Bacteria 850
174 Ga0105249_10049663 3300009553 Unclassified 3825
175 Ga0105249_10368236 3300009553 Unclassified 1460
176 Ga0105249_10495364 3300009553 Bacteria 1266
177 Ga0105249_10973533 3300009553 Bacteria 917
178 Ga0105249_11773958 3300009553 Bacteria 690
179 Ga0105249_12283314 3300009553 Bacteria 614
180 Ga0105239_11413149 3300010375 Unclassified 803
181 Ga0105246_10228029 3300011119 Unclassified 1465
182 Ga0157374_10386794 3300013296 Bacteria 1394
183 Ga0157378_10319748 3300013297 Bacteria 1507
184 Ga0163162_10009500 3300013306 Bacteria 9458
185 Ga0163162_10115234 3300013306 Unclassified 2787
186 Ga0163162_10136419 3300013306 Bacteria 2564
187 Ga0163162_12150663 3300013306 Bacteria 640
188 Ga0163162_12208021 3300013306 Bacteria 632
189 Ga0157372_13272714 3300013307 Unclassified 516
190 Ga0157375_10190870 3300013308 Bacteria 2203
191 Ga0157375_12241677 3300013308 Bacteria 651
192 Ga0163163_10009087 3300014325 Bacteria 8855
193 Ga0157380_10009925 3300014326 Bacteria 6832
194 Ga0157380_10103458 3300014326 Bacteria 2376
195 Ga0157380_10262184 3300014326 Bacteria 1570
196 Ga0157380_10304558 3300014326 Unclassified 1470
197 Ga0157380_10647887 3300014326 Bacteria 1053
198 Ga0157379_10017929 3300014968 Bacteria 6237
199 Ga0157379_10826765 3300014968 Unclassified 875
200 Ga0157376_10022115 3300014969 Bacteria 4950
201 Ga0157376_10055213 3300014969 Unclassified 3314
202 Ga0157376_10317417 3300014969 Bacteria 1480
203 Ga0157376_11302554 3300014969 Bacteria 757
204 Ga0163161_10157225 3300017792 Bacteria 1731
205 Ga0163161_10992969 3300017792 Unclassified 716
206 Ga0197907_10413580 3300020069 Unclassified 686
207 Ga0206355_1161945 3300020076 Unclassified 533
208 Ga0206350_11154346 3300020080 Unclassified 596
209 Ga0206353_11076246 3300020082 Unclassified 549
210 Ga0224712_10290886 3300022467 Bacteria 762
211 Ga0224712_10448946 3300022467 Unclassified 619
212 Ga0207697_10229276 3300025315 Bacteria 820
213 Ga0207682_10007317 3300025893 Bacteria 4403
214 Ga0207682_10306802 3300025893 Unclassified 744
215 Ga0207642_10037847 3300025899 Bacteria 2082
216 Ga0207642_10132059 3300025899 Bacteria 1305
217 Ga0207710_10037942 3300025900 Unclassified 2129
218 Ga0207688_10644118 3300025901 Unclassified 669
219 Ga0207680_10602362 3300025903 Bacteria 786
220 Ga0207645_10015080 3300025907 Bacteria 5148
221 Ga0207645_10075778 3300025907 Bacteria 2153
222 Ga0207643_10279671 3300025908 Bacteria 1035
223 Ga0207705_10073128 3300025909 Bacteria 2487
224 Ga0207705_10118804 3300025909 Unclassified 1960
225 Ga0207684_11304476 3300025910 Bacteria 598
226 Ga0207707_10036888 3300025912 Bacteria 4271
227 Ga0207707_10160154 3300025912 Bacteria 1968
228 Ga0207671_10054674 3300025914 Bacteria 2957
229 Ga0207662_10072667 3300025918 Bacteria 2085
230 Ga0207657_10003193 3300025919 Bacteria 17534
231 Ga0207657_10134603 3300025919 Bacteria 2023
232 Ga0207649_10038012 3300025920 Bacteria 2912
233 Ga0207649_10316174 3300025920 Bacteria 1146
234 Ga0207652_10129454 3300025921 Bacteria 2250
235 Ga0207681_10005651 3300025923 Bacteria 7676
236 Ga0207681_10720112 3300025923 Bacteria 830
237 Ga0207694_10742321 3300025924 Bacteria 828
