F443683

General Info

Members Datasets Scaffolds Average Seq Length
437 240 436 157

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10091320|rootL2_100913202
Length 193
Sequence MITVKQCTVTGFPLLSIVPCRKSTYLDLLFTEKQFFMVKLKINQKEYTVDASPDMPLLWAIRDIVGLTGTKFGCGMAQCGACTVHLDGEAVRSCVTLVSRAVGKEIVTIEGLSADPDNYLQKAWIELDVPQCGYCQSGQIMSAAVLLRENPNPTDEDIDSAMSGNICRCGTYPRIRKAIHLAAKMQREGGKNK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
150 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
154 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
157 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
175 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
176 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
177 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
178 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
179 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
180 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
183 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
196 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
214 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
215 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
219 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
224 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
230 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
231 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
232 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
233 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
234 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
235 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
236 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
237 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
238 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
239 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
240 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.7
Nodule 0
Rhizoplane 0.23
Rhizosphere 87.41
Stem 0
Stem Tuber 0
Unclassified 3.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2198354 2162886007 Bacteria 28683
2 JGI24736J21556_1020327 3300001904 Unclassified 1044
3 JGI24739J22299_10000783 3300001989 Bacteria 11599
4 JGI24737J22298_10007573 3300001990 Bacteria 3659
5 JGI24737J22298_10015189 3300001990 Bacteria 2493
6 JGI24735J21928_10000002 3300002067 Bacteria 624895
7 JGI25154J39366_1012167 3300002738 Bacteria 959
8 JGI25153J46596_10018283 3300003215 Bacteria 2729
9 rootH1_10081086 3300003316 Bacteria 6114
10 rootH2_10052254 3300003320 Bacteria 7924
11 rootL2_10091320 3300003322 Bacteria 1925
12 rootL2_10185155 3300003322 Bacteria 7042
13 rootL2_10275954 3300003322 Bacteria 2669
14 JGI25160J50197_1004412 3300003354 Bacteria 6095
15 Ga0055526_1035187 3300003771 Bacteria 1355
16 Ga0055528_1000209 3300003790 Bacteria 49598
17 Ga0055528_1000317 3300003790 Bacteria 40640
18 Ga0055530_10005661 3300003791 Bacteria 5847
19 Ga0055530_10020618 3300003791 Bacteria 1964
20 Ga0055531_10000354 3300003794 Bacteria 44915
21 Ga0055543_1014310 3300004625 Bacteria 1549
22 Ga0065165_1000225 3300005262 Bacteria 99123
23 Ga0065714_10003480 3300005288 Bacteria 7167
24 Ga0065714_10016702 3300005288 Bacteria 2058
25 Ga0065704_10000258 3300005289 Bacteria 102292
26 Ga0065715_10420429 3300005293 Bacteria 859
27 Ga0070658_10235785 3300005327 Bacteria 1550
28 Ga0070658_10481717 3300005327 Bacteria 1071
29 Ga0070676_10000053 3300005328 Bacteria 37051
30 Ga0070683_100028149 3300005329 Bacteria 5077
31 Ga0070683_100745149 3300005329 Bacteria 938
32 Ga0070670_100352791 3300005331 Bacteria 1292
33 Ga0068869_100354900 3300005334 Bacteria 1196
34 Ga0070666_10000050 3300005335 Bacteria 100280
35 Ga0070666_10745510 3300005335 Bacteria 720
36 Ga0070680_100047401 3300005336 Bacteria 3499
37 Ga0068868_100070835 3300005338 Bacteria 2780
38 Ga0068868_100109700 3300005338 Bacteria 2241
39 Ga0068868_100521843 3300005338 Bacteria 1043
40 Ga0070660_100005857 3300005339 Bacteria 8509
41 Ga0070660_100632296 3300005339 Bacteria 896
42 Ga0070669_100266142 3300005353 Bacteria 1369
43 Ga0070671_100038320 3300005355 Bacteria 3979
44 Ga0070673_100258728 3300005364 Bacteria 1520
45 Ga0070673_100280794 3300005364 Bacteria 1461
46 Ga0070667_100011433 3300005367 Bacteria 7340
47 Ga0070667_100012636 3300005367 Bacteria 6983
48 Ga0070667_100603587 3300005367 Bacteria 1011
49 Ga0070667_101013920 3300005367 Bacteria 775
50 Ga0070703_10352800 3300005406 Bacteria 628
51 Ga0070714_101124158 3300005435 Bacteria 766
52 Ga0070713_100205885 3300005436 Bacteria 1779
53 Ga0070713_100436295 3300005436 Bacteria 1228
54 Ga0070713_101214464 3300005436 Bacteria 730
55 Ga0070701_11062759 3300005438 Bacteria 568
56 Ga0070700_101237561 3300005441 Unclassified 625
