F443693

General Info

Members Datasets Scaffolds Average Seq Length
437 206 874 141

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100363346|Ga0070683_1003633462
Length 152
Sequence MSVNPRIGSRPVDGFTFSVPIRVRFADTDAQGVAHNSAYVVWFEVARVEYLREFAGGYQALRDQGIEALVLESLCRYRIPAKFDDELVVHTRCLGPRGARFRYEYAIVRGDELLADGHTEHACVDAQTFRPTRVPEWLADAIRAAEGASSSA

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
82 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
83 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
84 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
85 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
86 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
87 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
88 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
91 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
92 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
93 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
94 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
106 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
107 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
108 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
125 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
126 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
148 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
149 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
204 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.92
Rhizosphere 90.85
Stem 0
Stem Tuber 0
Unclassified 15.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100363346 3300005329 Bacteria 1379
2 Ga0070658_10049760 3300005327 Bacteria 3396
3 Ga0070683_100009700 3300005329 Bacteria 8243
4 Ga0070683_101825008 3300005329 Bacteria 584
5 Ga0070680_100089595 3300005336 Bacteria 2546
6 Ga0070680_100109852 3300005336 Bacteria 2295
7 Ga0070682_100017324 3300005337 Bacteria 4198
8 Ga0070682_101273326 3300005337 Bacteria 624
9 Ga0068868_100159763 3300005338 Bacteria 1860
10 Ga0068868_100513830 3300005338 Unclassified 1051
11 Ga0068868_100571461 3300005338 Bacteria 999
12 Ga0070660_100093102 3300005339 Bacteria 2379
13 Ga0070691_10018737 3300005341 Bacteria 3192
14 Ga0070692_10346878 3300005345 Bacteria 921
15 Ga0070671_100052342 3300005355 Bacteria 3395
16 Ga0070671_100809599 3300005355 Bacteria 816
17 Ga0070659_100215144 3300005366 Bacteria 1585
18 Ga0070709_10157659 3300005434 Bacteria 1575
19 Ga0070709_10343144 3300005434 Bacteria 1101
20 Ga0070714_100007131 3300005435 Bacteria 8671
21 Ga0070714_100010211 3300005435 Bacteria 7411
22 Ga0070714_100160343 3300005435 Bacteria 2034
23 Ga0070714_100926105 3300005435 Bacteria 846
24 Ga0070713_100436553 3300005436 Bacteria 1228
25 Ga0070713_100722125 3300005436 Bacteria 952
26 Ga0070710_10886852 3300005437 Bacteria 643
27 Ga0070708_100596357 3300005445 Unclassified 1041
28 Ga0070678_100759398 3300005456 Bacteria 878
29 Ga0070681_10189851 3300005458 Bacteria 1974
30 Ga0070681_10376405 3300005458 Bacteria 1330
31 Ga0070681_10971718 3300005458 Bacteria 769
32 Ga0068867_101343236 3300005459 Bacteria 661
33 Ga0070706_100242450 3300005467 Bacteria 1683
34 Ga0070707_100056597 3300005468 Unclassified 3761
35 Ga0070698_100407342 3300005471 Bacteria 1293
36 Ga0070699_100889468 3300005518 Bacteria 816
37 Ga0070679_100015385 3300005530 Bacteria 7351
38 Ga0070679_100039492 3300005530 Bacteria 4690
39 Ga0070679_100312865 3300005530 Unclassified 1520
40 Ga0070684_100315153 3300005535 Bacteria 1436
41 Ga0070684_100496992 3300005535 Bacteria 1130
42 Ga0068853_101830008 3300005539 Bacteria 589
43 Ga0070686_100500696 3300005544 Bacteria 943
44 Ga0070695_100003203 3300005545 Bacteria 9558
45 Ga0070693_100254423 3300005547 Bacteria 1166
46 Ga0068855_100019092 3300005563 Bacteria 8239
47 Ga0068857_100480925 3300005577 Bacteria 1164
48 Ga0068856_100054055 3300005614 Bacteria 3960
49 Ga0068856_100177626 3300005614 Bacteria 2142
50 Ga0070702_100176319 3300005615 Bacteria 1395
51 Ga0070702_100979217 3300005615 Bacteria 668
52 Ga0068864_101271970 3300005618 Bacteria 736
53 Ga0068863_101867431 3300005841 Bacteria 611
54 Ga0070717_10002024 3300006028 Bacteria 14193
55 Ga0070717_10016783 3300006028 Bacteria 5683
56 Ga0070717_10065331 3300006028 Bacteria 3024
57 Ga0070716_101310711 3300006173 Bacteria 586
58 Ga0070712_100119337 3300006175 Bacteria 1982
59 Ga0075434_100003940 3300006871 Bacteria 13301
60 Ga0068865_100845389 3300006881 Bacteria 792
61 Ga0105240_10026508 3300009093 Bacteria 7605
62 Ga0105245_10534125 3300009098 Bacteria 1193
63 Ga0105241_11468579 3300009174 Bacteria 655
64 Ga0105242_11298429 3300009176 Bacteria 751