238 Ga0207650_10008940 3300025925 Bacteria 6846
239 Ga0207650_10610823 3300025925 Bacteria 917
240 Ga0207659_10100288 3300025926 Unclassified 2182
241 Ga0207659_10211562 3300025926 Bacteria 1554
242 Ga0207659_10568539 3300025926 Unclassified 965
243 Ga0207659_10594739 3300025926 Bacteria 943
244 Ga0207687_11304297 3300025927 Bacteria 624
245 Ga0207644_10576238 3300025931 Bacteria 933
246 Ga0207644_11109145 3300025931 Bacteria 665
247 Ga0207690_10290587 3300025932 Bacteria 1276
248 Ga0207690_10936073 3300025932 Unclassified 719
249 Ga0207706_10197101 3300025933 Bacteria 1766
250 Ga0207706_10262479 3300025933 Bacteria 1508
251 Ga0207706_10290092 3300025933 Bacteria 1426
252 Ga0207706_11210933 3300025933 Unclassified 627
253 Ga0207686_10022629 3300025934 Unclassified 3621
254 Ga0207686_10049313 3300025934 Bacteria 2613
255 Ga0207709_10032402 3300025935 Bacteria 3059
256 Ga0207709_10087321 3300025935 Bacteria 2027
257 Ga0207669_10620902 3300025937 Unclassified 881
258 Ga0207704_10071714 3300025938 Unclassified 2199
259 Ga0207704_10260589 3300025938 Bacteria 1307
260 Ga0207691_10059382 3300025940 Unclassified 3478
261 Ga0207691_10144901 3300025940 Bacteria 2091
262 Ga0207691_10210405 3300025940 Bacteria 1689
263 Ga0207691_10535254 3300025940 Bacteria 994
264 Ga0207711_10029597 3300025941 Bacteria 4621
265 Ga0207711_10052885 3300025941 Unclassified 3482
266 Ga0207711_10322955 3300025941 Unclassified 1427
267 Ga0207711_10567365 3300025941 Bacteria 1059
268 Ga0207711_10678341 3300025941 Bacteria 961
269 Ga0207689_10041857 3300025942 Bacteria 3790
270 Ga0207679_10125103 3300025945 Bacteria 2053
271 Ga0207679_11670162 3300025945 Unclassified 583
272 Ga0207667_10016163 3300025949 Bacteria 8438
273 Ga0207651_10031962 3300025960 Unclassified 3373
274 Ga0207651_10318396 3300025960 Bacteria 1299
275 Ga0207651_10544613 3300025960 Bacteria 1008
276 Ga0207651_10608167 3300025960 Bacteria 956
277 Ga0207651_10788809 3300025960 Unclassified 842
278 Ga0207712_10099703 3300025961 Unclassified 2157
279 Ga0207712_10621174 3300025961 Bacteria 937
280 Ga0207640_10198092 3300025981 Bacteria 1520
281 Ga0207658_10046258 3300025986 Bacteria 3177
282 Ga0207703_10148861 3300026035 Unclassified 2039
283 Ga0207639_10837176 3300026041 Unclassified 858
284 Ga0207678_10051895 3300026067 Bacteria 3539
285 Ga0207678_10732396 3300026067 Bacteria 871
286 Ga0207678_11039939 3300026067 Bacteria 725
287 Ga0207708_10006586 3300026075 Bacteria 8598
288 Ga0207708_10918966 3300026075 Bacteria 758
289 Ga0207641_10015323 3300026088 Bacteria 6283
290 Ga0207641_10058196 3300026088 Bacteria 3289
291 Ga0207641_11171492 3300026088 Unclassified 768
292 Ga0207641_11531959 3300026088 Bacteria 668
293 Ga0207648_10008966 3300026089 Bacteria 9620
294 Ga0207648_10019503 3300026089 Bacteria 6122
295 Ga0207648_10196400 3300026089 Bacteria 1789
296 Ga0207648_10951390 3300026089 Unclassified 803
297 Ga0207648_11234021 3300026089 Unclassified 702
298 Ga0207676_10024531 3300026095 Bacteria 4464
299 Ga0207676_10143312 3300026095 Unclassified 2048
300 Ga0207676_10184053 3300026095 Bacteria 1832
301 Ga0207674_10436511 3300026116 Bacteria 1266