57 Ga0070700_101450391 3300005441 Bacteria 582
58 Ga0070678_100031234 3300005456 Unclassified 3671
59 Ga0070678_101077194 3300005456 Bacteria 741
60 Ga0070662_100000132 3300005457 Bacteria 41983
61 Ga0070681_10021014 3300005458 Bacteria 6539
62 Ga0068867_100004376 3300005459 Bacteria 9945
63 Ga0068867_100344420 3300005459 Bacteria 1242
64 Ga0070684_100037934 3300005535 Bacteria 4136
65 Ga0070684_100659932 3300005535 Bacteria 974
66 Ga0070684_101098749 3300005535 Bacteria 747
67 Ga0070684_101145978 3300005535 Bacteria 731
68 Ga0068853_100018771 3300005539 Bacteria 5727
69 Ga0068853_100055748 3300005539 Bacteria 3407
70 Ga0068853_100147682 3300005539 Unclassified 2114
71 Ga0070672_100110376 3300005543 Bacteria 2241
72 Ga0070672_100441324 3300005543 Bacteria 1120
73 Ga0070665_100000020 3300005548 Bacteria 389687
74 Ga0070665_100000581 3300005548 Bacteria 51024
75 Ga0070665_100058824 3300005548 Bacteria 3853
76 Ga0068855_100023624 3300005563 Bacteria 7364
77 Ga0068855_100096297 3300005563 Bacteria 3410
78 Ga0068855_100135028 3300005563 Bacteria 2815
79 Ga0068855_101554592 3300005563 Bacteria 678
80 Ga0068857_100138471 3300005577 Bacteria 2199
81 Ga0068857_101121242 3300005577 Bacteria 760
82 Ga0068854_100705393 3300005578 Bacteria 871
83 Ga0068856_100222712 3300005614 Bacteria 1902
84 Ga0068852_100003986 3300005616 Bacteria 10377
85 Ga0068852_100005954 3300005616 Bacteria 8777
86 Ga0068852_100467106 3300005616 Unclassified 1252
87 Ga0068852_100708742 3300005616 Unclassified 1017
88 Ga0068859_100000025 3300005617 Bacteria 191679
89 Ga0068859_100011927 3300005617 Bacteria 8731
90 Ga0068859_100116987 3300005617 Bacteria 2731
91 Ga0068864_100016894 3300005618 Bacteria 6082
92 Ga0068864_100516444 3300005618 Bacteria 1151
93 Ga0068864_101337050 3300005618 Bacteria 717
94 Ga0068864_101629309 3300005618 Bacteria 650
95 Ga0068864_101925290 3300005618 Bacteria 597
96 Ga0068866_11099553 3300005718 Unclassified 569
97 Ga0068851_10072084 3300005834 Bacteria 1789
98 Ga0068863_100002841 3300005841 Bacteria 17144
99 Ga0068863_100289610 3300005841 Bacteria 1587
100 Ga0068863_101302495 3300005841 Bacteria 733
101 Ga0068858_100011067 3300005842 Bacteria 8531
102 Ga0068858_101007505 3300005842 Bacteria 816
103 Ga0068860_100003010 3300005843 Bacteria 17411
104 Ga0068860_100016819 3300005843 Bacteria 7131
105 Ga0068860_101542365 3300005843 Bacteria 686
106 Ga0081539_10051441 3300005985 Unclassified 2322
107 Ga0081539_10129031 3300005985 Bacteria 1245
108 Ga0075366_10104730 3300006195 Bacteria 1700
109 Ga0097621_100001247 3300006237 Bacteria 17596
110 Ga0097621_100548690 3300006237 Bacteria 1052
111 Ga0068871_100000710 3300006358 Bacteria 22594
112 Ga0068871_100305299 3300006358 Bacteria 1398
113 Ga0068871_100584222 3300006358 Bacteria 1014
114 Ga0068871_100851800 3300006358 Bacteria 843
115 Ga0068871_101861024 3300006358 Unclassified 572
116 Ga0068865_100003231 3300006881 Bacteria 9761
117 Ga0097620_100000025 3300006931 Bacteria 191679
118 Ga0097620_100011927 3300006931 Bacteria 8731
119 Ga0097620_100116979 3300006931 Bacteria 2731
120 Ga0099794_10035872 3300007265 Bacteria 2342
121 Ga0105244_10102648 3300009036 Bacteria 1397
122 Ga0105240_10001590 3300009093 Bacteria 38585
123 Ga0105240_10045283 3300009093 Bacteria 5582
124 Ga0105240_10165121 3300009093 Unclassified 2627
125 Ga0105240_10319974 3300009093 Bacteria 1769
126 Ga0105245_10235644 3300009098 Bacteria 1772
127 Ga0105245_10285794 3300009098 Bacteria 1614
128 Ga0105245_12087967 3300009098 Bacteria 620
129 Ga0105247_10029175 3300009101 Bacteria 3342
130 Ga0105247_10553570 3300009101 Bacteria 846
131 Ga0105243_10056302 3300009148 Bacteria 3126
132 Ga0105243_11430480 3300009148 Bacteria 713
133 Ga0105241_10001218 3300009174 Bacteria 19675
134 Ga0105241_10002147 3300009174 Bacteria 14863
135 Ga0105241_10005149 3300009174 Bacteria 9644
136 Ga0105241_10181226 3300009174 Bacteria 1747
137 Ga0105242_10075581 3300009176 Bacteria 2805
138 Ga0105242_10389042 3300009176 Bacteria 1298
139 Ga0105242_11801849 3300009176 Unclassified 650
140 Ga0105248_10316340 3300009177 Bacteria 1758
141 Ga0105237_10005071 3300009545 Bacteria 14963
142 Ga0105237_10005234 3300009545 Bacteria 14676
143 Ga0105237_10005513 3300009545 Bacteria 14262
144 Ga0105237_10007561 3300009545 Bacteria 11876
145 Ga0105237_10070929 3300009545 Bacteria 3479
146 Ga0105237_10134754 3300009545 Bacteria 2464
147 Ga0105237_10174955 3300009545 Bacteria 2147
148 Ga0105237_10908119 3300009545 Bacteria 888
149 Ga0105237_11155496 3300009545 Bacteria 781
150 Ga0105238_10002923 3300009551 Bacteria 17052
151 Ga0105238_10465533 3300009551 Bacteria 1262
152 Ga0105249_10020133 3300009553 Bacteria 5960
153 Ga0105249_10099896 3300009553 Bacteria 2728
