F443740

General Info

Members Datasets Scaffolds Average Seq Length
437 253 874 183

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100705376|Ga0075430_1007053762
Length 198
Sequence MSDRKVILKMVISLDGFATSPDGTHDWMFEWFGDDSRERNMRALEEAGVHVMGRRSYEIMGPHWAASEGPIASSMNEKPKAVFSHTLKAPTWGPAEIFGGDLSAGIADLKARDDEGTVLVHGGPDFAKSLTRLGLVDEYQLSTVPIAIGAGHSPFAELDEHLKLDVVEEERLRSGALAQNLGAQAMKRERAGLESGPW

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
156 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
167 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
168 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
169 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
170 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
171 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
172 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
173 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
182 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
242 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0.69
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.83
Nodule 0
Rhizoplane 11.67
Rhizosphere 83.3
Stem 0
Stem Tuber 0
Unclassified 1.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100705376 3300006846 Bacteria 832
2 JGI24735J21928_10117572 3300002067 Bacteria 765
3 JGI24744J21845_10024289 3300002077 Bacteria 1185
4 JGI24742J22300_10037712 3300002244 Bacteria 856
5 Ga0070658_10114365 3300005327 Bacteria 2237
6 Ga0070683_100022916 3300005329 Bacteria 5582
7 Ga0070683_100120193 3300005329 Bacteria 2481
8 Ga0070670_100681010 3300005331 Bacteria 924
9 Ga0070666_10002348 3300005335 Bacteria 11433
10 Ga0070680_100087311 3300005336 Bacteria 2579
11 Ga0070680_100455688 3300005336 Bacteria 1093
12 Ga0070682_100043046 3300005337 Bacteria 2790
13 Ga0070682_100068250 3300005337 Bacteria 2267
14 Ga0070682_100542564 3300005337 Bacteria 908
15 Ga0070660_100197903 3300005339 Bacteria 1629
16 Ga0070660_100465303 3300005339 Bacteria 1050
17 Ga0070689_100044525 3300005340 Bacteria 3414
18 Ga0070689_100866032 3300005340 Bacteria 798
19 Ga0070661_100129458 3300005344 Bacteria 1895
20 Ga0070668_100005508 3300005347 Bacteria 9387
21 Ga0070668_100104911 3300005347 Bacteria 2244
22 Ga0070668_100418815 3300005347 Bacteria 1146
23 Ga0070668_100918581 3300005347 Bacteria 783
24 Ga0070669_100363259 3300005353 Bacteria 1178
25 Ga0070675_100049031 3300005354 Bacteria 3464
26 Ga0070674_100437305 3300005356 Bacteria 1077
27 Ga0070674_100595157 3300005356 Bacteria 934
28 Ga0070688_100051602 3300005365 Bacteria 2567
29 Ga0070688_100177761 3300005365 Bacteria 1474
30 Ga0070688_100758948 3300005365 Bacteria 756
31 Ga0070659_100004702 3300005366 Bacteria 9745
32 Ga0070659_100041758 3300005366 Bacteria 3586
33 Ga0070659_100495808 3300005366 Bacteria 1040
34 Ga0070659_100781062 3300005366 Bacteria 830
35 Ga0070667_100002656 3300005367 Bacteria 15480
36 Ga0070667_100008673 3300005367 Bacteria 8423
37 Ga0070714_100008087 3300005435 Bacteria 8196
38 Ga0070713_100078960 3300005436 Bacteria 2802
39 Ga0070710_10195604 3300005437 Bacteria 1274
40 Ga0070663_100064153 3300005455 Bacteria 2654
41 Ga0070663_100265520 3300005455 Bacteria 1363
42 Ga0070678_100471845 3300005456 Bacteria 1103
43 Ga0070678_100781784 3300005456 Bacteria 865
44 Ga0070662_100163128 3300005457 Bacteria 1744
45 Ga0070662_100303537 3300005457 Bacteria 1298
46 Ga0070662_100778558 3300005457 Bacteria 813
47 Ga0070681_10038911 3300005458 Bacteria 4768
48 Ga0070699_100457120 3300005518 Bacteria 1158
49 Ga0070684_100039125 3300005535 Bacteria 4078
50 Ga0070684_100136696 3300005535 Bacteria 2214
51 Ga0068853_101009964 3300005539 Bacteria 801
52 Ga0070672_100450472 3300005543 Bacteria 1108
53 Ga0070686_100095699 3300005544 Bacteria 1995
54 Ga0070696_100476975 3300005546 Bacteria 989
55 Ga0070665_100006979 3300005548 Bacteria 11481
56 Ga0070665_100243978 3300005548 Bacteria 1797
57 Ga0070704_100195268 3300005549 Bacteria 1630
58 Ga0070664_100159734 3300005564 Bacteria 1993
59 Ga0068854_100376532 3300005578 Bacteria 1169