302 Ga0207674_10728941 3300026116 Unclassified 957
303 Ga0207675_100067021 3300026118 Bacteria 3355
304 Ga0207675_100128923 3300026118 Bacteria 2398
305 Ga0207675_100416018 3300026118 Bacteria 1327
306 Ga0207675_101025378 3300026118 Unclassified 844
307 Ga0207683_10099325 3300026121 Bacteria 2598
308 Ga0207683_10406048 3300026121 Unclassified 1253
309 Ga0207683_11190232 3300026121 Bacteria 706
310 Ga0207683_11309972 3300026121 Bacteria 670
311 Ga0207698_10981407 3300026142 Bacteria 855
312 Ga0209974_10232817 3300027876 Bacteria 689
313 Ga0207428_10019346 3300027907 Bacteria 5806
314 Ga0207428_10075813 3300027907 Unclassified 2635
315 Ga0207428_10094301 3300027907 Unclassified 2320
316 Ga0268266_10021873 3300028379 Bacteria 5449
317 Ga0268265_10019816 3300028380 Unclassified 4684
318 Ga0268264_10057603 3300028381 Bacteria 3250
319 Ga0268264_10213762 3300028381 Unclassified 1772
320 Ga0268264_10576091 3300028381 Bacteria 1107
321 Ga0268264_10771388 3300028381 Bacteria 959
322 Ga0268264_10998378 3300028381 Bacteria 843
323 Ga0307513_10238849 3300031456 Unclassified 1624
324 Ga0307405_10519384 3300031731 Unclassified 958
325 Ga0307405_10775762 3300031731 Bacteria 801
326 Ga0307413_10072604 3300031824 Bacteria 2173
327 Ga0307410_10615772 3300031852 Bacteria 907
328 Ga0307416_100016899 3300032002 Bacteria 5087
329 Ga0307416_102822333 3300032002 Bacteria 581
330 Ga0373956_0481763 3300035119 Unclassified 592
331 Ga0373957_0194281 3300035120 Bacteria 844
332 Ga0373933_0838819 3300035724 Bacteria 605
333 Ga0373937_0150775 3300036401 Bacteria 2178
334 Ga0451802_1799892 3300041460 Bacteria 608
335 Ga0451804_0038258 3300041463 Unclassified 761
336 Ga0451853_2488221 3300041512 Bacteria 647
337 Ga0466957_0884542 3300044842 Bacteria 638
338 Ga0451576_2170396 3300045051 Unclassified 570
339 Ga0495592_0053630 3300046454 Bacteria 2990
340 Ga0495629_0150787 3300046459 Unclassified 1616
341 Ga0495651_0261667 3300046462 Bacteria 1177
342 Ga0495582_0433415 3300046473 Bacteria 759
343 Ga0495639_0206131 3300046475 Bacteria 964
344 Ga0495664_0478386 3300046477 Unclassified 745
345 Ga0495608_0502842 3300046511 Bacteria 734
346 Ga0495628_0224650 3300046516 Bacteria 1409
347 Ga0495628_0542356 3300046516 Unclassified 836
348 Ga0495643_0001705 3300046522 Bacteria 19059
349 Ga0495640_0260261 3300046533 Unclassified 1084
350 Ga0495621_0332836 3300046539 Bacteria 634
351 Ga0495645_0761049 3300046543 Unclassified 584
352 Ga0495635_0195537 3300046663 Bacteria 1373
353 Ga0495599_0356636 3300046678 Unclassified 876
354 Ga0495647_0068867 3300046681 Bacteria 1412
355 Ga0495658_0053685 3300046683 Bacteria 2290
356 Ga0495658_0094098 3300046683 Unclassified 1779
357 Ga0495658_0999706 3300046683 Unclassified 534
358 Ga0495669_0017313 3300046684 Bacteria 3092
359 Ga0495674_0256480 3300047319 Bacteria 1438
360 Ga0495672_0314953 3300047320 Bacteria 737
361 Ga0495602_0670084 3300048088 Unclassified 707
362 Ga0496101_0942920 3300048904 Bacteria 679
363 Ga0496102_0010134 3300048905 Bacteria 8105
364 Ga0496104_0124818 3300048907 Bacteria 2472
365 Ga0496104_0699694 3300048907 Bacteria 921