154 Ga0105239_10000701 3300010375 Bacteria 47575
155 Ga0105239_10050041 3300010375 Unclassified 4583
156 Ga0105239_10268375 3300010375 Unclassified 1919
157 Ga0105239_10313468 3300010375 Bacteria 1768
158 Ga0105246_10007813 3300011119 Bacteria 6561
159 Ga0105246_10336892 3300011119 Unclassified 1231
160 Ga0105246_10552826 3300011119 Bacteria 987
161 Ga0157373_10000578 3300013100 Bacteria 28485
162 Ga0157373_10037590 3300013100 Bacteria 3470
163 Ga0157371_10100589 3300013102 Bacteria 2050
164 Ga0157371_10101777 3300013102 Unclassified 2038
165 Ga0157371_10151391 3300013102 Bacteria 1655
166 Ga0157371_10151413 3300013102 Bacteria 1655
167 Ga0157370_10012898 3300013104 Bacteria 8639
168 Ga0157370_10414331 3300013104 Bacteria 1240
169 Ga0157370_10434743 3300013104 Bacteria 1207
170 Ga0157370_10927471 3300013104 Bacteria 790
171 Ga0157369_10103496 3300013105 Bacteria 3033
172 Ga0157369_10329063 3300013105 Bacteria 1588
173 Ga0157369_11070987 3300013105 Unclassified 824
174 Ga0157374_10002112 3300013296 Bacteria 16713
175 Ga0157374_10003227 3300013296 Bacteria 13700
176 Ga0157374_10052963 3300013296 Bacteria 3782
177 Ga0157374_10088782 3300013296 Bacteria 2945
178 Ga0157378_10002905 3300013297 Bacteria 15257
179 Ga0157378_10013693 3300013297 Bacteria 7094
180 Ga0157378_10057730 3300013297 Bacteria 3460
181 Ga0157378_10126202 3300013297 Bacteria 2364
182 Ga0163162_10000032 3300013306 Bacteria 156609
183 Ga0163162_10000344 3300013306 Bacteria 42218
184 Ga0163162_10099580 3300013306 Bacteria 2997
185 Ga0163162_10218310 3300013306 Unclassified 2037
186 Ga0163162_10288161 3300013306 Bacteria 1774
187 Ga0163162_10306013 3300013306 Bacteria 1722
188 Ga0163162_10782639 3300013306 Bacteria 1072
189 Ga0163162_11599856 3300013306 Bacteria 743
190 Ga0163162_12369200 3300013306 Bacteria 610
191 Ga0157372_10002858 3300013307 Bacteria 18659
192 Ga0157372_10098441 3300013307 Bacteria 3337
193 Ga0157375_10020919 3300013308 Bacteria 5988
194 Ga0157375_10046977 3300013308 Bacteria 4212
195 Ga0157375_10105260 3300013308 Bacteria 2911
196 Ga0157375_10486316 3300013308 Bacteria 1399
197 Ga0157375_10532032 3300013308 Bacteria 1338
198 Ga0157375_10622578 3300013308 Bacteria 1237
199 Ga0163163_10531012 3300014325 Bacteria 1239
200 Ga0157380_10002914 3300014326 Bacteria 11634
201 Ga0157377_10117356 3300014745 Unclassified 1608
202 Ga0157379_10025888 3300014968 Bacteria 5216
203 Ga0157379_10296230 3300014968 Bacteria 1474
204 Ga0157379_10411603 3300014968 Bacteria 1244
205 Ga0157376_10007363 3300014969 Bacteria 7848
206 Ga0157376_10294666 3300014969 Bacteria 1533
207 Ga0163161_10337241 3300017792 Bacteria 1195
208 Ga0163161_10521296 3300017792 Unclassified 970
209 Ga0206356_11644439 3300020070 Bacteria 809
210 Ga0213872_10031289 3300021361 Bacteria 2439
211 Ga0209437_100024 3300025233 Bacteria 592878
212 Ga0209646_1002891 3300025246 Bacteria 3580
213 Ga0209673_1000167 3300025273 Bacteria 135172
214 Ga0209676_1000001 3300025292 Bacteria 1852142
215 Ga0209564_1001763 3300025295 Bacteria 20152
216 Ga0209564_1004541 3300025295 Bacteria 8428
217 Ga0209564_1089063 3300025295 Bacteria 572
218 Ga0209758_1013768 3300025297 Bacteria 4375
219 Ga0209050_1000018 3300025298 Bacteria 723263
220 Ga0209050_1000503 3300025298 Bacteria 66444
221 Ga0207426_1004780 3300025302 Bacteria 6439
222 Ga0209051_1077781 3300025303 Bacteria 970
223 Ga0209257_1000008 3300025304 Bacteria 1294570
224 Ga0209257_1003179 3300025304 Bacteria 14609
225 Ga0207656_10149571 3300025321 Bacteria 1105
226 Ga0207642_10343912 3300025899 Unclassified 878
227 Ga0207710_10025163 3300025900 Bacteria 2568
228 Ga0207680_10000086 3300025903 Bacteria 42622
229 Ga0207680_10796485 3300025903 Bacteria 677
230 Ga0207647_10002636 3300025904 Bacteria 13557
231 Ga0207645_10000440 3300025907 Bacteria 34498
232 Ga0207705_10013419 3300025909 Bacteria 5910
233 Ga0207654_10003112 3300025911 Bacteria 8401
234 Ga0207654_10003382 3300025911 Bacteria 8074
235 Ga0207654_10026306 3300025911 Bacteria 3149
236 Ga0207707_10101356 3300025912 Bacteria 2516
237 Ga0207695_10019578 3300025913 Bacteria 7788
238 Ga0207695_10022737 3300025913 Bacteria 7104
239 Ga0207695_10109889 3300025913 Bacteria 2738
240 Ga0207671_10003741 3300025914 Bacteria 14990
241 Ga0207671_10041100 3300025914 Bacteria 3422
242 Ga0207671_10045295 3300025914 Bacteria 3253
243 Ga0207671_10061581 3300025914 Bacteria 2784
244 Ga0207671_10090623 3300025914 Bacteria 2303
245 Ga0207671_10132864 3300025914 Bacteria 1912
246 Ga0207671_10352321 3300025914 Bacteria 1167
247 Ga0207671_10509077 3300025914 Bacteria 960
248 Ga0207660_10040488 3300025917 Bacteria 3263
249 Ga0207657_10024815 3300025919 Bacteria 5542
250 Ga0207657_10828162 3300025919 Bacteria 715
251 Ga0207649_11578123 3300025920 Unclassified 519