65 Ga0105248_10505902 3300009177 Bacteria 1362
66 Ga0105237_10168792 3300009545 Bacteria 2188
67 Ga0105238_10039642 3300009551 Bacteria 4776
68 Ga0105249_11308539 3300009553 Bacteria 796
69 Ga0105246_10965093 3300011119 Bacteria 769
70 Ga0157369_10040788 3300013105 Bacteria 5068
71 Ga0157374_11382139 3300013296 Unclassified 727
72 Ga0163162_10330206 3300013306 Bacteria 1657
73 Ga0157372_10151631 3300013307 Bacteria 2676
74 Ga0157372_10472515 3300013307 Bacteria 1462
75 Ga0157372_11019161 3300013307 Bacteria 959
76 Ga0157372_12228589 3300013307 Bacteria 629
77 Ga0157375_10193486 3300013308 Bacteria 2189
78 Ga0182008_10124156 3300014497 Bacteria 1284
79 Ga0157377_10088199 3300014745 Bacteria 1827
80 Ga0157376_10109801 3300014969 Bacteria 2425
81 Ga0206356_10849764 3300020070 Bacteria 1321
82 Ga0206353_10043102 3300020082 Bacteria 2298
83 Ga0207684_10318013 3300025910 Bacteria 1342
84 Ga0207707_10131576 3300025912 Bacteria 2188
85 Ga0207707_10710780 3300025912 Bacteria 843
86 Ga0207695_10290911 3300025913 Bacteria 1526
87 Ga0207671_10664210 3300025914 Bacteria 830
88 Ga0207693_10121343 3300025915 Bacteria 2053
89 Ga0207693_10482029 3300025915 Bacteria 968
90 Ga0207693_11033892 3300025915 Bacteria 626
91 Ga0207660_10040777 3300025917 Bacteria 3252
92 Ga0207657_10004929 3300025919 Bacteria 14033
93 Ga0207652_10778811 3300025921 Bacteria 850
94 Ga0207646_10006959 3300025922 Bacteria 11595
95 Ga0207646_10112766 3300025922 Unclassified 2440
96 Ga0207694_10835536 3300025924 Bacteria 778
97 Ga0207687_10256037 3300025927 Bacteria 1394
98 Ga0207687_10561390 3300025927 Bacteria 959
99 Ga0207700_10134286 3300025928 Bacteria 2025
100 Ga0207700_10896737 3300025928 Bacteria 793
101 Ga0207664_10054735 3300025929 Bacteria 3163
102 Ga0207664_10123492 3300025929 Bacteria 2170
103 Ga0207664_10142268 3300025929 Bacteria 2030
104 Ga0207664_10505589 3300025929 Unclassified 1082
105 Ga0207664_11078894 3300025929 Unclassified 718
106 Ga0207664_11414126 3300025929 Bacteria 616
107 Ga0207644_10871929 3300025931 Unclassified 754
108 Ga0207690_10955083 3300025932 Bacteria 712
109 Ga0207661_10249059 3300025944 Bacteria 1578
110 Ga0207661_10976457 3300025944 Bacteria 780
111 Ga0207679_10218726 3300025945 Bacteria 1602
112 Ga0207667_11890463 3300025949 Bacteria 559
113 Ga0207702_10173149 3300026078 Bacteria 1981
114 Ga0207702_10366925 3300026078 Bacteria 1381
115 Ga0207641_10919956 3300026088 Bacteria 869
116 Ga0207676_10761758 3300026095 Bacteria 942
117 Ga0207674_10177664 3300026116 Bacteria 2081
118 Ga0265337_1032996 3300028556 Unclassified 1529
119 Ga0265326_10039723 3300028558 Bacteria 1336
120 Ga0265319_1000793 3300028563 Bacteria 20469
121 Ga0265319_1005311 3300028563 Bacteria 6185
122 Ga0265319_1008984 3300028563 Bacteria 4314
123 Ga0265319_1138565 3300028563 Unclassified 755
124 Ga0265334_10000386 3300028573 Bacteria 23500
125 Ga0265334_10012271 3300028573 Bacteria 3601
126 Ga0265318_10000286 3300028577 Bacteria 41428
127 Ga0265318_10012283 3300028577 Bacteria 3651
128 Ga0265318_10044435 3300028577 Unclassified 1681
129 Ga0265323_10025930 3300028653 Bacteria 2213
130 Ga0265323_10155139 3300028653 Bacteria 732
131 Ga0265322_10035296 3300028654 Bacteria 1425
132 Ga0265336_10008782 3300028666 Bacteria 3523
133 Ga0265336_10009096 3300028666 Bacteria 3448
134 Ga0265338_10004582 3300028800 Bacteria 18589
135 Ga0265338_10049124 3300028800 Bacteria 3828
136 Ga0265338_10149355 3300028800 Bacteria 1817
137 Ga0265338_10190834 3300028800 Unclassified 1553
138 Ga0265324_10059802 3300029957 Unclassified 1303
139 Ga0265330_10000170 3300031235 Bacteria 51357
140 Ga0265330_10111130 3300031235 Bacteria 1170
141 Ga0265332_10000981 3300031238 Bacteria 16887
142 Ga0265328_10000396 3300031239 Bacteria 20417
143 Ga0265320_10011607 3300031240 Bacteria 5173
144 Ga0265320_10133625 3300031240 Bacteria 1126
145 Ga0265320_10458129 3300031240 Unclassified 563
146 Ga0265325_10000058 3300031241 Bacteria 76250
147 Ga0265329_10008869 3300031242 Unclassified 3788
148 Ga0265329_10099004 3300031242 Bacteria 928
149 Ga0265340_10012390 3300031247 Bacteria 4505
150 Ga0265340_10499923 3300031247 Unclassified 535
151 Ga0265339_10001168 3300031249 Bacteria 19822
152 Ga0265339_10076874 3300031249 Bacteria 1770
153 Ga0265331_10000568 3300031250 Bacteria 33224
154 Ga0265327_10004500 3300031251 Bacteria 12303
155 Ga0265316_10000700 3300031344 Bacteria 37322
156 Ga0265316_10018204 3300031344 Bacteria 6044
157 Ga0265313_10000754 3300031595 Bacteria 33060
158 Ga0265314_10000982 3300031711 Bacteria 33556
159 Ga0265342_10001473 3300031712 Bacteria 21888
160 Ga0265342_10012200 3300031712 Bacteria 5829