366 Ga0496104_1182122 3300048907 Unclassified 668
367 Ga0496105_0081276 3300048908 Unclassified 2677
368 Ga0496105_0319421 3300048908 Bacteria 1245
369 Ga0496107_0176607 3300048910 Bacteria 1586
370 Ga0496108_1335249 3300048911 Unclassified 602
371 Ga0496109_0674875 3300048912 Bacteria 971
372 Ga0496111_0559679 3300048914 Bacteria 839
373 Ga0496112_0085486 3300048915 Unclassified 3121
374 Ga0496112_1235722 3300048915 Bacteria 663
375 Ga0496113_0109175 3300048916 Bacteria 2151
376 Ga0501032_0032681 3300049569 Bacteria 3565
377 Ga0501034_0001368 3300049571 Bacteria 32875
378 Ga0501034_0013094 3300049571 Bacteria 8549
379 Ga0501034_1027336 3300049571 Unclassified 707
380 Ga0501036_0023339 3300049572 Bacteria 5210
381 Ga0501037_0154709 3300049573 Bacteria 1637
382 Ga0501037_0192113 3300049573 Unclassified 1445
383 Ga0501038_0023355 3300049574 Bacteria 5530
384 Ga0501038_0052124 3300049574 Unclassified 3528
385 Ga0501039_0017705 3300049575 Bacteria 5465
386 Ga0501043_0034174 3300049579 Bacteria 3999
387 Ga0501043_0269826 3300049579 Unclassified 1306
388 Ga0501046_0017376 3300049580 Bacteria 6006
389 Ga0501046_0050177 3300049580 Bacteria 3297
390 Ga0501047_0001819 3300049581 Bacteria 20607
391 Ga0501047_0051627 3300049581 Bacteria 3973
392 Ga0501048_0080541 3300049582 Unclassified 2297
393 Ga0501048_0308969 3300049582 Unclassified 1125
394 Ga0501067_0003645 3300049583 Bacteria 8485
395 Ga0501067_0070511 3300049583 Bacteria 1935
396 Ga0501068_0002843 3300049584 Bacteria 9208
397 Ga0501069_0026709 3300049585 Bacteria 3162
398 Ga0501069_0167342 3300049585 Bacteria 1267
399 Ga0501070_0272081 3300049586 Unclassified 1383
400 Ga0501072_0005605 3300049588 Bacteria 9553
401 Ga0501072_0099333 3300049588 Bacteria 2314
402 Ga0501073_0005846 3300049589 Bacteria 9179
403 Ga0501073_0093448 3300049589 Bacteria 2089
404 Ga0501074_0084659 3300049590 Bacteria 2273
405 Ga0501074_0291837 3300049590 Unclassified 1159
406 Ga0501076_0359560 3300049592 Bacteria 1196
407 Ga0501079_0531686 3300049741 Unclassified 924
408 Ga0501080_0000239 3300049742 Bacteria 41220
409 Ga0501080_0006022 3300049742 Bacteria 10867
410 Ga0501083_0030095 3300049744 Bacteria 3731
411 Ga0501035_0018679 3300049822 Bacteria 6386
412 Ga0501035_0118241 3300049822 Bacteria 2319
413 Ga0501044_0004864 3300049823 Bacteria 15015
414 Ga0501044_0457965 3300049823 Bacteria 1181
415 nmdc:mga00v17_605116_c1 3300050491 Bacteria 706
416 nmdc:mga0k408_234184_c1 3300050493 Bacteria 1096
417 nmdc:mga05p37_9246_c1 3300050507 Bacteria 11645
418 nmdc:mga08y16_188595_c1 3300050511 Unclassified 2139
419 nmdc:mga08y16_247875_c1 3300050511 Bacteria 1841
420 nmdc:mga08y16_38685_c1 3300050511 Bacteria 5007
421 nmdc:mga08y16_556303_c1 3300050511 Bacteria 1160
422 nmdc:mga08y16_642460_c1 3300050511 Bacteria 1066
423 nmdc:mga08y16_9008_c1 3300050511 Bacteria 10482
424 nmdc:mga0n895_101618_c1 3300050512 Unclassified 2885
425 nmdc:mga0n895_1777085_c1 3300050512 Bacteria 578
426 nmdc:mga0rr50_1185892_c1 3300050513 Bacteria 649
427 nmdc:mga0rr50_495154_c1 3300050513 Bacteria 1039
428 Ga0495601_0243646 3300053077 Bacteria 1174
429 Ga0495619_0300619 3300053085 Bacteria 1112