60 Ga0068854_100976827 3300005578 Bacteria 748
61 Ga0068856_100014890 3300005614 Bacteria 7507
62 Ga0068856_100083109 3300005614 Bacteria 3179
63 Ga0068856_100597358 3300005614 Bacteria 1125
64 Ga0068856_101148195 3300005614 Bacteria 794
65 Ga0070702_100196436 3300005615 Bacteria 1332
66 Ga0070702_100547034 3300005615 Bacteria 859
67 Ga0068852_100032110 3300005616 Bacteria 4343
68 Ga0068852_100330042 3300005616 Bacteria 1484
69 Ga0068859_100146729 3300005617 Bacteria 2434
70 Ga0068859_100198805 3300005617 Unclassified 2089
71 Ga0068864_100117536 3300005618 Bacteria 2374
72 Ga0068864_100225209 3300005618 Bacteria 1732
73 Ga0068864_100426202 3300005618 Bacteria 1265
74 Ga0068861_100785061 3300005719 Bacteria 893
75 Ga0068851_10107732 3300005834 Bacteria 1485
76 Ga0068851_10362224 3300005834 Bacteria 846
77 Ga0068870_10362898 3300005840 Bacteria 933
78 Ga0068858_100289240 3300005842 Bacteria 1562
79 Ga0068858_100352798 3300005842 Unclassified 1409
80 Ga0068860_100085808 3300005843 Bacteria 2995
81 Ga0068860_100798990 3300005843 Bacteria 957
82 Ga0068862_100004503 3300005844 Bacteria 11751
83 Ga0068862_100260944 3300005844 Bacteria 1581
84 Ga0081455_10025489 3300005937 Bacteria 5456
85 Ga0081538_10002807 3300005981 Bacteria 16684
86 Ga0081538_10084571 3300005981 Bacteria 1671
87 Ga0081538_10111131 3300005981 Bacteria 1345
88 Ga0081540_1038224 3300005983 Bacteria 2532
89 Ga0081539_10003904 3300005985 Bacteria 17349
90 Ga0070717_10136848 3300006028 Bacteria 2110
91 Ga0075365_10031827 3300006038 Bacteria 3386
92 Ga0075365_10437991 3300006038 Bacteria 923
93 Ga0075363_100019028 3300006048 Bacteria 3428
94 Ga0075364_10120535 3300006051 Bacteria 1755
95 Ga0075364_10483558 3300006051 Bacteria 846
96 Ga0070716_100328188 3300006173 Bacteria 1075
97 Ga0070712_100408785 3300006175 Bacteria 1122
98 Ga0075428_100071488 3300006844 Bacteria 3792
99 Ga0075428_100326852 3300006844 Bacteria 1647
100 Ga0075430_100429312 3300006846 Bacteria 1091
101 Ga0075430_100697919 3300006846 Bacteria 837
102 Ga0075431_100024629 3300006847 Bacteria 6170
103 Ga0075434_100640278 3300006871 Bacteria 1081
104 Ga0075434_100651336 3300006871 Bacteria 1072
105 Ga0075429_100100323 3300006880 Bacteria 2526
106 Ga0068865_100125897 3300006881 Bacteria 1912
107 Ga0068865_100140799 3300006881 Bacteria 1818
108 Ga0068865_100861265 3300006881 Bacteria 785
109 Ga0075436_100028826 3300006914 Bacteria 3819
110 Ga0075436_100999651 3300006914 Bacteria 628
111 Ga0097620_100146730 3300006931 Bacteria 2434
112 Ga0097620_100198825 3300006931 Unclassified 2089
113 Ga0105240_10016164 3300009093 Bacteria 10115
114 Ga0105240_11462135 3300009093 Bacteria 717
115 Ga0111539_10234415 3300009094 Bacteria 2137
116 Ga0111539_11188200 3300009094 Bacteria 886
117 Ga0105245_11055077 3300009098 Bacteria 858
118 Ga0105247_10151712 3300009101 Bacteria 1527
119 Ga0105247_10277568 3300009101 Bacteria 1155
120 Ga0114129_10192800 3300009147 Bacteria 2765
121 Ga0114129_10418661 3300009147 Bacteria 1762
122 Ga0114129_10934063 3300009147 Bacteria 1097
123 Ga0114129_11193161 3300009147 Bacteria 948
124 Ga0105243_10051320 3300009148 Bacteria 3262
125 Ga0105242_10552857 3300009176 Bacteria 1104
126 Ga0105248_10111318 3300009177 Bacteria 3088
127 Ga0105248_10521897 3300009177 Bacteria 1339
128 Ga0105248_10782208 3300009177 Unclassified 1077
129 Ga0105248_12739711 3300009177 Bacteria 562
130 Ga0105237_10016465 3300009545 Bacteria 7680
131 Ga0105238_10020958 3300009551 Bacteria 6659
132 Ga0105249_10015428 3300009553 Bacteria 6762
133 Ga0105249_10035141 3300009553 Bacteria 4543
134 Ga0105249_10133586 3300009553 Bacteria 2372
135 Ga0105239_10131163 3300010375 Bacteria 2788
136 Ga0105239_10142640 3300010375 Bacteria 2670
137 Ga0105246_10329444 3300011119 Bacteria 1244
138 Ga0157370_10102262 3300013104 Bacteria 2683
139 Ga0157369_10028154 3300013105 Bacteria 6220
140 Ga0157374_10049441 3300013296 Bacteria 3905
141 Ga0157378_10285491 3300013297 Bacteria 1592
142 Ga0163162_10403904 3300013306 Bacteria 1499
143 Ga0157372_10118058 3300013307 Bacteria 3043