161 Ga0373939_0443644 3300035114 Unclassified 545
162 Ga0373953_0046996 3300035117 Unclassified 1735
163 Ga0373946_0382170 3300035171 Bacteria 708
164 Ga0373924_0048491 3300035410 Bacteria 1755
165 Ga0373931_0323532 3300035691 Bacteria 958
166 Ga0373947_1085004 3300035725 Unclassified 546
167 Ga0373937_0001461 3300036401 Bacteria 19779
168 Ga0373937_0168436 3300036401 Unclassified 2055
169 Ga0373937_0306740 3300036401 Bacteria 1501
170 Ga0373937_1582567 3300036401 Bacteria 603
171 Ga0373925_0685678 3300037068 Bacteria 845
172 Ga0373925_0990564 3300037068 Bacteria 692
173 Ga0395899_0101385 3300037312 Bacteria 2078
174 Ga0395900_0017016 3300037418 Bacteria 7421
175 Ga0395898_0519168 3300037466 Bacteria 1132
176 Ga0395905_0099711 3300037471 Bacteria 2728
177 Ga0395901_0299882 3300038443 Bacteria 1666
178 Ga0451853_2003087 3300041512 Bacteria 572
179 Ga0466972_0017345 3300044658 Bacteria 3605
180 Ga0466965_0333608 3300044683 Bacteria 828
181 Ga0466965_0492972 3300044683 Bacteria 686
182 Ga0466966_0004115 3300044684 Bacteria 9606
183 Ga0466961_0094968 3300044693 Bacteria 1881
184 Ga0466963_0000400 3300044694 Bacteria 19783
185 Ga0466963_0000752 3300044694 Bacteria 16002
186 Ga0466963_0010150 3300044694 Bacteria 5694
187 Ga0466963_0014514 3300044694 Bacteria 4859
188 Ga0466963_0018057 3300044694 Bacteria 4402
189 Ga0466963_0025530 3300044694 Bacteria 3769
190 Ga0466963_0245885 3300044694 Bacteria 1255
191 Ga0466963_0275154 3300044694 Bacteria 1183
192 Ga0466964_0000980 3300044706 Bacteria 9461
193 Ga0466964_0003183 3300044706 Bacteria 5968
194 Ga0466964_0005022 3300044706 Bacteria 4891
195 Ga0466964_0041430 3300044706 Bacteria 1862
196 Ga0466964_0068559 3300044706 Bacteria 1494
197 Ga0466964_0072606 3300044706 Bacteria 1459
198 Ga0466964_0858590 3300044706 Unclassified 517
199 Ga0466964_0884654 3300044706 Bacteria 510
200 Ga0466971_0006205 3300044719 Bacteria 5194
201 Ga0466971_0016908 3300044719 Bacteria 3223
202 Ga0466968_0004902 3300044735 Bacteria 5008
203 Ga0466968_0025537 3300044735 Bacteria 2419
204 Ga0466968_0055142 3300044735 Unclassified 1705
205 Ga0466968_0134769 3300044735 Bacteria 1126
206 Ga0466968_0154590 3300044735 Bacteria 1056
207 Ga0466968_0186659 3300044735 Bacteria 966
208 Ga0466970_0051920 3300044765 Bacteria 2189
209 Ga0466957_0011673 3300044842 Bacteria 5077
210 Ga0466957_0057418 3300044842 Bacteria 2382
211 Ga0466957_0062718 3300044842 Bacteria 2283
212 Ga0466957_0548576 3300044842 Bacteria 805
213 Ga0466957_0612130 3300044842 Unclassified 763
214 Ga0466957_0727673 3300044842 Bacteria 701
215 Ga0466957_0804817 3300044842 Bacteria 668
216 Ga0466960_0031960 3300044901 Bacteria 2432
217 Ga0466960_0099508 3300044901 Bacteria 1495
218 Ga0466959_0901324 3300045049 Bacteria 590
219 Ga0466958_0005521 3300045836 Bacteria 6818
220 Ga0466958_0008174 3300045836 Bacteria 5792
221 Ga0466958_0014182 3300045836 Bacteria 4548
222 Ga0466958_0327740 3300045836 Bacteria 984
223 Ga0466967_0002083 3300045976 Bacteria 12245
224 Ga0466967_0002624 3300045976 Bacteria 11319
225 Ga0466967_0016832 3300045976 Bacteria 5780
226 Ga0466967_0042123 3300045976 Bacteria 3943
227 Ga0466967_0048807 3300045976 Bacteria 3699
228 Ga0466967_0104122 3300045976 Bacteria 2597
229 Ga0466967_0273916 3300045976 Bacteria 1618
230 Ga0466967_0347598 3300045976 Bacteria 1435
231 Ga0466967_0463128 3300045976 Bacteria 1240
232 Ga0466967_0579007 3300045976 Bacteria 1106
233 Ga0466967_0671386 3300045976 Bacteria 1025
234 Ga0466967_0701197 3300045976 Bacteria 1002
235 Ga0466967_0840342 3300045976 Bacteria 912
236 Ga0466967_0873011 3300045976 Archaea 894
237 Ga0495592_0000048 3300046454 Bacteria 114599
238 Ga0495592_0141409 3300046454 Unclassified 1673
239 Ga0495592_0257916 3300046454 Bacteria 1149
240 Ga0495603_0013422 3300046455 Bacteria 4955
241 Ga0495603_0424849 3300046455 Bacteria 761
242 Ga0495629_0076774 3300046459 Bacteria 2332
243 Ga0495629_0240779 3300046459 Bacteria 1246
244 Ga0495629_0482669 3300046459 Bacteria 837
245 Ga0495629_0740906 3300046459 Unclassified 651
246 Ga0495629_0787985 3300046459 Bacteria 627
247 Ga0495641_0003996 3300046461 Bacteria 10695
248 Ga0495641_0054504 3300046461 Bacteria 1817
249 Ga0495651_0000049 3300046462 Bacteria 88249
250 Ga0495651_0171550 3300046462 Unclassified 1544
251 Ga0495653_0000489 3300046463 Bacteria 30700
252 Ga0495653_0054747 3300046463 Bacteria 3047
253 Ga0495653_0078283 3300046463 Bacteria 2452
254 Ga0495653_0496473 3300046463 Bacteria 761
255 Ga0495582_0056816 3300046473 Bacteria 2157
256 Ga0495582_0089742 3300046473 Bacteria 1713
257 Ga0495582_0196259 3300046473 Unclassified 1152