430 Ga0501084_0358289 3300054114 Bacteria 1232
431 Ga0501084_0660539 3300054114 Unclassified 882
432 Ga0587080_077731 3300059503 Unclassified 675
433 Ga0587098_003875 3300059604 Bacteria 1377
434 Ga0587067_045834 3300059640 Bacteria 867
435 Ga0587079_149320 3300059647 Bacteria 603
436 Ga0501082_0005684 3300060353 Bacteria 10820
437 Ga0501082_0028365 3300060353 Bacteria 4823
438 Ga0111539_10812114
439 JGI25406J46586_10023385
440 JGI25406J46586_10034328
441 Ga0058861_11773142
442 Ga0058861_11984659
443 Ga0058862_12815021
444 Ga0065704_10293843
445 Ga0065712_10076720
446 Ga0065712_10483195
447 Ga0065715_10108898
448 Ga0065715_10163408
449 Ga0065715_10220853
450 Ga0065707_10124895
451 Ga0065707_10260922
452 Ga0065707_10337051
453 Ga0065707_10975517
454 Ga0070658_10151143
455 Ga0070676_10015917
456 Ga0070676_10130076
457 Ga0070676_10158440
458 Ga0070683_100544909
459 Ga0070690_100099897
460 Ga0070670_100005156
461 Ga0070670_100313746
462 Ga0070677_10323427
463 Ga0068869_100014514
464 Ga0070680_100590554
465 Ga0068868_100104079
466 Ga0070660_100016864
467 Ga0070689_100046684
468 Ga0070689_100814180
469 Ga0070691_10449743
470 Ga0070661_100157808
471 Ga0070661_100376691
472 Ga0070692_10647615
473 Ga0070669_100012947
474 Ga0070675_100045494
475 Ga0070675_100145132
476 Ga0070675_100331999
477 Ga0070675_100817853
478 Ga0070674_100575112
479 Ga0070674_100971705
480 Ga0070673_100022404
481 Ga0070673_100239643
482 Ga0070673_100594346
483 Ga0070673_100702105
484 Ga0070688_100052104
485 Ga0070688_100481518
486 Ga0070659_100324872
487 Ga0070667_100083663
488 Ga0070701_10147824
489 Ga0070708_101128418
490 Ga0070663_100016567
491 Ga0070678_101225328
492 Ga0070662_100386802
493 Ga0070662_100645028
494 Ga0070681_10001110
495 Ga0070681_10089941
496 Ga0070681_10785781
497 Ga0068867_100033402
498 Ga0068867_100041366
499 Ga0068867_100089180
500 Ga0068867_100489867
501 Ga0068867_101360947
502 Ga0070685_10983851
503 Ga0070706_100716413
504 Ga0070698_100334375
505 Ga0070699_100116906
506 Ga0070679_100200544
507 Ga0070679_100339485
508 Ga0070679_101529798
509 Ga0068853_100389817
510 Ga0070672_100135172
511 Ga0070672_100296349
512 Ga0070672_100682367
513 Ga0070686_101168169
514 Ga0070696_100172909
515 Ga0070696_100864540
516 Ga0070665_100114227
517 Ga0070665_100116830
518 Ga0068855_100005452
519 Ga0070664_100005017
520 Ga0070664_100603313
521 Ga0070664_101706042
522 Ga0070664_101864553
523 Ga0068857_100289510
524 Ga0068857_101616220
525 Ga0068852_101075412
526 Ga0068859_100105115
527 Ga0068859_101232871
528 Ga0068859_101336311
529 Ga0068859_101877228
530 Ga0068864_100251848
531 Ga0068864_100364776
532 Ga0068861_100060984
533 Ga0068861_100073794
534 Ga0068861_100210397
535 Ga0068861_100335379
536 Ga0068851_10571459
537 Ga0068870_10353879
538 Ga0068863_100126162
539 Ga0068863_100323648
540 Ga0068863_100716461
541 Ga0068863_101448304
542 Ga0068858_100003770
543 Ga0068858_100477427
544 Ga0068858_100636431
545 Ga0068858_100913511
546 Ga0068858_101141064
547 Ga0068860_100072811
548 Ga0068860_100143085
549 Ga0068860_100326302
550 Ga0068860_100669667
551 Ga0068860_100947303
552 Ga0068860_101807807