144 Ga0157372_10423556 3300013307 Bacteria 1551
145 Ga0157375_10122710 3300013308 Bacteria 2710
146 Ga0157375_10955651 3300013308 Bacteria 998
147 Ga0157375_11966838 3300013308 Bacteria 695
148 Ga0163163_10216167 3300014325 Bacteria 1966
149 Ga0163163_10376141 3300014325 Bacteria 1478
150 Ga0163163_10835645 3300014325 Bacteria 984
151 Ga0182008_10219089 3300014497 Bacteria 973
152 Ga0182008_10289276 3300014497 Bacteria 855
153 Ga0157377_10049150 3300014745 Bacteria 2370
154 Ga0157379_10005833 3300014968 Bacteria 10587
155 Ga0157379_11158821 3300014968 Bacteria 742
156 Ga0157376_10277573 3300014969 Bacteria 1577
157 Ga0163161_11292165 3300017792 Bacteria 634
158 Ga0206354_11315557 3300020081 Bacteria 655
159 Ga0206353_10308811 3300020082 Bacteria 3000
160 Ga0206353_10808716 3300020082 Bacteria 663
161 Ga0207656_10145147 3300025321 Bacteria 1121
162 Ga0207692_10199906 3300025898 Bacteria 1174
163 Ga0207710_10055033 3300025900 Bacteria 1793
164 Ga0207688_10201725 3300025901 Bacteria 1193
165 Ga0207688_10212833 3300025901 Bacteria 1162
166 Ga0207688_10220579 3300025901 Bacteria 1142
167 Ga0207680_10004564 3300025903 Bacteria 6576
168 Ga0207645_10095430 3300025907 Bacteria 1915
169 Ga0207645_10301972 3300025907 Bacteria 1066
170 Ga0207643_10056548 3300025908 Bacteria 2231
171 Ga0207643_10232036 3300025908 Bacteria 1132
172 Ga0207705_10156249 3300025909 Bacteria 1711
173 Ga0207705_10533238 3300025909 Bacteria 912
174 Ga0207654_10115587 3300025911 Bacteria 1676
175 Ga0207654_10212807 3300025911 Bacteria 1278
176 Ga0207707_10209468 3300025912 Bacteria 1698
177 Ga0207695_10222472 3300025913 Bacteria 1794
178 Ga0207671_10233998 3300025914 Bacteria 1442
179 Ga0207693_10163648 3300025915 Bacteria 1751
180 Ga0207660_10074193 3300025917 Bacteria 2482
181 Ga0207660_10271438 3300025917 Bacteria 1344
182 Ga0207662_10039154 3300025918 Bacteria 2780
183 Ga0207662_10369138 3300025918 Bacteria 967
184 Ga0207657_10020023 3300025919 Bacteria 6337
185 Ga0207657_10665064 3300025919 Bacteria 810
186 Ga0207649_10149314 3300025920 Bacteria 1608
187 Ga0207652_10021938 3300025921 Bacteria 5276
188 Ga0207652_10578923 3300025921 Bacteria 1008
189 Ga0207694_10762046 3300025924 Bacteria 817
190 Ga0207659_10453794 3300025926 Bacteria 1080
191 Ga0207659_11034045 3300025926 Bacteria 707
192 Ga0207687_10150323 3300025927 Bacteria 1776
193 Ga0207687_10186007 3300025927 Bacteria 1613
194 Ga0207687_10813772 3300025927 Bacteria 797
195 Ga0207700_10023762 3300025928 Bacteria 4233
196 Ga0207664_10112434 3300025929 Bacteria 2267
197 Ga0207644_10335553 3300025931 Bacteria 1225
198 Ga0207690_10059332 3300025932 Bacteria 2592
199 Ga0207690_10414791 3300025932 Bacteria 1076
200 Ga0207706_10037446 3300025933 Bacteria 4307
201 Ga0207706_10179631 3300025933 Bacteria 1858
202 Ga0207709_10015773 3300025935 Bacteria 4193
203 Ga0207709_10087241 3300025935 Bacteria 2028
204 Ga0207669_10398882 3300025937 Bacteria 1077
205 Ga0207665_10134488 3300025939 Bacteria 1758
206 Ga0207691_10145350 3300025940 Bacteria 2088
207 Ga0207711_10468871 3300025941 Unclassified 1173
208 Ga0207711_11354072 3300025941 Bacteria 654
209 Ga0207689_10273355 3300025942 Bacteria 1399
210 Ga0207661_10115265 3300025944 Bacteria 2279
211 Ga0207661_10555949 3300025944 Bacteria 1051
212 Ga0207679_10154437 3300025945 Bacteria 1872
213 Ga0207679_10975949 3300025945 Bacteria 776
214 Ga0207667_10207259 3300025949 Bacteria 2010
215 Ga0207712_10002739 3300025961 Bacteria 11264
216 Ga0207712_10259643 3300025961 Bacteria 1408
217 Ga0207712_10317963 3300025961 Bacteria 1283
218 Ga0207712_10382928 3300025961 Bacteria 1178
219 Ga0207668_10012165 3300025972 Bacteria 5259
220 Ga0207668_10667460 3300025972 Bacteria 911
221 Ga0207640_11005978 3300025981 Bacteria 733
222 Ga0207658_10002131 3300025986 Bacteria 14704
223 Ga0207658_10007792 3300025986 Bacteria 7293
224 Ga0207658_10569634 3300025986 Bacteria 1015
225 Ga0207677_10009821 3300026023 Bacteria 5393
226 Ga0207677_10232031 3300026023 Bacteria 1487
227 Ga0207677_10441099 3300026023 Bacteria 1113