252 Ga0207652_10234357 3300025921 Bacteria 1654
253 Ga0207681_10196804 3300025923 Bacteria 1545
254 Ga0207681_10524243 3300025923 Bacteria 973
255 Ga0207694_10045797 3300025924 Bacteria 3379
256 Ga0207694_10901207 3300025924 Bacteria 748
257 Ga0207650_10235102 3300025925 Bacteria 1479
258 Ga0207650_10525594 3300025925 Bacteria 990
259 Ga0207659_10172062 3300025926 Bacteria 1709
260 Ga0207687_10515110 3300025927 Bacteria 1000
261 Ga0207687_10886206 3300025927 Bacteria 763
262 Ga0207700_10101554 3300025928 Bacteria 2295
263 Ga0207644_10006375 3300025931 Bacteria 7685
264 Ga0207706_10000043 3300025933 Bacteria 124186
265 Ga0207686_10231683 3300025934 Bacteria 1339
266 Ga0207686_10773218 3300025934 Bacteria 768
267 Ga0207709_10550351 3300025935 Bacteria 907
268 Ga0207709_10668142 3300025935 Bacteria 829
269 Ga0207704_10000120 3300025938 Bacteria 42425
270 Ga0207704_10037988 3300025938 Bacteria 2787
271 Ga0207691_10195380 3300025940 Bacteria 1763
272 Ga0207691_10420680 3300025940 Bacteria 1139
273 Ga0207691_10464867 3300025940 Unclassified 1076
274 Ga0207689_10073266 3300025942 Bacteria 2813
275 Ga0207689_10546704 3300025942 Bacteria 972
276 Ga0207661_10569136 3300025944 Bacteria 1039
277 Ga0207667_10128096 3300025949 Bacteria 2614
278 Ga0207667_10250986 3300025949 Bacteria 1810
279 Ga0207667_10325279 3300025949 Bacteria 1570
280 Ga0207667_10737383 3300025949 Bacteria 985
281 Ga0207667_11379221 3300025949 Bacteria 679
282 Ga0207651_10095750 3300025960 Bacteria 2187
283 Ga0207651_10303544 3300025960 Bacteria 1328
284 Ga0207712_10016747 3300025961 Bacteria 4752
285 Ga0207658_10069358 3300025986 Bacteria 2663
286 Ga0207658_10203373 3300025986 Bacteria 1655
287 Ga0207658_10237326 3300025986 Bacteria 1542
288 Ga0207677_10047780 3300026023 Bacteria 2876
289 Ga0207677_10531715 3300026023 Bacteria 1021
290 Ga0207703_10006240 3300026035 Bacteria 9538
291 Ga0207703_12235185 3300026035 Bacteria 523
292 Ga0207639_10010887 3300026041 Bacteria 6308
293 Ga0207639_10014040 3300026041 Bacteria 5622
294 Ga0207639_10121741 3300026041 Unclassified 2145
295 Ga0207639_10203438 3300026041 Bacteria 1700
296 Ga0207641_10000661 3300026088 Bacteria 37590
297 Ga0207641_10059102 3300026088 Bacteria 3264
298 Ga0207648_10008517 3300026089 Bacteria 9927
299 Ga0207648_10108564 3300026089 Bacteria 2436
300 Ga0207676_10038678 3300026095 Bacteria 3643
301 Ga0207676_10072976 3300026095 Bacteria 2761
302 Ga0207676_11810000 3300026095 Bacteria 609
303 Ga0207683_10009754 3300026121 Bacteria 8186
304 Ga0207698_10001744 3300026142 Bacteria 12682
305 Ga0207698_10002995 3300026142 Bacteria 10135
306 Ga0268266_10000018 3300028379 Bacteria 569141
307 Ga0268266_10009155 3300028379 Bacteria 8738
308 Ga0268266_10057610 3300028379 Bacteria 3344
309 Ga0268264_10002203 3300028381 Bacteria 17296
310 Ga0265318_10077374 3300028577 Unclassified 1230
311 Ga0307517_10006765 3300028786 Bacteria 16871
312 Ga0307517_10011991 3300028786 Bacteria 11958
313 Ga0307515_10000162 3300028794 Bacteria 163720
314 Ga0265338_10020762 3300028800 Bacteria 6889
315 Ga0265324_10008508 3300029957 Bacteria 4072
316 Ga0265320_10078342 3300031240 Bacteria 1546
317 Ga0307513_10162634 3300031456 Bacteria 2122
318 Ga0307509_10023175 3300031507 Bacteria 6981
319 Ga0316578_10321793 3300031728 Bacteria 923
320 Ga0307412_10000031 3300031911 Bacteria 207128
321 Ga0307416_101424201 3300032002 Bacteria 799
322 Ga0307414_10001701 3300032004 Bacteria 11461
323 Ga0307510_10000766 3300033180 Bacteria 33227
324 Ga0373936_0000449 3300035113 Bacteria 13800
325 Ga0373954_0322448 3300035118 Bacteria 763
326 Ga0373955_0064475 3300035172 Bacteria 2031
327 Ga0373955_0110386 3300035172 Bacteria 1590
328 Ga0316574_0436286 3300035398 Bacteria 822
329 Ga0316574_0741514 3300035398 Bacteria 600
330 Ga0373937_0024923 3300036401 Bacteria 5399
331 Ga0373937_0787200 3300036401 Bacteria 899
332 Ga0373937_0837019 3300036401 Bacteria 868
333 Ga0395899_0110378 3300037312 Bacteria 1978
334 Ga0395900_0000231 3300037418 Bacteria 87314
335 Ga0395900_0026896 3300037418 Bacteria 5888
336 Ga0395898_0012430 3300037466 Bacteria 8802
337 Ga0395898_0076397 3300037466 Bacteria 3235
338 Ga0395905_0000261 3300037471 Bacteria 78643
339 Ga0395905_0000769 3300037471 Bacteria 42306
340 Ga0436364_0126689 3300037853 Bacteria 1217
341 Ga0395901_0000236 3300038443 Bacteria 69250
342 Ga0395901_0003843 3300038443 Bacteria 15134
343 Ga0436361_0020381 3300039447 Bacteria 2420
344 Ga0439431_0027889 3300041997 Bacteria 1389
345 Ga0439437_047902 3300042000 Bacteria 563
346 Ga0439445_0060612 3300042004 Bacteria 1034
347 Ga0439448_0026007 3300042005 Bacteria 1838
348 Ga0439457_056842 3300042014 Bacteria 883
349 Ga0439434_0077868 3300042435 Bacteria 1050
350 Ga0439435_0011220 3300042436 Bacteria 2146