553 Ga0068862_100021075
554 Ga0068862_100065074
555 Ga0068862_100232294
556 Ga0068862_100731005
557 Ga0081455_10635884
558 Ga0081539_10003605
559 Ga0081539_10004285
560 Ga0070715_10513858
561 Ga0070712_100113290
562 Ga0097621_100205651
563 Ga0097621_100283376
564 Ga0068871_100085242
565 Ga0068871_100134976
566 Ga0068871_100544404
567 Ga0068871_100555637
568 Ga0068871_100648624
569 Ga0075433_10447994
570 Ga0075434_100103471
571 Ga0068865_100037901
572 Ga0068865_100038388
573 Ga0068865_100082027
574 Ga0068865_100107033
575 Ga0068865_100702890
576 Ga0068865_101221631
577 Ga0097620_100105116
578 Ga0097620_101232416
579 Ga0097620_101336069
580 Ga0097620_101877334
581 Ga0075435_100296979
582 Ga0105240_10078197
583 Ga0111539_10070688
584 Ga0111539_10075161
585 Ga0111539_10095150
586 Ga0111539_10222324
587 Ga0111539_10295489
588 Ga0111539_10319029
589 Ga0111539_10378611
590 Ga0105245_10243339
591 Ga0105245_10619652
592 Ga0105245_10915017
593 Ga0105245_11352570
594 Ga0105247_10331065
595 Ga0105243_10128517
596 Ga0105243_11070240
597 Ga0105242_10007230
598 Ga0105242_10020397
599 Ga0105242_10023737
600 Ga0105248_10017596
601 Ga0105248_10028994
602 Ga0105248_10117745
603 Ga0105248_10320947
604 Ga0105248_10528856
605 Ga0105248_10547421
606 Ga0105248_10559155
607 Ga0105237_10095834
608 Ga0105238_10193747
609 Ga0105238_10884841
610 Ga0105238_11015993
611 Ga0105249_10049663
612 Ga0105249_10368236
613 Ga0105249_10495364
614 Ga0105249_10973533
615 Ga0105249_11773958
616 Ga0105249_12283314
617 Ga0105239_11413149
618 Ga0105246_10228029
619 Ga0157374_10386794
620 Ga0157378_10319748
621 Ga0163162_10009500
622 Ga0163162_10115234
623 Ga0163162_10136419
624 Ga0163162_12150663
625 Ga0163162_12208021
626 Ga0157372_13272714
627 Ga0157375_10190870
628 Ga0157375_12241677
629 Ga0163163_10009087
630 Ga0157380_10009925
631 Ga0157380_10103458
632 Ga0157380_10262184
633 Ga0157380_10304558
634 Ga0157380_10647887
635 Ga0157379_10017929
636 Ga0157379_10826765
637 Ga0157376_10022115
638 Ga0157376_10055213
639 Ga0157376_10317417
640 Ga0157376_11302554
641 Ga0163161_10157225
642 Ga0163161_10992969
643 Ga0197907_10413580
644 Ga0206355_1161945
645 Ga0206350_11154346
646 Ga0206353_11076246
647 Ga0224712_10290886
648 Ga0224712_10448946
649 Ga0207697_10229276
650 Ga0207682_10007317
651 Ga0207682_10306802
652 Ga0207642_10037847
653 Ga0207642_10132059
654 Ga0207710_10037942
655 Ga0207688_10644118
656 Ga0207680_10602362
657 Ga0207645_10015080
658 Ga0207645_10075778
659 Ga0207643_10279671
660 Ga0207705_10073128
661 Ga0207705_10118804
662 Ga0207684_11304476
663 Ga0207707_10036888
664 Ga0207707_10160154
665 Ga0207671_10054674
666 Ga0207662_10072667
667 Ga0207657_10003193
668 Ga0207657_10134603
669 Ga0207649_10038012
670 Ga0207649_10316174
671 Ga0207652_10129454
672 Ga0207681_10005651
673 Ga0207681_10720112
674 Ga0207694_10742321
675 Ga0207650_10008940
676 Ga0207650_10610823
677 Ga0207659_10100288
678 Ga0207659_10211562
679 Ga0207659_10568539
680 Ga0207659_10594739
681 Ga0207687_11304297
682 Ga0207644_10576238
683 Ga0207644_11109145
684 Ga0207690_10290587
685 Ga0207690_10936073
686 Ga0207706_10197101