258 Ga0495582_0216919 3300046473 Unclassified 1094
259 Ga0495639_0040434 3300046475 Bacteria 2098
260 Ga0495639_0398995 3300046475 Bacteria 695
261 Ga0495664_0073069 3300046477 Unclassified 2050
262 Ga0495585_0104250 3300046492 Bacteria 1514
263 Ga0495608_0003026 3300046511 Bacteria 11997
264 Ga0495608_0005307 3300046511 Bacteria 9210
265 Ga0495608_0013996 3300046511 Bacteria 5565
266 Ga0495608_0070336 3300046511 Bacteria 2284
267 Ga0495608_0373255 3300046511 Bacteria 875
268 Ga0495608_0651087 3300046511 Bacteria 629
269 Ga0495608_0705128 3300046511 Bacteria 600
270 Ga0495618_0006054 3300046514 Bacteria 7342
271 Ga0495618_0050114 3300046514 Bacteria 2637
272 Ga0495618_0173335 3300046514 Unclassified 1372
273 Ga0495618_0471963 3300046514 Unclassified 759
274 Ga0495618_0516674 3300046514 Bacteria 718
275 Ga0495628_0000026 3300046516 Bacteria 127398
276 Ga0495628_0092281 3300046516 Bacteria 2343
277 Ga0495628_0143625 3300046516 Unclassified 1820
278 Ga0495628_0811603 3300046516 Bacteria 654
279 Ga0495630_0045747 3300046517 Bacteria 3271
280 Ga0495630_0081421 3300046517 Bacteria 2443
281 Ga0495630_0086145 3300046517 Bacteria 2372
282 Ga0495630_0313841 3300046517 Unclassified 1198
283 Ga0495630_0617657 3300046517 Bacteria 831
284 Ga0495630_1096828 3300046517 Bacteria 603
285 Ga0495644_0001562 3300046523 Bacteria 9331
286 Ga0495663_0157493 3300046525 Bacteria 778
287 Ga0495642_0290692 3300046528 Bacteria 716
288 Ga0495652_0000172 3300046529 Bacteria 74042
289 Ga0495652_0035634 3300046529 Bacteria 4330
290 Ga0495652_0127042 3300046529 Bacteria 2024
291 Ga0495652_0415226 3300046529 Bacteria 949
292 Ga0495652_0831971 3300046529 Bacteria 613
293 Ga0495665_0447160 3300046531 Bacteria 653
294 Ga0495640_0004584 3300046533 Bacteria 11021
295 Ga0495640_0170622 3300046533 Bacteria 1390
296 Ga0495640_0609615 3300046533 Bacteria 659
297 Ga0495586_0094224 3300046535 Bacteria 1656
298 Ga0495586_0117426 3300046535 Unclassified 1484
299 Ga0495586_0644086 3300046535 Bacteria 612
300 Ga0495587_0000362 3300046536 Bacteria 32677
301 Ga0495587_0163661 3300046536 Unclassified 1265
302 Ga0495587_0430387 3300046536 Unclassified 732
303 Ga0495645_0000016 3300046543 Bacteria 158415
304 Ga0495645_0037319 3300046543 Bacteria 3541
305 Ga0495645_0051923 3300046543 Bacteria 2983
306 Ga0495645_0112627 3300046543 Bacteria 1924
307 Ga0495645_0350836 3300046543 Bacteria 951
308 Ga0495645_0362074 3300046543 Unclassified 932
309 Ga0495667_0001379 3300046559 Bacteria 15997
310 Ga0495667_0056604 3300046559 Bacteria 2578
311 Ga0495667_0268845 3300046559 Bacteria 1083
312 Ga0495656_0036346 3300046615 Bacteria 2028
313 Ga0495668_0106225 3300046616 Bacteria 1536
314 Ga0495634_0072981 3300046642 Bacteria 2257
315 Ga0495634_0203907 3300046642 Unclassified 1227
316 Ga0495634_0328269 3300046642 Unclassified 920
317 Ga0495635_0038583 3300046663 Bacteria 3306
318 Ga0495635_0137454 3300046663 Unclassified 1665
319 Ga0495635_0453573 3300046663 Bacteria 847
320 Ga0495661_0255584 3300046665 Bacteria 892
321 Ga0495657_0002580 3300046675 Bacteria 15174
322 Ga0495657_0006142 3300046675 Bacteria 9412
323 Ga0495657_0045931 3300046675 Bacteria 2961
324 Ga0495657_0187042 3300046675 Unclassified 1267
325 Ga0495599_0000016 3300046678 Bacteria 169605
326 Ga0495599_0011586 3300046678 Bacteria 5423
327 Ga0495599_0232430 3300046678 Unclassified 1125
328 Ga0495623_0000046 3300046679 Bacteria 74571
329 Ga0495623_0194438 3300046679 Unclassified 1170
330 Ga0495646_0003505 3300046680 Bacteria 9770
331 Ga0495658_0034158 3300046683 Bacteria 2789
332 Ga0495658_0044125 3300046683 Bacteria 2497
333 Ga0495613_0139196 3300046689 Unclassified 1735
334 Ga0495613_0239687 3300046689 Unclassified 1268
335 Ga0495624_0003996 3300046690 Bacteria 10855
336 Ga0495624_0048741 3300046690 Bacteria 2687
337 Ga0495670_0327770 3300046691 Bacteria 822
338 Ga0495600_0016262 3300046809 Bacteria 4719
339 Ga0495600_0065238 3300046809 Bacteria 2380
340 Ga0495600_0089932 3300046809 Unclassified 2002
341 Ga0495600_0389246 3300046809 Bacteria 869
342 Ga0495581_0105523 3300047315 Bacteria 1637
343 Ga0495604_0000004 3300047317 Bacteria 456385
344 Ga0495604_0076658 3300047317 Bacteria 2514
345 Ga0495604_0314627 3300047317 Bacteria 1048
346 Ga0495674_0091626 3300047319 Bacteria 2596
347 Ga0495674_0175945 3300047319 Unclassified 1783
348 Ga0495674_0185582 3300047319 Unclassified 1731
349 Ga0495674_0405479 3300047319 Bacteria 1100
350 Ga0495676_0188462 3300047321 Bacteria 1440
351 Ga0495676_0207079 3300047321 Bacteria 1359
352 Ga0495676_0687708 3300047321 Bacteria 662
353 Ga0495676_0733767 3300047321 Bacteria 638
354 Ga0495680_0009072 3300047322 Bacteria 8980