228 Ga0207703_10041447 3300026035 Bacteria 3688
229 Ga0207703_10080488 3300026035 Unclassified 2713
230 Ga0207703_10338666 3300026035 Bacteria 1382
231 Ga0207639_10018396 3300026041 Bacteria 4964
232 Ga0207678_10316990 3300026067 Bacteria 1341
233 Ga0207678_10641720 3300026067 Bacteria 932
234 Ga0207708_10019998 3300026075 Bacteria 5048
235 Ga0207708_10312701 3300026075 Bacteria 1280
236 Ga0207708_10576928 3300026075 Bacteria 951
237 Ga0207702_10056072 3300026078 Bacteria 3344
238 Ga0207702_10705937 3300026078 Bacteria 994
239 Ga0207648_10410217 3300026089 Bacteria 1229
240 Ga0207676_10113442 3300026095 Bacteria 2272
241 Ga0207676_10214215 3300026095 Bacteria 1711
242 Ga0207676_10456229 3300026095 Bacteria 1206
243 Ga0207676_10778461 3300026095 Bacteria 932
244 Ga0207674_10481628 3300026116 Bacteria 1199
245 Ga0207675_100024309 3300026118 Bacteria 5634
246 Ga0207675_100823552 3300026118 Bacteria 942
247 Ga0207675_100987675 3300026118 Bacteria 860
248 Ga0207698_10207194 3300026142 Bacteria 1761
249 Ga0207698_10603291 3300026142 Bacteria 1082
250 Ga0207428_10104543 3300027907 Bacteria 2185
251 Ga0207428_10146004 3300027907 Bacteria 1803
252 Ga0268266_10000097 3300028379 Bacteria 184541
253 Ga0268266_10206111 3300028379 Bacteria 1802
254 Ga0268265_10005144 3300028380 Bacteria 8958
255 Ga0268265_10049169 3300028380 Bacteria 3170
256 Ga0307408_100196131 3300031548 Bacteria 1631
257 Ga0307408_101568290 3300031548 Bacteria 624
258 Ga0307410_10759959 3300031852 Bacteria 821
259 Ga0307406_10559088 3300031901 Bacteria 937
260 Ga0307409_101189934 3300031995 Bacteria 785
261 Ga0307416_101296137 3300032002 Bacteria 834
262 Ga0307414_10360179 3300032004 Bacteria 1251
263 Ga0307411_10630772 3300032005 Bacteria 925
264 Ga0307415_100247608 3300032126 Bacteria 1446
265 Ga0307415_100287020 3300032126 Bacteria 1356
266 Ga0373926_0192603 3300035083 Bacteria 783
267 Ga0373940_0156787 3300035088 Bacteria 729
268 Ga0373955_0682774 3300035172 Bacteria 630
269 Ga0373931_0435591 3300035691 Bacteria 836
270 Ga0373935_0069870 3300035692 Bacteria 2263
271 Ga0373947_0086305 3300035725 Bacteria 1950
272 Ga0373925_0027990 3300037068 Bacteria 4127
273 Ga0395900_0556648 3300037418 Bacteria 1091
274 Ga0395900_0943823 3300037418 Bacteria 784
275 Ga0395898_0153851 3300037466 Bacteria 2200
276 Ga0395905_0210398 3300037471 Bacteria 1822
277 Ga0395905_0686118 3300037471 Bacteria 926
278 Ga0395905_1278951 3300037471 Bacteria 637
279 Ga0395901_0357153 3300038443 Bacteria 1507
280 Ga0395901_0434691 3300038443 Bacteria 1344
281 Ga0451791_1444831 3300041451 Bacteria 979
282 Ga0451793_1918376 3300041452 Bacteria 1461
283 Ga0451800_0318102 3300041459 Bacteria 655
284 Ga0451804_1026339 3300041463 Bacteria 815
285 Ga0451837_0468466 3300041494 Bacteria 1621
286 Ga0451853_1242477 3300041512 Bacteria 994
287 Ga0451853_2961412 3300041512 Bacteria 720
288 Ga0439459_0086853 3300042438 Bacteria 747
289 Ga0439460_0033757 3300042461 Bacteria 1471
290 Ga0466963_0356232 3300044694 Bacteria 1031
291 Ga0466971_0297341 3300044719 Bacteria 775
292 Ga0466968_0067736 3300044735 Bacteria 1549
293 Ga0466957_0356737 3300044842 Bacteria 993
294 Ga0466957_0458887 3300044842 Bacteria 879
295 Ga0466960_0000011 3300044901 Bacteria 60167
296 Ga0466960_0012514 3300044901 Bacteria 3583
297 Ga0466960_0042301 3300044901 Bacteria 2163
298 Ga0466960_0288407 3300044901 Bacteria 922
299 Ga0466958_0136671 3300045836 Bacteria 1542
300 Ga0466958_0332774 3300045836 Bacteria 977
301 Ga0466958_0515652 3300045836 Bacteria 776
302 Ga0466967_0042760 3300045976 Bacteria 3918
303 Ga0466967_0161099 3300045976 Bacteria 2106
304 Ga0466967_0228760 3300045976 Bacteria 1770
305 Ga0466967_0430982 3300045976 Bacteria 1286
306 Ga0466967_0583326 3300045976 Bacteria 1102
307 Ga0466967_1439068 3300045976 Bacteria 686
308 Ga0466967_1474531 3300045976 Bacteria 678
309 Ga0495617_213717 3300046452 Bacteria 601
310 Ga0495616_0365339 3300046513 Bacteria 599
311 Ga0495665_0163206 3300046531 Bacteria 1161
312 Ga0495598_0097055 3300046537 Bacteria 970