687 Ga0207706_10262479
688 Ga0207706_10290092
689 Ga0207706_11210933
690 Ga0207686_10022629
691 Ga0207686_10049313
692 Ga0207709_10032402
693 Ga0207709_10087321
694 Ga0207669_10620902
695 Ga0207704_10071714
696 Ga0207704_10260589
697 Ga0207691_10059382
698 Ga0207691_10144901
699 Ga0207691_10210405
700 Ga0207691_10535254
701 Ga0207711_10029597
702 Ga0207711_10052885
703 Ga0207711_10322955
704 Ga0207711_10567365
705 Ga0207711_10678341
706 Ga0207689_10041857
707 Ga0207679_10125103
708 Ga0207679_11670162
709 Ga0207667_10016163
710 Ga0207651_10031962
711 Ga0207651_10318396
712 Ga0207651_10544613
713 Ga0207651_10608167
714 Ga0207651_10788809
715 Ga0207712_10099703
716 Ga0207712_10621174
717 Ga0207640_10198092
718 Ga0207658_10046258
719 Ga0207703_10148861
720 Ga0207639_10837176
721 Ga0207678_10051895
722 Ga0207678_10732396
723 Ga0207678_11039939
724 Ga0207708_10006586
725 Ga0207708_10918966
726 Ga0207641_10015323
727 Ga0207641_10058196
728 Ga0207641_11171492
729 Ga0207641_11531959
730 Ga0207648_10008966
731 Ga0207648_10019503
732 Ga0207648_10196400
733 Ga0207648_10951390
734 Ga0207648_11234021
735 Ga0207676_10024531
736 Ga0207676_10143312
737 Ga0207676_10184053
738 Ga0207674_10436511
739 Ga0207674_10728941
740 Ga0207675_100067021
741 Ga0207675_100128923
742 Ga0207675_100416018
743 Ga0207675_101025378
744 Ga0207683_10099325
745 Ga0207683_10406048
746 Ga0207683_11190232
747 Ga0207683_11309972
748 Ga0207698_10981407
749 Ga0209974_10232817
750 Ga0207428_10019346
751 Ga0207428_10075813
752 Ga0207428_10094301
753 Ga0268266_10021873
754 Ga0268265_10019816
755 Ga0268264_10057603
756 Ga0268264_10213762
757 Ga0268264_10576091
758 Ga0268264_10771388
759 Ga0268264_10998378
760 Ga0307513_10238849
761 Ga0307405_10519384
762 Ga0307405_10775762
763 Ga0307413_10072604
764 Ga0307410_10615772
765 Ga0307416_100016899
766 Ga0307416_102822333
767 Ga0373956_0481763
768 Ga0373957_0194281
769 Ga0373933_0838819
770 Ga0373937_0150775
771 Ga0451802_1799892
772 Ga0451804_0038258
773 Ga0451853_2488221
774 Ga0466957_0884542
775 Ga0451576_2170396
776 Ga0495592_0053630
777 Ga0495629_0150787
778 Ga0495651_0261667
779 Ga0495582_0433415
780 Ga0495639_0206131
781 Ga0495664_0478386
782 Ga0495608_0502842
783 Ga0495628_0224650
784 Ga0495628_0542356
785 Ga0495643_0001705
786 Ga0495640_0260261
787 Ga0495621_0332836
788 Ga0495645_0761049
789 Ga0495635_0195537
790 Ga0495599_0356636
791 Ga0495647_0068867
792 Ga0495658_0053685
793 Ga0495658_0094098
794 Ga0495658_0999706
795 Ga0495669_0017313
796 Ga0495674_0256480
797 Ga0495672_0314953
798 Ga0495602_0670084
799 Ga0496101_0942920
800 Ga0496102_0010134
801 Ga0496104_0124818
802 Ga0496104_0699694
803 Ga0496104_1182122
804 Ga0496105_0081276
805 Ga0496105_0319421
806 Ga0496107_0176607
807 Ga0496108_1335249
808 Ga0496109_0674875
809 Ga0496111_0559679
810 Ga0496112_0085486
811 Ga0496112_1235722
812 Ga0496113_0109175
813 Ga0501032_0032681
814 Ga0501034_0001368
815 Ga0501034_0013094
816 Ga0501034_1027336
817 Ga0501036_0023339
818 Ga0501037_0154709
819 Ga0501037_0192113
820 Ga0501038_0023355
821 Ga0501038_0052124
822 Ga0501039_0017705
823 Ga0501043_0034174
824 Ga0501043_0269826