351 Ga0451577_0009571 3300042876 Bacteria 9312
352 Ga0451577_0202546 3300042876 Bacteria 1792
353 Ga0451577_0261008 3300042876 Bacteria 1569
354 Ga0466969_0102905 3300044656 Bacteria 1343
355 Ga0466969_0148902 3300044656 Bacteria 1079
356 Ga0466972_0000062 3300044658 Bacteria 108852
357 Ga0466972_0015232 3300044658 Bacteria 3845
358 Ga0466961_0209328 3300044693 Bacteria 1204
359 Ga0466961_0350116 3300044693 Bacteria 899
360 Ga0466971_0331358 3300044719 Bacteria 734
361 Ga0466970_0298650 3300044765 Bacteria 908
362 Ga0466959_0018117 3300045049 Bacteria 5168
363 Ga0466959_0048157 3300045049 Bacteria 3133
364 Ga0466959_0172996 3300045049 Bacteria 1514
365 Ga0451576_0027340 3300045051 Bacteria 6128
366 Ga0466958_0722353 3300045836 Bacteria 649
367 Ga0495629_0083755 3300046459 Bacteria 2226
368 Ga0495638_0148451 3300046460 Bacteria 1362
369 Ga0495651_0044860 3300046462 Bacteria 3426
370 Ga0495650_0042353 3300046471 Bacteria 1939
371 Ga0495580_0042540 3300046472 Bacteria 3237
372 Ga0495596_0052271 3300046500 Bacteria 1599
373 Ga0495583_0052018 3300046506 Bacteria 1865
374 Ga0495583_0258429 3300046506 Bacteria 697
375 Ga0495606_0254605 3300046507 Bacteria 972
376 Ga0495608_0114514 3300046511 Bacteria 1732
377 Ga0495616_0009420 3300046513 Bacteria 5713
378 Ga0495616_0035715 3300046513 Bacteria 2569
379 Ga0495630_0038337 3300046517 Bacteria 3585
380 Ga0495630_1127230 3300046517 Bacteria 594
381 Ga0495632_0094399 3300046519 Unclassified 1415
382 Ga0495652_0585825 3300046529 Bacteria 763
383 Ga0495665_0272735 3300046531 Bacteria 869
384 Ga0495586_0054309 3300046535 Bacteria 2171
385 Ga0495587_0084330 3300046536 Bacteria 1840
386 Ga0495645_0120134 3300046543 Bacteria 1851
387 Ga0495645_0433205 3300046543 Bacteria 832
388 Ga0495633_0000014 3300046558 Bacteria 261742
389 Ga0495633_0000104 3300046558 Bacteria 114011
390 Ga0495667_0368178 3300046559 Bacteria 907
391 Ga0495667_0521402 3300046559 Bacteria 744
392 Ga0495668_0106075 3300046616 Bacteria 1537
393 Ga0495668_0344009 3300046616 Bacteria 818
394 Ga0495625_0000005 3300046660 Bacteria 596135
395 Ga0495625_0009290 3300046660 Bacteria 8242
396 Ga0495625_0055057 3300046660 Bacteria 2838
397 Ga0495625_0063142 3300046660 Bacteria 2616
398 Ga0495625_0090199 3300046660 Bacteria 2121
399 Ga0495625_0433034 3300046660 Bacteria 815
400 Ga0495661_0005445 3300046665 Bacteria 9036
401 Ga0495669_0023652 3300046684 Bacteria 2676
402 Ga0495671_0193084 3300046692 Unclassified 988
403 Ga0495649_0000003 3300046694 Bacteria 880817
404 Ga0495649_0063220 3300046694 Bacteria 1989
405 Ga0495660_0048514 3300046810 Bacteria 2322
406 Ga0495604_0197126 3300047317 Bacteria 1400
407 Ga0495604_0364254 3300047317 Bacteria 958
408 Ga0495674_0074974 3300047319 Bacteria 2912
409 Ga0495687_002745 3300047443 Bacteria 13645
410 Ga0495687_106578 3300047443 Bacteria 1039
411 Ga0495686_0044810 3300047472 Bacteria 2800
412 Ga0495602_0042214 3300048088 Bacteria 4158
413 Ga0496115_1104766 3300048918 Bacteria 601
414 Ga0496126_0011212 3300048929 Bacteria 9302
415 Ga0496126_0046152 3300048929 Bacteria 3999
416 Ga0495678_049516 3300049459 Bacteria 1632
417 Ga0501297_013697 3300049520 Bacteria 954
418 Ga0501047_0109067 3300049581 Bacteria 2651
419 Ga0501241_000943 3300049758 Bacteria 6165
420 Ga0501241_002500 3300049758 Bacteria 3548
421 nmdc:mga0k408_319903_c1 3300050493 Bacteria 926
422 nmdc:mga08x19_968428_c1 3300050514 Bacteria 604
423 Ga0500644_0140514 3300053088 Bacteria 959
424 Ga0500581_173266 3300053089 Unclassified 988
425 Ga0500651_0016121 3300053093 Bacteria 4593
426 Ga0500651_0036214 3300053093 Bacteria 3109
427 Ga0500572_116688 3300053111 Bacteria 862
428 Ga0500608_003726 3300053122 Bacteria 5775
429 Ga0500559_0346115 3300053136 Bacteria 695
430 Ga0500589_017274 3300053147 Bacteria 3250
431 Ga0500622_0000844 3300053156 Bacteria 26216
432 Ga0500622_0013499 3300053156 Bacteria 4407
433 Ga0500624_000909 3300053157 Bacteria 6240
434 Ga0500645_004358 3300053730 Bacteria 5439
435 Ga0500661_077089 3300055283 Bacteria 614
436 Ga0587062_064667 3300059639 Bacteria 649

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007265 Ga0099794_10035872 Ga0099794_100358721 149
2 3300009176 Ga0105242_11801849 Ga0105242_118018492 150
3 3300014326 Ga0157380_10002914 Ga0157380_1000291412 150
4 3300042004 Ga0439445_0060612 Ga0439445_0060612_427_924 150
5 3300005618 Ga0068864_101337050 Ga0068864_1013370501 151
6 3300009093 Ga0105240_10045283 Ga0105240_100452832 151
7 3300009553 Ga0105249_10020133 Ga0105249_100201333 151
8 3300005293 Ga0065715_10420429 Ga0065715_104204291 153
9 3300005334 Ga0068869_100354900 Ga0068869_1003549001 153
10 3300005441 Ga0070700_101450391 Ga0070700_1014503911 153
11 3300005617 Ga0068859_100116987 Ga0068859_1001169872 153