355 Ga0495680_0035895 3300047322 Bacteria 3986
356 Ga0495680_0107560 3300047322 Bacteria 2071
357 Ga0495680_0122416 3300047322 Bacteria 1919
358 Ga0495680_0202460 3300047322 Bacteria 1423
359 Ga0495680_0434341 3300047322 Bacteria 901
360 Ga0495680_0938652 3300047322 Bacteria 556
361 Ga0495675_0000079 3300047444 Bacteria 68947
362 Ga0495675_0669610 3300047444 Unclassified 583
363 Ga0495684_0000645 3300047471 Bacteria 28045
364 Ga0495684_0434168 3300047471 Bacteria 916
365 Ga0495593_0083851 3300047673 Bacteria 1646
366 Ga0495602_0000351 3300048088 Bacteria 42756
367 Ga0495602_0315365 3300048088 Unclassified 1139
368 Ga0495614_0036519 3300048089 Bacteria 2110
369 Ga0496100_1610421 3300048903 Bacteria 513
370 Ga0496101_0147490 3300048904 Bacteria 1797
371 Ga0496101_0161717 3300048904 Bacteria 1717
372 Ga0496101_1296027 3300048904 Unclassified 570
373 Ga0496102_0019429 3300048905 Bacteria 5985
374 Ga0496102_0083378 3300048905 Bacteria 2950
375 Ga0496103_0020210 3300048906 Bacteria 3999
376 Ga0496104_0046579 3300048907 Bacteria 4083
377 Ga0496104_0261656 3300048907 Bacteria 1643
378 Ga0496104_0539937 3300048907 Unclassified 1077
379 Ga0496104_1123931 3300048907 Bacteria 689
380 Ga0496105_0114110 3300048908 Bacteria 2228
381 Ga0496105_0115182 3300048908 Unclassified 2217
382 Ga0496106_0222747 3300048909 Unclassified 1505
383 Ga0496106_0430416 3300048909 Bacteria 1060
384 Ga0496106_0672724 3300048909 Unclassified 826
385 Ga0496107_0046342 3300048910 Bacteria 3129
386 Ga0496108_0039313 3300048911 Bacteria 3943
387 Ga0496108_0185455 3300048911 Bacteria 1802
388 Ga0496108_0256185 3300048911 Unclassified 1522
389 Ga0496109_0058049 3300048912 Bacteria 3534
390 Ga0496109_0075153 3300048912 Bacteria 3106
391 Ga0496109_0262412 3300048912 Bacteria 1627
392 Ga0496110_0039706 3300048913 Bacteria 4099
393 Ga0496111_0095279 3300048914 Bacteria 2184
394 Ga0496111_0261053 3300048914 Bacteria 1285
395 Ga0496111_0758655 3300048914 Bacteria 703
396 Ga0496112_0123697 3300048915 Bacteria 2558
397 Ga0496112_0240340 3300048915 Bacteria 1764
398 Ga0496112_0441006 3300048915 Unclassified 1240
399 Ga0496112_0456391 3300048915 Bacteria 1215
400 Ga0496112_0539077 3300048915 Unclassified 1101
401 Ga0496113_0093930 3300048916 Bacteria 2316
402 Ga0496113_0414127 3300048916 Unclassified 1082
403 Ga0496114_0213909 3300048917 Bacteria 1691
404 Ga0496114_0358651 3300048917 Unclassified 1290
405 Ga0496115_0006663 3300048918 Bacteria 8476
406 Ga0496115_0073871 3300048918 Bacteria 2768
407 Ga0496115_0106606 3300048918 Bacteria 2300
408 Ga0501067_0016972 3300049583 Bacteria 4022
409 Ga0501067_0107706 3300049583 Bacteria 1549
410 Ga0501067_0216741 3300049583 Unclassified 1066
411 Ga0501069_0063408 3300049585 Bacteria 2064
412 Ga0501069_0163828 3300049585 Unclassified 1281
413 Ga0501070_1423512 3300049586 Unclassified 526
414 nmdc:mga0n895_7131_c1 3300050512 Bacteria 9554
415 nmdc:mga0rr50_315364_c1 3300050513 Bacteria 1310
416 Ga0495601_0000896 3300053077 Bacteria 16243
417 Ga0495601_0127403 3300053077 Bacteria 1656
418 Ga0495601_0153527 3300053077 Unclassified 1503
419 Ga0495601_0724904 3300053077 Bacteria 633
420 Ga0495612_0002591 3300053078 Bacteria 7456
421 Ga0495612_0028085 3300053078 Unclassified 2264
422 Ga0495612_0185722 3300053078 Bacteria 914
423 Ga0495595_0024683 3300053084 Bacteria 2656
424 Ga0495595_0035190 3300053084 Unclassified 2269
425 Ga0495595_0061991 3300053084 Bacteria 1752
426 Ga0495595_0065538 3300053084 Unclassified 1708
427 Ga0495595_0203609 3300053084 Bacteria 985
428 Ga0495619_0006645 3300053085 Bacteria 7320
429 Ga0495619_0016523 3300053085 Bacteria 4672
430 Ga0495619_0071206 3300053085 Bacteria 2326
431 Ga0495619_0291280 3300053085 Bacteria 1131
432 Ga0495619_0305444 3300053085 Bacteria 1102
433 Ga0495619_0342680 3300053085 Unclassified 1034
434 Ga0495619_0829421 3300053085 Bacteria 624
435 Ga0466962_0000230 3300061719 Bacteria 23282
436 Ga0466962_0012619 3300061719 Bacteria 4064
437 Ga0466962_0070784 3300061719 Bacteria 1667
438 Ga0070683_100363346
439 Ga0070658_10049760
440 Ga0070683_100009700
441 Ga0070683_101825008
442 Ga0070680_100089595
443 Ga0070680_100109852
444 Ga0070682_100017324
445 Ga0070682_101273326
446 Ga0068868_100159763
447 Ga0068868_100513830
448 Ga0068868_100571461
449 Ga0070660_100093102
450 Ga0070691_10018737
451 Ga0070692_10346878
452 Ga0070671_100052342
453 Ga0070671_100809599
454 Ga0070659_100215144
455 Ga0070709_10157659
456 Ga0070709_10343144
457 Ga0070714_100007131
458 Ga0070714_100010211
459 Ga0070714_100160343
460 Ga0070714_100926105
461 Ga0070713_100436553
462 Ga0070713_100722125
463 Ga0070710_10886852