825 Ga0501046_0017376
826 Ga0501046_0050177
827 Ga0501047_0001819
828 Ga0501047_0051627
829 Ga0501048_0080541
830 Ga0501048_0308969
831 Ga0501067_0003645
832 Ga0501067_0070511
833 Ga0501068_0002843
834 Ga0501069_0026709
835 Ga0501069_0167342
836 Ga0501070_0272081
837 Ga0501072_0005605
838 Ga0501072_0099333
839 Ga0501073_0005846
840 Ga0501073_0093448
841 Ga0501074_0084659
842 Ga0501074_0291837
843 Ga0501076_0359560
844 Ga0501079_0531686
845 Ga0501080_0000239
846 Ga0501080_0006022
847 Ga0501083_0030095
848 Ga0501035_0018679
849 Ga0501035_0118241
850 Ga0501044_0004864
851 Ga0501044_0457965
852 nmdc:mga00v17_605116_c1
853 nmdc:mga0k408_234184_c1
854 nmdc:mga05p37_9246_c1
855 nmdc:mga08y16_188595_c1
856 nmdc:mga08y16_247875_c1
857 nmdc:mga08y16_38685_c1
858 nmdc:mga08y16_556303_c1
859 nmdc:mga08y16_642460_c1
860 nmdc:mga08y16_9008_c1
861 nmdc:mga0n895_101618_c1
862 nmdc:mga0n895_1777085_c1
863 nmdc:mga0rr50_1185892_c1
864 nmdc:mga0rr50_495154_c1
865 Ga0495601_0243646
866 Ga0495619_0300619
867 Ga0501084_0358289
868 Ga0501084_0660539
869 Ga0587080_077731
870 Ga0587098_003875
871 Ga0587067_045834
872 Ga0587079_149320
873 Ga0501082_0005684
874 Ga0501082_0028365

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

42

174

0.98

PF02915

Rubrerythrin

Rubrerythrin

43

171

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qqy-assembly1.cif.gz_A crystal structure of ferritin like, diiron-carboxylate proteins from bacillus anthracis str. ames 0.9629 8 144
2qqy-assembly1.cif.gz_A crystal structure of ferritin like, diiron-carboxylate proteins from bacillus anthracis str. ames 0.9429 8 144
3hiu-assembly1.cif.gz_A the crystal structure of protein (xcc3681) from xanthomonas campestris pv. campestris str. atcc 33913 0.9408 10 145
3hiu-assembly1.cif.gz_B the crystal structure of protein (xcc3681) from xanthomonas campestris pv. campestris str. atcc 33913 0.9377 10 145
3e2c-assembly1.cif.gz_B escherichia coli bacterioferritin mutant e128r/e135r 0.9256 13 145
ID Description Score Start End Superfamily
2qqyA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9515 10 144 1.20.1260.10
3e2cA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9261 13 145 1.20.1260.10
2vxiG00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9258 12 145 1.20.1260.10
3e2cB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9256 13 145 1.20.1260.10
2qqyA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9241 10 144 1.20.1260.10
ID Description Score Start End GO Terms
AF-B9XLV2-F1-model_v4 Ferritin Dps family protein 0.991 11 149 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-A0A7G8BRE9-F1-model_v4 Ferritin-like domain-containing protein 0.9906 11 151 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-A0A832TDR8-F1-model_v4 Ferritin-like domain-containing protein 0.9839 11 146 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-A0A847A0B7-F1-model_v4 Ferritin-like domain-containing protein 0.9834 11 145 GO:0004322
GO:0005829
GO:0006880
GO:0008199
GO:0020037
AF-A0A1V5IPQ1-F1-model_v4 ferroxidase (EC 1.16.3.1) 0.9807 11 145 GO:0004322
GO:0005829
GO:0006880
GO:0008199
GO:0015093
GO:0020037

Map