313 Ga0495621_0249578 3300046539 Bacteria 725
314 Ga0495597_0257631 3300046542 Bacteria 684
315 Ga0495661_0392633 3300046665 Bacteria 676
316 Ga0495658_0085497 3300046683 Bacteria 1859
317 Ga0495671_0216426 3300046692 Bacteria 928
318 Ga0495672_0041449 3300047320 Bacteria 2784
319 Ga0495676_0004562 3300047321 Bacteria 12674
320 Ga0495676_0098241 3300047321 Bacteria 2173
321 Ga0495685_208397 3300047447 Bacteria 626
322 Ga0495686_0143759 3300047472 Bacteria 1406
323 Ga0495614_0217595 3300048089 Bacteria 868
324 Ga0496100_0017809 3300048903 Bacteria 4202
325 Ga0496101_0073778 3300048904 Bacteria 2507
326 Ga0496102_0112751 3300048905 Bacteria 2536
327 Ga0496102_0183115 3300048905 Bacteria 1974
328 Ga0496103_0037012 3300048906 Bacteria 2990
329 Ga0496103_0070399 3300048906 Bacteria 2188
330 Ga0496103_0089021 3300048906 Bacteria 1947
331 Ga0496104_0033388 3300048907 Bacteria 4793
332 Ga0496104_0086212 3300048907 Bacteria 2998
333 Ga0496105_0028328 3300048908 Bacteria 4581
334 Ga0496105_0135677 3300048908 Bacteria 2027
335 Ga0496106_0055495 3300048909 Bacteria 2994
336 Ga0496106_0598462 3300048909 Bacteria 883
337 Ga0496107_0055473 3300048910 Bacteria 2862
338 Ga0496107_0056482 3300048910 Bacteria 2836
339 Ga0496108_0055385 3300048911 Bacteria 3330
340 Ga0496108_0134318 3300048911 Bacteria 2127
341 Ga0496108_0184617 3300048911 Bacteria 1806
342 Ga0496108_1049003 3300048911 Bacteria 694
343 Ga0496109_0003104 3300048912 Bacteria 13851
344 Ga0496109_0068548 3300048912 Bacteria 3251
345 Ga0496109_0098695 3300048912 Bacteria 2708
346 Ga0496109_0150717 3300048912 Bacteria 2177
347 Ga0496109_0270718 3300048912 Bacteria 1600
348 Ga0496109_0306281 3300048912 Bacteria 1498
349 Ga0496109_0434829 3300048912 Bacteria 1239
350 Ga0496110_0018921 3300048913 Bacteria 5787
351 Ga0496110_0085294 3300048913 Bacteria 2819
352 Ga0496110_0443892 3300048913 Bacteria 1182
353 Ga0496110_0539449 3300048913 Bacteria 1060
354 Ga0496110_0793206 3300048913 Bacteria 851
355 Ga0496110_1029222 3300048913 Bacteria 731
356 Ga0496111_0049765 3300048914 Bacteria 3022
357 Ga0496111_0057672 3300048914 Bacteria 2811
358 Ga0496112_0011598 3300048915 Bacteria 8059
359 Ga0496112_0023279 3300048915 Bacteria 5915
360 Ga0496112_0044092 3300048915 Bacteria 4369
361 Ga0496112_0482238 3300048915 Bacteria 1176
362 Ga0496112_0541760 3300048915 Bacteria 1098
363 Ga0496113_0007687 3300048916 Bacteria 6956
364 Ga0496113_0057058 3300048916 Bacteria 2933
365 Ga0496113_0173536 3300048916 Bacteria 1708
366 Ga0496113_0287939 3300048916 Bacteria 1314
367 Ga0496113_0299584 3300048916 Bacteria 1287
368 Ga0496114_0036270 3300048917 Bacteria 4075
369 Ga0496114_0227498 3300048917 Bacteria 1638
370 Ga0496115_0156668 3300048918 Bacteria 1882
371 Ga0496118_0048737 3300048921 Bacteria 3267
372 Ga0496118_0132466 3300048921 Bacteria 1598
373 Ga0496119_0003887 3300048922 Bacteria 15208
374 Ga0496121_0004843 3300048924 Bacteria 17713
375 Ga0496121_0005247 3300048924 Bacteria 16760
376 Ga0496121_0006688 3300048924 Bacteria 14174
377 Ga0496121_0063435 3300048924 Bacteria 3019
378 Ga0496124_0032529 3300048927 Bacteria 4604
379 Ga0496125_0022408 3300048928 Bacteria 5867
380 Ga0496125_0384095 3300048928 Unclassified 827
381 Ga0496126_0082571 3300048929 Bacteria 2839
382 Ga0501031_0201843 3300049568 Bacteria 1297
383 Ga0501032_0075323 3300049569 Bacteria 2247
384 Ga0501033_0830590 3300049570 Bacteria 623
385 Ga0501034_0004053 3300049571 Bacteria 16438
386 Ga0501034_0381397 3300049571 Bacteria 1334
387 Ga0501034_0479417 3300049571 Bacteria 1159
388 Ga0501036_0021330 3300049572 Bacteria 5444
389 Ga0501036_0063877 3300049572 Bacteria 3117
390 Ga0501036_0289762 3300049572 Bacteria 1370
391 Ga0501037_0053451 3300049573 Bacteria 2954
392 Ga0501038_0117787 3300049574 Bacteria 2193
393 Ga0501046_0042784 3300049580 Bacteria 3610
394 Ga0501047_0578968 3300049581 Bacteria 945
395 Ga0501048_0042480 3300049582 Bacteria 3255
396 Ga0501048_0085700 3300049582 Bacteria 2222
397 Ga0501067_0043471 3300049583 Bacteria 2495
398 Ga0501069_0059320 3300049585 Bacteria 2135