12 3300006931 Ga0097620_100116979 Ga0097620_1001169792 153
13 3300009177 Ga0105248_10316340 Ga0105248_103163401 153
14 3300025942 Ga0207689_10546704 Ga0207689_105467042 153
15 3300044656 Ga0466969_0148902 Ga0466969_0148902_502_975 153
16 3300044693 Ga0466961_0209328 Ga0466961_0209328_502_975 153
17 3300045049 Ga0466959_0018117 Ga0466959_0018117_2611_3084 153
18 3300005535 Ga0070684_101145978 Ga0070684_1011459781 154
19 3300005548 Ga0070665_100000581 Ga0070665_10000058143 154
20 3300009036 Ga0105244_10102648 Ga0105244_101026481 154
21 3300009545 Ga0105237_11155496 Ga0105237_111554961 154
22 3300014968 Ga0157379_10296230 Ga0157379_102962302 154
23 3300025914 Ga0207671_10132864 Ga0207671_101328641 154
24 3300028379 Ga0268266_10009155 Ga0268266_100091554 154
25 3300031728 Ga0316578_10321793 Ga0316578_103217932 154
26 3300032002 Ga0307416_101424201 Ga0307416_1014242011 154
27 3300035113 Ga0373936_0000449 Ga0373936_0000449_6144_6620 154
28 3300035398 Ga0316574_0436286 Ga0316574_0436286_126_596 154
29 3300042435 Ga0439434_0077868 Ga0439434_0077868_554_1033 154
30 3300048929 Ga0496126_0011212 Ga0496126_0011212_7784_8260 154
31 3300053111 Ga0500572_116688 Ga0500572_116688_18_494 154
32 3300053136 Ga0500559_0346115 Ga0500559_0346115_82_558 154
33 3300005338 Ga0068868_100521843 Ga0068868_1005218432 155
34 3300005367 Ga0070667_100603587 Ga0070667_1006035871 155
35 3300005406 Ga0070703_10352800 Ga0070703_103528001 155
36 3300005438 Ga0070701_11062759 Ga0070701_110627591 155
37 3300005841 Ga0068863_101302495 Ga0068863_1013024952 155
38 3300009098 Ga0105245_10235644 Ga0105245_102356442 155
39 3300009545 Ga0105237_10070929 Ga0105237_100709294 155
40 3300010375 Ga0105239_10000701 Ga0105239_1000070132 155
41 3300013308 Ga0157375_10020919 Ga0157375_100209194 155
42 3300014969 Ga0157376_10294666 Ga0157376_102946662 155
43 3300025926 Ga0207659_10172062 Ga0207659_101720623 155
44 3300025927 Ga0207687_10515110 Ga0207687_105151102 155
45 3300025986 Ga0207658_10203373 Ga0207658_102033732 155
46 3300026023 Ga0207677_10531715 Ga0207677_105317152 155
47 3300028577 Ga0265318_10077374 Ga0265318_100773742 155
48 3300031240 Ga0265320_10078342 Ga0265320_100783422 155
49 3300046517 Ga0495630_1127230 Ga0495630_1127230_86_556 155
50 3300050514 nmdc:mga08x19_968428_c1 nmdc:mga08x19_968428_c1_82_558 155
51 3300055283 Ga0500661_077089 Ga0500661_077089_123_599 155
52 3300001904 JGI24736J21556_1020327 JGI24736J21556_10203272 156
53 3300001989 JGI24739J22299_10000783 JGI24739J22299_1000078312 156
54 3300001990 JGI24737J22298_10007573 JGI24737J22298_100075732 156
55 3300001990 JGI24737J22298_10015189 JGI24737J22298_100151893 156
56 3300002067 JGI24735J21928_10000002 JGI24735J21928_10000002504 156
57 3300002738 JGI25154J39366_1012167 JGI25154J39366_10121671 156
58 3300003215 JGI25153J46596_10018283 JGI25153J46596_100182831 156
59 3300003316 rootH1_10081086 rootH1_100810865 156
60 3300003320 rootH2_10052254 rootH2_100522543 156
61 3300003322 rootL2_10275954 rootL2_102759544 156
62 3300003354 JGI25160J50197_1004412 JGI25160J50197_10044123 156
63 3300003771 Ga0055526_1035187 Ga0055526_10351871 156
64 3300003790 Ga0055528_1000209 Ga0055528_10002095 156
65 3300003790 Ga0055528_1000317 Ga0055528_10003173 156
66 3300003791 Ga0055530_10020618 Ga0055530_100206182 156
67 3300004625 Ga0055543_1014310 Ga0055543_10143102 156
68 3300005262 Ga0065165_1000225 Ga0065165_100022570 156
69 3300005327 Ga0070658_10235785 Ga0070658_102357852 156
70 3300005327 Ga0070658_10481717 Ga0070658_104817171 156
71 3300005328 Ga0070676_10000053 Ga0070676_100000539 156
72 3300005329 Ga0070683_100745149 Ga0070683_1007451492 156
73 3300005331 Ga0070670_100352791 Ga0070670_1003527912 156
74 3300005335 Ga0070666_10000050 Ga0070666_1000005085 156
75 3300005335 Ga0070666_10745510 Ga0070666_107455101 156
76 3300005338 Ga0068868_100070835 Ga0068868_1000708354 156
77 3300005338 Ga0068868_100109700 Ga0068868_1001097002 156
78 3300005339 Ga0070660_100005857 Ga0070660_1000058577 156
79 3300005339 Ga0070660_100632296 Ga0070660_1006322962 156
80 3300005353 Ga0070669_100266142 Ga0070669_1002661422 156
81 3300005355 Ga0070671_100038320 Ga0070671_1000383203 156
82 3300005364 Ga0070673_100258728 Ga0070673_1002587282 156
83 3300005364 Ga0070673_100280794 Ga0070673_1002807942 156
84 3300005367 Ga0070667_100011433 Ga0070667_1000114332 156
85 3300005367 Ga0070667_100012636 Ga0070667_1000126365 156
86 3300005367 Ga0070667_101013920 Ga0070667_1010139201 156
87 3300005435 Ga0070714_101124158 Ga0070714_1011241581 156
88 3300005436 Ga0070713_100205885 Ga0070713_1002058851 156
89 3300005436 Ga0070713_101214464 Ga0070713_1012144641 156
90 3300005441 Ga0070700_101237561 Ga0070700_1012375611 156
91 3300005456 Ga0070678_100031234 Ga0070678_1000312343 156