464 Ga0070708_100596357
465 Ga0070678_100759398
466 Ga0070681_10189851
467 Ga0070681_10376405
468 Ga0070681_10971718
469 Ga0068867_101343236
470 Ga0070706_100242450
471 Ga0070707_100056597
472 Ga0070698_100407342
473 Ga0070699_100889468
474 Ga0070679_100015385
475 Ga0070679_100039492
476 Ga0070679_100312865
477 Ga0070684_100315153
478 Ga0070684_100496992
479 Ga0068853_101830008
480 Ga0070686_100500696
481 Ga0070695_100003203
482 Ga0070693_100254423
483 Ga0068855_100019092
484 Ga0068857_100480925
485 Ga0068856_100054055
486 Ga0068856_100177626
487 Ga0070702_100176319
488 Ga0070702_100979217
489 Ga0068864_101271970
490 Ga0068863_101867431
491 Ga0070717_10002024
492 Ga0070717_10016783
493 Ga0070717_10065331
494 Ga0070716_101310711
495 Ga0070712_100119337
496 Ga0075434_100003940
497 Ga0068865_100845389
498 Ga0105240_10026508
499 Ga0105245_10534125
500 Ga0105241_11468579
501 Ga0105242_11298429
502 Ga0105248_10505902
503 Ga0105237_10168792
504 Ga0105238_10039642
505 Ga0105249_11308539
506 Ga0105246_10965093
507 Ga0157369_10040788
508 Ga0157374_11382139
509 Ga0163162_10330206
510 Ga0157372_10151631
511 Ga0157372_10472515
512 Ga0157372_11019161
513 Ga0157372_12228589
514 Ga0157375_10193486
515 Ga0182008_10124156
516 Ga0157377_10088199
517 Ga0157376_10109801
518 Ga0206356_10849764
519 Ga0206353_10043102
520 Ga0207684_10318013
521 Ga0207707_10131576
522 Ga0207707_10710780
523 Ga0207695_10290911
524 Ga0207671_10664210
525 Ga0207693_10121343
526 Ga0207693_10482029
527 Ga0207693_11033892
528 Ga0207660_10040777
529 Ga0207657_10004929
530 Ga0207652_10778811
531 Ga0207646_10006959
532 Ga0207646_10112766
533 Ga0207694_10835536
534 Ga0207687_10256037
535 Ga0207687_10561390
536 Ga0207700_10134286
537 Ga0207700_10896737
538 Ga0207664_10054735
539 Ga0207664_10123492
540 Ga0207664_10142268
541 Ga0207664_10505589
542 Ga0207664_11078894
543 Ga0207664_11414126
544 Ga0207644_10871929
545 Ga0207690_10955083
546 Ga0207661_10249059
547 Ga0207661_10976457
548 Ga0207679_10218726
549 Ga0207667_11890463
550 Ga0207702_10173149
551 Ga0207702_10366925
552 Ga0207641_10919956
553 Ga0207676_10761758
554 Ga0207674_10177664
555 Ga0265337_1032996
556 Ga0265326_10039723
557 Ga0265319_1000793
558 Ga0265319_1005311
559 Ga0265319_1008984
560 Ga0265319_1138565
561 Ga0265334_10000386
562 Ga0265334_10012271
563 Ga0265318_10000286
564 Ga0265318_10012283
565 Ga0265318_10044435
566 Ga0265323_10025930
567 Ga0265323_10155139
568 Ga0265322_10035296
569 Ga0265336_10008782
570 Ga0265336_10009096
571 Ga0265338_10004582
572 Ga0265338_10049124
573 Ga0265338_10149355
574 Ga0265338_10190834
575 Ga0265324_10059802
576 Ga0265330_10000170
577 Ga0265330_10111130
578 Ga0265332_10000981
579 Ga0265328_10000396
580 Ga0265320_10011607
581 Ga0265320_10133625
582 Ga0265320_10458129
583 Ga0265325_10000058
584 Ga0265329_10008869
585 Ga0265329_10099004
586 Ga0265340_10012390
587 Ga0265340_10499923
588 Ga0265339_10001168
589 Ga0265339_10076874
590 Ga0265331_10000568
591 Ga0265327_10004500
592 Ga0265316_10000700
593 Ga0265316_10018204
594 Ga0265313_10000754
595 Ga0265314_10000982
596 Ga0265342_10001473
597 Ga0265342_10012200
598 Ga0373939_0443644
599 Ga0373953_0046996
600 Ga0373946_0382170
601 Ga0373924_0048491
602 Ga0373931_0323532
603 Ga0373947_1085004
604 Ga0373937_0001461
605 Ga0373937_0168436
606 Ga0373937_0306740
607 Ga0373937_1582567
608 Ga0373925_0685678
609 Ga0373925_0990564
610 Ga0395899_0101385
611 Ga0395900_0017016
612 Ga0395898_0519168
613 Ga0395905_0099711
614 Ga0395901_0299882
615 Ga0451853_2003087
616 Ga0466972_0017345
617 Ga0466965_0333608
618 Ga0466965_0492972
619 Ga0466966_0004115
620 Ga0466961_0094968
621 Ga0466963_0000400
622 Ga0466963_0000752
623 Ga0466963_0010150
624 Ga0466963_0014514
625 Ga0466963_0018057
626 Ga0466963_0025530
627 Ga0466963_0245885
628 Ga0466963_0275154
629 Ga0466964_0000980
630 Ga0466964_0003183
631 Ga0466964_0005022
632 Ga0466964_0041430
633 Ga0466964_0068559
634 Ga0466964_0072606
635 Ga0466964_0858590
636 Ga0466964_0884654
637 Ga0466971_0006205
638 Ga0466971_0016908
639 Ga0466968_0004902
640 Ga0466968_0025537
641 Ga0466968_0055142
642 Ga0466968_0134769
643 Ga0466968_0154590
644 Ga0466968_0186659
645 Ga0466970_0051920
646 Ga0466957_0011673
647 Ga0466957_0057418
648 Ga0466957_0062718
649 Ga0466957_0548576
650 Ga0466957_0612130
651 Ga0466957_0727673
652 Ga0466957_0804817
653 Ga0466960_0031960
654 Ga0466960_0099508
655 Ga0466959_0901324
656 Ga0466958_0005521
657 Ga0466958_0008174
658 Ga0466958_0014182
659 Ga0466958_0327740
660 Ga0466967_0002083
661 Ga0466967_0002624
662 Ga0466967_0016832
663 Ga0466967_0042123
664 Ga0466967_0048807
665 Ga0466967_0104122