399 Ga0501070_0028565 3300049586 Bacteria 4678
400 Ga0501070_0694898 3300049586 Bacteria 805
401 Ga0501070_0749915 3300049586 Bacteria 769
402 Ga0501071_0080576 3300049587 Bacteria 2381
403 Ga0501071_0097559 3300049587 Bacteria 2164
404 Ga0501071_0682039 3300049587 Bacteria 791
405 Ga0501072_0052370 3300049588 Bacteria 3214
406 Ga0501073_0032275 3300049589 Bacteria 3733
407 Ga0501074_0398991 3300049590 Bacteria 975
408 Ga0501076_0060269 3300049592 Bacteria 3019
409 Ga0501080_0018515 3300049742 Bacteria 6442
410 Ga0501081_0966071 3300049743 Bacteria 643
411 Ga0501083_0021751 3300049744 Bacteria 4455
412 Ga0501035_0167206 3300049822 Bacteria 1901
413 Ga0501044_0315641 3300049823 Bacteria 1488
414 Ga0501044_0880913 3300049823 Bacteria 771
415 Ga0501045_0437348 3300049824 Bacteria 973
416 nmdc:mga03n38_531869_c1 3300050490 Bacteria 663
417 nmdc:mga00v17_72684_c1 3300050491 Bacteria 2134
418 nmdc:mga05p37_262541_c1 3300050507 Bacteria 2066
419 nmdc:mga05p37_638416_c1 3300050507 Bacteria 1195
420 nmdc:mga05p37_78719_c1 3300050507 Bacteria 4059
421 nmdc:mga06r32_19787_c1 3300050510 Bacteria 6186
422 nmdc:mga06r32_2234_c1 3300050510 Bacteria 17338
423 nmdc:mga08y16_175475_c1 3300050511 Bacteria 2225
424 nmdc:mga08y16_22894_c1 3300050511 Bacteria 6594
425 nmdc:mga08y16_272190_c1 3300050511 Bacteria 1748
426 nmdc:mga0n895_325019_c1 3300050512 Bacteria 1559
427 nmdc:mga08x19_29684_c1 3300050514 Bacteria 3430
428 nmdc:mga0a205_166329_c1 3300050515 Bacteria 2101
429 nmdc:mga0a205_477046_c1 3300050515 Bacteria 1106
430 nmdc:mga0a205_921841_c1 3300050515 Bacteria 720
431 Ga0500568_0041890 3300053139 Bacteria 1838
432 Ga0501084_0085624 3300054114 Bacteria 2646
433 Ga0590075_089665 3300059424 Bacteria 798
434 Ga0501082_0081751 3300060353 Bacteria 2787
435 Ga0501082_0129187 3300060353 Bacteria 2192
436 Ga0501082_0284663 3300060353 Bacteria 1439
437 Ga0530510_0073593 3300061734 Bacteria 2480
438 Ga0075430_100705376
439 JGI24735J21928_10117572
440 JGI24744J21845_10024289
441 JGI24742J22300_10037712
442 Ga0070658_10114365
443 Ga0070683_100022916
444 Ga0070683_100120193
445 Ga0070670_100681010
446 Ga0070666_10002348
447 Ga0070680_100087311
448 Ga0070680_100455688
449 Ga0070682_100043046
450 Ga0070682_100068250
451 Ga0070682_100542564
452 Ga0070660_100197903
453 Ga0070660_100465303
454 Ga0070689_100044525
455 Ga0070689_100866032
456 Ga0070661_100129458
457 Ga0070668_100005508
458 Ga0070668_100104911
459 Ga0070668_100418815
460 Ga0070668_100918581
461 Ga0070669_100363259
462 Ga0070675_100049031
463 Ga0070674_100437305
464 Ga0070674_100595157
465 Ga0070688_100051602
466 Ga0070688_100177761
467 Ga0070688_100758948
468 Ga0070659_100004702
469 Ga0070659_100041758
470 Ga0070659_100495808
471 Ga0070659_100781062
472 Ga0070667_100002656
473 Ga0070667_100008673
474 Ga0070714_100008087
475 Ga0070713_100078960
476 Ga0070710_10195604
477 Ga0070663_100064153
478 Ga0070663_100265520
479 Ga0070678_100471845
480 Ga0070678_100781784
481 Ga0070662_100163128
482 Ga0070662_100303537
483 Ga0070662_100778558
484 Ga0070681_10038911
485 Ga0070699_100457120
486 Ga0070684_100039125
487 Ga0070684_100136696
488 Ga0068853_101009964
489 Ga0070672_100450472
490 Ga0070686_100095699
491 Ga0070696_100476975
492 Ga0070665_100006979
493 Ga0070665_100243978
494 Ga0070704_100195268
495 Ga0070664_100159734
496 Ga0068854_100376532
497 Ga0068854_100976827
498 Ga0068856_100014890
499 Ga0068856_100083109
500 Ga0068856_100597358
501 Ga0068856_101148195
502 Ga0070702_100196436
503 Ga0070702_100547034
504 Ga0068852_100032110
505 Ga0068852_100330042
506 Ga0068859_100146729
507 Ga0068859_100198805
508 Ga0068864_100117536
509 Ga0068864_100225209
510 Ga0068864_100426202
511 Ga0068861_100785061
512 Ga0068851_10107732
513 Ga0068851_10362224
514 Ga0068870_10362898
515 Ga0068858_100289240
516 Ga0068858_100352798
517 Ga0068860_100085808
518 Ga0068860_100798990
519 Ga0068862_100004503
520 Ga0068862_100260944
521 Ga0081455_10025489
522 Ga0081538_10002807
523 Ga0081538_10084571
524 Ga0081538_10111131
525 Ga0081540_1038224