92 3300005457 Ga0070662_100000132 Ga0070662_10000013233 156
93 3300005458 Ga0070681_10021014 Ga0070681_100210147 156
94 3300005459 Ga0068867_100004376 Ga0068867_1000043765 156
95 3300005535 Ga0070684_100037934 Ga0070684_1000379342 156
96 3300005535 Ga0070684_101098749 Ga0070684_1010987492 156
97 3300005539 Ga0068853_100018771 Ga0068853_1000187711 156
98 3300005539 Ga0068853_100055748 Ga0068853_1000557483 156
99 3300005539 Ga0068853_100147682 Ga0068853_1001476822 156
100 3300005543 Ga0070672_100110376 Ga0070672_1001103762 156
101 3300005543 Ga0070672_100441324 Ga0070672_1004413242 156
102 3300005548 Ga0070665_100000020 Ga0070665_100000020236 156
103 3300005548 Ga0070665_100058824 Ga0070665_1000588242 156
104 3300005563 Ga0068855_100023624 Ga0068855_1000236241 156
105 3300005563 Ga0068855_100096297 Ga0068855_1000962972 156
106 3300005563 Ga0068855_100135028 Ga0068855_1001350283 156
107 3300005563 Ga0068855_101554592 Ga0068855_1015545922 156
108 3300005577 Ga0068857_100138471 Ga0068857_1001384712 156
109 3300005577 Ga0068857_101121242 Ga0068857_1011212422 156
110 3300005578 Ga0068854_100705393 Ga0068854_1007053931 156
111 3300005614 Ga0068856_100222712 Ga0068856_1002227122 156
112 3300005616 Ga0068852_100003986 Ga0068852_1000039862 156
113 3300005616 Ga0068852_100005954 Ga0068852_1000059546 156
114 3300005616 Ga0068852_100708742 Ga0068852_1007087422 156
115 3300005617 Ga0068859_100000025 Ga0068859_10000002585 156
116 3300005617 Ga0068859_100011927 Ga0068859_1000119273 156
117 3300005618 Ga0068864_100016894 Ga0068864_1000168943 156
118 3300005618 Ga0068864_100516444 Ga0068864_1005164442 156
119 3300005618 Ga0068864_101629309 Ga0068864_1016293092 156
120 3300005618 Ga0068864_101925290 Ga0068864_1019252901 156
121 3300005718 Ga0068866_11099553 Ga0068866_110995532 156
122 3300005834 Ga0068851_10072084 Ga0068851_100720842 156
123 3300005841 Ga0068863_100002841 Ga0068863_1000028413 156
124 3300005841 Ga0068863_100289610 Ga0068863_1002896102 156
125 3300005842 Ga0068858_100011067 Ga0068858_1000110673 156
126 3300005843 Ga0068860_100003010 Ga0068860_10000301013 156
127 3300005843 Ga0068860_100016819 Ga0068860_1000168195 156
128 3300005985 Ga0081539_10051441 Ga0081539_100514412 156
129 3300005985 Ga0081539_10129031 Ga0081539_101290312 156
130 3300006195 Ga0075366_10104730 Ga0075366_101047302 156
131 3300006237 Ga0097621_100001247 Ga0097621_10000124711 156
132 3300006237 Ga0097621_100548690 Ga0097621_1005486902 156
133 3300006358 Ga0068871_100000710 Ga0068871_10000071015 156
134 3300006358 Ga0068871_100305299 Ga0068871_1003052992 156
135 3300006358 Ga0068871_100584222 Ga0068871_1005842222 156
136 3300006881 Ga0068865_100003231 Ga0068865_1000032313 156
137 3300006931 Ga0097620_100000025 Ga0097620_10000002585 156
138 3300006931 Ga0097620_100011927 Ga0097620_1000119276 156
139 3300009093 Ga0105240_10001590 Ga0105240_100015907 156
140 3300009093 Ga0105240_10165121 Ga0105240_101651214 156
141 3300009093 Ga0105240_10319974 Ga0105240_103199743 156
142 3300009098 Ga0105245_10285794 Ga0105245_102857942 156
143 3300009098 Ga0105245_12087967 Ga0105245_120879672 156
144 3300009101 Ga0105247_10029175 Ga0105247_100291752 156
145 3300009148 Ga0105243_10056302 Ga0105243_100563024 156
146 3300009148 Ga0105243_11430480 Ga0105243_114304802 156
147 3300009174 Ga0105241_10001218 Ga0105241_1000121813 156
148 3300009174 Ga0105241_10002147 Ga0105241_1000214715 156
149 3300009174 Ga0105241_10005149 Ga0105241_100051494 156
150 3300009174 Ga0105241_10181226 Ga0105241_101812262 156
151 3300009176 Ga0105242_10075581 Ga0105242_100755812 156
152 3300009545 Ga0105237_10005071 Ga0105237_100050713 156
153 3300009545 Ga0105237_10005234 Ga0105237_1000523413 156
154 3300009545 Ga0105237_10005513 Ga0105237_100055135 156
155 3300009545 Ga0105237_10007561 Ga0105237_100075616 156
156 3300009545 Ga0105237_10134754 Ga0105237_101347541 156
157 3300009545 Ga0105237_10174955 Ga0105237_101749552 156
158 3300009545 Ga0105237_10908119 Ga0105237_109081191 156
159 3300009551 Ga0105238_10002923 Ga0105238_1000292310 156
160 3300009551 Ga0105238_10465533 Ga0105238_104655332 156
161 3300009553 Ga0105249_10099896 Ga0105249_100998962 156
162 3300010375 Ga0105239_10050041 Ga0105239_100500416 156
163 3300010375 Ga0105239_10268375 Ga0105239_102683752 156
164 3300010375 Ga0105239_10313468 Ga0105239_103134683 156
165 3300011119 Ga0105246_10007813 Ga0105246_100078139 156
166 3300011119 Ga0105246_10552826 Ga0105246_105528263 156
167 3300013100 Ga0157373_10037590 Ga0157373_100375903 156
168 3300013102 Ga0157371_10100589 Ga0157371_101005892 156
169 3300013102 Ga0157371_10101777 Ga0157371_101017773 156
170 3300013102 Ga0157371_10151391 Ga0157371_101513912 156
171 3300013102 Ga0157371_10151413 Ga0157371_101514132 156