666 Ga0466967_0273916
667 Ga0466967_0347598
668 Ga0466967_0463128
669 Ga0466967_0579007
670 Ga0466967_0671386
671 Ga0466967_0701197
672 Ga0466967_0840342
673 Ga0466967_0873011
674 Ga0495592_0000048
675 Ga0495592_0141409
676 Ga0495592_0257916
677 Ga0495603_0013422
678 Ga0495603_0424849
679 Ga0495629_0076774
680 Ga0495629_0240779
681 Ga0495629_0482669
682 Ga0495629_0740906
683 Ga0495629_0787985
684 Ga0495641_0003996
685 Ga0495641_0054504
686 Ga0495651_0000049
687 Ga0495651_0171550
688 Ga0495653_0000489
689 Ga0495653_0054747
690 Ga0495653_0078283
691 Ga0495653_0496473
692 Ga0495582_0056816
693 Ga0495582_0089742
694 Ga0495582_0196259
695 Ga0495582_0216919
696 Ga0495639_0040434
697 Ga0495639_0398995
698 Ga0495664_0073069
699 Ga0495585_0104250
700 Ga0495608_0003026
701 Ga0495608_0005307
702 Ga0495608_0013996
703 Ga0495608_0070336
704 Ga0495608_0373255
705 Ga0495608_0651087
706 Ga0495608_0705128
707 Ga0495618_0006054
708 Ga0495618_0050114
709 Ga0495618_0173335
710 Ga0495618_0471963
711 Ga0495618_0516674
712 Ga0495628_0000026
713 Ga0495628_0092281
714 Ga0495628_0143625
715 Ga0495628_0811603
716 Ga0495630_0045747
717 Ga0495630_0081421
718 Ga0495630_0086145
719 Ga0495630_0313841
720 Ga0495630_0617657
721 Ga0495630_1096828
722 Ga0495644_0001562
723 Ga0495663_0157493
724 Ga0495642_0290692
725 Ga0495652_0000172
726 Ga0495652_0035634
727 Ga0495652_0127042
728 Ga0495652_0415226
729 Ga0495652_0831971
730 Ga0495665_0447160
731 Ga0495640_0004584
732 Ga0495640_0170622
733 Ga0495640_0609615
734 Ga0495586_0094224
735 Ga0495586_0117426
736 Ga0495586_0644086
737 Ga0495587_0000362
738 Ga0495587_0163661
739 Ga0495587_0430387
740 Ga0495645_0000016
741 Ga0495645_0037319
742 Ga0495645_0051923
743 Ga0495645_0112627
744 Ga0495645_0350836
745 Ga0495645_0362074
746 Ga0495667_0001379
747 Ga0495667_0056604
748 Ga0495667_0268845
749 Ga0495656_0036346
750 Ga0495668_0106225
751 Ga0495634_0072981
752 Ga0495634_0203907
753 Ga0495634_0328269
754 Ga0495635_0038583
755 Ga0495635_0137454
756 Ga0495635_0453573
757 Ga0495661_0255584
758 Ga0495657_0002580
759 Ga0495657_0006142
760 Ga0495657_0045931
761 Ga0495657_0187042
762 Ga0495599_0000016
763 Ga0495599_0011586
764 Ga0495599_0232430
765 Ga0495623_0000046
766 Ga0495623_0194438
767 Ga0495646_0003505
768 Ga0495658_0034158
769 Ga0495658_0044125
770 Ga0495613_0139196
771 Ga0495613_0239687
772 Ga0495624_0003996
773 Ga0495624_0048741
774 Ga0495670_0327770
775 Ga0495600_0016262
776 Ga0495600_0065238
777 Ga0495600_0089932
778 Ga0495600_0389246
779 Ga0495581_0105523
780 Ga0495604_0000004
781 Ga0495604_0076658
782 Ga0495604_0314627
783 Ga0495674_0091626
784 Ga0495674_0175945
785 Ga0495674_0185582
786 Ga0495674_0405479
787 Ga0495676_0188462
788 Ga0495676_0207079
789 Ga0495676_0687708
790 Ga0495676_0733767
791 Ga0495680_0009072
792 Ga0495680_0035895
793 Ga0495680_0107560
794 Ga0495680_0122416
795 Ga0495680_0202460
796 Ga0495680_0434341
797 Ga0495680_0938652
798 Ga0495675_0000079
799 Ga0495675_0669610
800 Ga0495684_0000645
801 Ga0495684_0434168
802 Ga0495593_0083851
803 Ga0495602_0000351
804 Ga0495602_0315365
805 Ga0495614_0036519
806 Ga0496100_1610421
807 Ga0496101_0147490
808 Ga0496101_0161717
809 Ga0496101_1296027
810 Ga0496102_0019429
811 Ga0496102_0083378
812 Ga0496103_0020210
813 Ga0496104_0046579
814 Ga0496104_0261656
815 Ga0496104_0539937
816 Ga0496104_1123931
817 Ga0496105_0114110
818 Ga0496105_0115182
819 Ga0496106_0222747
820 Ga0496106_0430416
821 Ga0496106_0672724
822 Ga0496107_0046342
823 Ga0496108_0039313
824 Ga0496108_0185455
825 Ga0496108_0256185
826 Ga0496109_0058049
827 Ga0496109_0075153
828 Ga0496109_0262412
829 Ga0496110_0039706
830 Ga0496111_0095279
831 Ga0496111_0261053
832 Ga0496111_0758655
833 Ga0496112_0123697
834 Ga0496112_0240340
835 Ga0496112_0441006
836 Ga0496112_0456391
837 Ga0496112_0539077
838 Ga0496113_0093930
839 Ga0496113_0414127
840 Ga0496114_0213909
841 Ga0496114_0358651
842 Ga0496115_0006663
843 Ga0496115_0073871
844 Ga0496115_0106606
845 Ga0501067_0016972
846 Ga0501067_0107706
847 Ga0501067_0216741
848 Ga0501069_0063408
849 Ga0501069_0163828
850 Ga0501070_1423512
851 nmdc:mga0n895_7131_c1
852 nmdc:mga0rr50_315364_c1
853 Ga0495601_0000896
854 Ga0495601_0127403
855 Ga0495601_0153527
856 Ga0495601_0724904
857 Ga0495612_0002591
858 Ga0495612_0028085
859 Ga0495612_0185722
860 Ga0495595_0024683
861 Ga0495595_0035190
862 Ga0495595_0061991
863 Ga0495595_0065538
864 Ga0495595_0203609
865 Ga0495619_0006645
866 Ga0495619_0016523
867 Ga0495619_0071206
868 Ga0495619_0291280
869 Ga0495619_0305444
870 Ga0495619_0342680
871 Ga0495619_0829421
872 Ga0466962_0000230
873 Ga0466962_0012619
874 Ga0466962_0070784