526 Ga0081539_10003904
527 Ga0070717_10136848
528 Ga0075365_10031827
529 Ga0075365_10437991
530 Ga0075363_100019028
531 Ga0075364_10120535
532 Ga0075364_10483558
533 Ga0070716_100328188
534 Ga0070712_100408785
535 Ga0075428_100071488
536 Ga0075428_100326852
537 Ga0075430_100429312
538 Ga0075430_100697919
539 Ga0075431_100024629
540 Ga0075434_100640278
541 Ga0075434_100651336
542 Ga0075429_100100323
543 Ga0068865_100125897
544 Ga0068865_100140799
545 Ga0068865_100861265
546 Ga0075436_100028826
547 Ga0075436_100999651
548 Ga0097620_100146730
549 Ga0097620_100198825
550 Ga0105240_10016164
551 Ga0105240_11462135
552 Ga0111539_10234415
553 Ga0111539_11188200
554 Ga0105245_11055077
555 Ga0105247_10151712
556 Ga0105247_10277568
557 Ga0114129_10192800
558 Ga0114129_10418661
559 Ga0114129_10934063
560 Ga0114129_11193161
561 Ga0105243_10051320
562 Ga0105242_10552857
563 Ga0105248_10111318
564 Ga0105248_10521897
565 Ga0105248_10782208
566 Ga0105248_12739711
567 Ga0105237_10016465
568 Ga0105238_10020958
569 Ga0105249_10015428
570 Ga0105249_10035141
571 Ga0105249_10133586
572 Ga0105239_10131163
573 Ga0105239_10142640
574 Ga0105246_10329444
575 Ga0157370_10102262
576 Ga0157369_10028154
577 Ga0157374_10049441
578 Ga0157378_10285491
579 Ga0163162_10403904
580 Ga0157372_10118058
581 Ga0157372_10423556
582 Ga0157375_10122710
583 Ga0157375_10955651
584 Ga0157375_11966838
585 Ga0163163_10216167
586 Ga0163163_10376141
587 Ga0163163_10835645
588 Ga0182008_10219089
589 Ga0182008_10289276
590 Ga0157377_10049150
591 Ga0157379_10005833
592 Ga0157379_11158821
593 Ga0157376_10277573
594 Ga0163161_11292165
595 Ga0206354_11315557
596 Ga0206353_10308811
597 Ga0206353_10808716
598 Ga0207656_10145147
599 Ga0207692_10199906
600 Ga0207710_10055033
601 Ga0207688_10201725
602 Ga0207688_10212833
603 Ga0207688_10220579
604 Ga0207680_10004564
605 Ga0207645_10095430
606 Ga0207645_10301972
607 Ga0207643_10056548
608 Ga0207643_10232036
609 Ga0207705_10156249
610 Ga0207705_10533238
611 Ga0207654_10115587
612 Ga0207654_10212807
613 Ga0207707_10209468
614 Ga0207695_10222472
615 Ga0207671_10233998
616 Ga0207693_10163648
617 Ga0207660_10074193
618 Ga0207660_10271438
619 Ga0207662_10039154
620 Ga0207662_10369138
621 Ga0207657_10020023
622 Ga0207657_10665064
623 Ga0207649_10149314
624 Ga0207652_10021938
625 Ga0207652_10578923
626 Ga0207694_10762046
627 Ga0207659_10453794
628 Ga0207659_11034045
629 Ga0207687_10150323
630 Ga0207687_10186007
631 Ga0207687_10813772
632 Ga0207700_10023762
633 Ga0207664_10112434
634 Ga0207644_10335553
635 Ga0207690_10059332
636 Ga0207690_10414791
637 Ga0207706_10037446
638 Ga0207706_10179631
639 Ga0207709_10015773
640 Ga0207709_10087241
641 Ga0207669_10398882
642 Ga0207665_10134488
643 Ga0207691_10145350
644 Ga0207711_10468871
645 Ga0207711_11354072
646 Ga0207689_10273355
647 Ga0207661_10115265
648 Ga0207661_10555949
649 Ga0207679_10154437
650 Ga0207679_10975949
651 Ga0207667_10207259
652 Ga0207712_10002739
653 Ga0207712_10259643
654 Ga0207712_10317963
655 Ga0207712_10382928
656 Ga0207668_10012165
657 Ga0207668_10667460
658 Ga0207640_11005978
659 Ga0207658_10002131
660 Ga0207658_10007792
661 Ga0207658_10569634
662 Ga0207677_10009821
663 Ga0207677_10232031
664 Ga0207677_10441099
665 Ga0207703_10041447
666 Ga0207703_10080488
667 Ga0207703_10338666
668 Ga0207639_10018396
669 Ga0207678_10316990
670 Ga0207678_10641720
671 Ga0207708_10019998
672 Ga0207708_10312701
673 Ga0207708_10576928
674 Ga0207702_10056072
675 Ga0207702_10705937
676 Ga0207648_10410217
677 Ga0207676_10113442
678 Ga0207676_10214215
679 Ga0207676_10456229
680 Ga0207676_10778461
681 Ga0207674_10481628
682 Ga0207675_100024309
683 Ga0207675_100823552
684 Ga0207675_100987675
685 Ga0207698_10207194
686 Ga0207698_10603291
687 Ga0207428_10104543
688 Ga0207428_10146004
689 Ga0268266_10000097
690 Ga0268266_10206111
691 Ga0268265_10005144
692 Ga0268265_10049169
693 Ga0307408_100196131
694 Ga0307408_101568290
695 Ga0307410_10759959
696 Ga0307406_10559088
697 Ga0307409_101189934
698 Ga0307416_101296137
699 Ga0307414_10360179
700 Ga0307411_10630772
701 Ga0307415_100247608
702 Ga0307415_100287020
703 Ga0373926_0192603
704 Ga0373940_0156787
705 Ga0373955_0682774
706 Ga0373931_0435591
707 Ga0373935_0069870
708 Ga0373947_0086305
709 Ga0373925_0027990
710 Ga0395900_0556648
711 Ga0395900_0943823
712 Ga0395898_0153851
713 Ga0395905_0210398
714 Ga0395905_0686118
715 Ga0395905_1278951
716 Ga0395901_0357153
717 Ga0395901_0434691
718 Ga0451791_1444831
719 Ga0451793_1918376
720 Ga0451800_0318102
721 Ga0451804_1026339
722 Ga0451837_0468466
723 Ga0451853_1242477
724 Ga0451853_2961412
725 Ga0439459_0086853
726 Ga0439460_0033757
727 Ga0466963_0356232
728 Ga0466971_0297341
729 Ga0466968_0067736
730 Ga0466957_0356737
731 Ga0466957_0458887
732 Ga0466960_0000011
733 Ga0466960_0012514
734 Ga0466960_0042301
735 Ga0466960_0288407
736 Ga0466958_0136671
737 Ga0466958_0332774
738 Ga0466958_0515652
739 Ga0466967_0042760
740 Ga0466967_0161099
741 Ga0466967_0228760
742 Ga0466967_0430982
743 Ga0466967_0583326
744 Ga0466967_1439068
745 Ga0466967_1474531
746 Ga0495617_213717
747 Ga0495616_0365339
748 Ga0495665_0163206
749 Ga0495598_0097055
750 Ga0495621_0249578
751 Ga0495597_0257631
752 Ga0495661_0392633
753 Ga0495658_0085497
754 Ga0495671_0216426
755 Ga0495672_0041449
756 Ga0495676_0004562
757 Ga0495676_0098241
758 Ga0495685_208397
759 Ga0495686_0143759
760 Ga0495614_0217595
761 Ga0496100_0017809
762 Ga0496101_0073778
763 Ga0496102_0112751
764 Ga0496102_0183115
765 Ga0496103_0037012
766 Ga0496103_0070399
767 Ga0496103_0089021
768 Ga0496104_0033388
769 Ga0496104_0086212
770 Ga0496105_0028328
771 Ga0496105_0135677
772 Ga0496106_0055495
773 Ga0496106_0598462
774 Ga0496107_0055473
775 Ga0496107_0056482
776 Ga0496108_0055385
777 Ga0496108_0134318
778 Ga0496108_0184617
779 Ga0496108_1049003
780 Ga0496109_0003104
781 Ga0496109_0068548
782 Ga0496109_0098695
783 Ga0496109_0150717
784 Ga0496109_0270718
785 Ga0496109_0306281
786 Ga0496109_0434829
787 Ga0496110_0018921
788 Ga0496110_0085294
789 Ga0496110_0443892
790 Ga0496110_0539449
791 Ga0496110_0793206
792 Ga0496110_1029222
793 Ga0496111_0049765
794 Ga0496111_0057672
795 Ga0496112_0011598
796 Ga0496112_0023279
797 Ga0496112_0044092
798 Ga0496112_0482238
799 Ga0496112_0541760
800 Ga0496113_0007687
801 Ga0496113_0057058
802 Ga0496113_0173536
803 Ga0496113_0287939
804 Ga0496113_0299584
805 Ga0496114_0036270
806 Ga0496114_0227498
807 Ga0496115_0156668
808 Ga0496118_0048737
809 Ga0496118_0132466
810 Ga0496119_0003887
811 Ga0496121_0004843
812 Ga0496121_0005247
813 Ga0496121_0006688
814 Ga0496121_0063435
815 Ga0496124_0032529
816 Ga0496125_0022408
817 Ga0496125_0384095
818 Ga0496126_0082571
819 Ga0501031_0201843
820 Ga0501032_0075323
821 Ga0501033_0830590
822 Ga0501034_0004053
823 Ga0501034_0381397
824 Ga0501034_0479417
825 Ga0501036_0021330
826 Ga0501036_0063877
827 Ga0501036_0289762
828 Ga0501037_0053451
829 Ga0501038_0117787
830 Ga0501046_0042784
831 Ga0501047_0578968
832 Ga0501048_0042480
833 Ga0501048_0085700
834 Ga0501067_0043471
835 Ga0501069_0059320
836 Ga0501070_0028565
837 Ga0501070_0694898
838 Ga0501070_0749915
839 Ga0501071_0080576
840 Ga0501071_0097559
841 Ga0501071_0682039
842 Ga0501072_0052370
843 Ga0501073_0032275
844 Ga0501074_0398991
845 Ga0501076_0060269
846 Ga0501080_0018515
847 Ga0501081_0966071
848 Ga0501083_0021751
849 Ga0501035_0167206
850 Ga0501044_0315641
851 Ga0501044_0880913
852 Ga0501045_0437348
853 nmdc:mga03n38_531869_c1
854 nmdc:mga00v17_72684_c1
855 nmdc:mga05p37_262541_c1
856 nmdc:mga05p37_638416_c1
857 nmdc:mga05p37_78719_c1
858 nmdc:mga06r32_19787_c1
859 nmdc:mga06r32_2234_c1
860 nmdc:mga08y16_175475_c1
861 nmdc:mga08y16_22894_c1
862 nmdc:mga08y16_272190_c1
863 nmdc:mga0n895_325019_c1
864 nmdc:mga08x19_29684_c1
865 nmdc:mga0a205_166329_c1
866 nmdc:mga0a205_477046_c1
867 nmdc:mga0a205_921841_c1
868 Ga0500568_0041890
869 Ga0501084_0085624
870 Ga0590075_089665
871 Ga0501082_0081751
872 Ga0501082_0129187
873 Ga0501082_0284663
874 Ga0530510_0073593

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

4

178

0.84

Map