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13279

4HBT_2

Thioesterase-like superfamily

23

142

0.98

PF03061

4HBT

Thioesterase superfamily

31

115

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t07-assembly1.cif.gz_A crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with decanoyl-coa 0.9572 6 131
5kl9-assembly1.cif.gz_B crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with coa 0.957 6 129
2egi-assembly1.cif.gz_C crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9569 6 131
2egi-assembly1.cif.gz_A crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9538 6 131
2egi-assembly1.cif.gz_H crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9514 6 111
ID Description Score Start End Superfamily
2egiH00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9514 6 111 3.10.129.10
5v10B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9512 6 131 3.10.129.10
5t06C00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9467 6 130 3.10.129.10
1z54D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9402 7 133 3.10.129.10
af_A0A0N7KJH1_95_233_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9383 7 133 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7Y5X356-F1-model_v4 Acyl-CoA thioesterase 0.9815 1 136 GO:0047617
AF-A0A7V9G0L3-F1-model_v4 Acyl-CoA thioesterase 0.9815 1 136 GO:0047617
AF-A0A538HXX5-F1-model_v4 Acyl-CoA thioesterase 0.9763 3 137 GO:0047617
AF-A0A7Y5X356-F1-model_v4 Acyl-CoA thioesterase 0.9744 1 136 GO:0047617
AF-A0A4Y8IBN5-F1-model_v4 Acyl-CoA thioesterase 0.974 4 133 GO:0047617

Map