172 3300013104 Ga0157370_10414331 Ga0157370_104143312 156
173 3300013104 Ga0157370_10434743 Ga0157370_104347432 156
174 3300013105 Ga0157369_10329063 Ga0157369_103290632 156
175 3300013105 Ga0157369_11070987 Ga0157369_110709871 156
176 3300013296 Ga0157374_10002112 Ga0157374_100021127 156
177 3300013296 Ga0157374_10003227 Ga0157374_100032273 156
178 3300013296 Ga0157374_10052963 Ga0157374_100529633 156
179 3300013296 Ga0157374_10088782 Ga0157374_100887822 156
180 3300013297 Ga0157378_10002905 Ga0157378_100029057 156
181 3300013297 Ga0157378_10013693 Ga0157378_100136936 156
182 3300013297 Ga0157378_10057730 Ga0157378_100577303 156
183 3300013306 Ga0163162_10000032 Ga0163162_1000003257 156
184 3300013306 Ga0163162_10000344 Ga0163162_1000034420 156
185 3300013306 Ga0163162_10306013 Ga0163162_103060132 156
186 3300013306 Ga0163162_11599856 Ga0163162_115998561 156
187 3300013306 Ga0163162_12369200 Ga0163162_123692001 156
188 3300013307 Ga0157372_10002858 Ga0157372_1000285813 156
189 3300013307 Ga0157372_10098441 Ga0157372_100984415 156
190 3300013308 Ga0157375_10046977 Ga0157375_100469772 156
191 3300013308 Ga0157375_10105260 Ga0157375_101052604 156
192 3300013308 Ga0157375_10622578 Ga0157375_106225782 156
193 3300014325 Ga0163163_10531012 Ga0163163_105310122 156
194 3300014745 Ga0157377_10117356 Ga0157377_101173563 156
195 3300014968 Ga0157379_10025888 Ga0157379_100258882 156
196 3300014968 Ga0157379_10411603 Ga0157379_104116032 156
197 3300014969 Ga0157376_10007363 Ga0157376_100073632 156
198 3300017792 Ga0163161_10521296 Ga0163161_105212961 156
199 3300020070 Ga0206356_11644439 Ga0206356_116444392 156
200 3300021361 Ga0213872_10031289 Ga0213872_100312892 156
201 3300025233 Ga0209437_100024 Ga0209437_100024540 156
202 3300025246 Ga0209646_1002891 Ga0209646_10028912 156
203 3300025273 Ga0209673_1000167 Ga0209673_100016789 156
204 3300025295 Ga0209564_1001763 Ga0209564_10017636 156
205 3300025295 Ga0209564_1004541 Ga0209564_10045416 156
206 3300025295 Ga0209564_1089063 Ga0209564_10890632 156
207 3300025297 Ga0209758_1013768 Ga0209758_10137684 156
208 3300025298 Ga0209050_1000503 Ga0209050_10005033 156
209 3300025302 Ga0207426_1004780 Ga0207426_10047804 156
210 3300025303 Ga0209051_1077781 Ga0209051_10777812 156
211 3300025304 Ga0209257_1003179 Ga0209257_10031799 156
212 3300025321 Ga0207656_10149571 Ga0207656_101495712 156
213 3300025900 Ga0207710_10025163 Ga0207710_100251632 156
214 3300025903 Ga0207680_10000086 Ga0207680_100000863 156
215 3300025903 Ga0207680_10796485 Ga0207680_107964851 156
216 3300025904 Ga0207647_10002636 Ga0207647_1000263615 156
217 3300025907 Ga0207645_10000440 Ga0207645_1000044023 156
218 3300025909 Ga0207705_10013419 Ga0207705_100134194 156
219 3300025911 Ga0207654_10003112 Ga0207654_100031127 156
220 3300025911 Ga0207654_10003382 Ga0207654_100033822 156
221 3300025911 Ga0207654_10026306 Ga0207654_100263064 156
222 3300025912 Ga0207707_10101356 Ga0207707_101013562 156
223 3300025913 Ga0207695_10019578 Ga0207695_100195785 156
224 3300025913 Ga0207695_10022737 Ga0207695_100227379 156
225 3300025913 Ga0207695_10109889 Ga0207695_101098892 156
226 3300025914 Ga0207671_10003741 Ga0207671_100037418 156
227 3300025914 Ga0207671_10041100 Ga0207671_100411004 156
228 3300025914 Ga0207671_10045295 Ga0207671_100452952 156
229 3300025914 Ga0207671_10061581 Ga0207671_100615813 156
230 3300025914 Ga0207671_10090623 Ga0207671_100906232 156
231 3300025914 Ga0207671_10352321 Ga0207671_103523212 156
232 3300025914 Ga0207671_10509077 Ga0207671_105090772 156
233 3300025919 Ga0207657_10024815 Ga0207657_100248154 156
234 3300025919 Ga0207657_10828162 Ga0207657_108281622 156
235 3300025921 Ga0207652_10234357 Ga0207652_102343571 156
236 3300025923 Ga0207681_10196804 Ga0207681_101968042 156
237 3300025924 Ga0207694_10045797 Ga0207694_100457973 156
238 3300025924 Ga0207694_10901207 Ga0207694_109012072 156
239 3300025925 Ga0207650_10235102 Ga0207650_102351022 156
240 3300025925 Ga0207650_10525594 Ga0207650_105255942 156
241 3300025927 Ga0207687_10886206 Ga0207687_108862062 156
242 3300025933 Ga0207706_10000043 Ga0207706_100000437 156
243 3300025934 Ga0207686_10231683 Ga0207686_102316832 156
244 3300025934 Ga0207686_10773218 Ga0207686_107732182 156
245 3300025935 Ga0207709_10550351 Ga0207709_105503512 156
246 3300025935 Ga0207709_10668142 Ga0207709_106681422 156
247 3300025938 Ga0207704_10000120 Ga0207704_1000012022 156
248 3300025938 Ga0207704_10037988 Ga0207704_100379883 156
249 3300025940 Ga0207691_10195380 Ga0207691_101953802 156
250 3300025940 Ga0207691_10420680 Ga0207691_104206801 156
251 3300025942 Ga0207689_10073266 Ga0207689_100732662 156
252 3300025944 Ga0207661_10569136 Ga0207661_105691361 156
253 3300025949 Ga0207667_10128096 Ga0207667_101280962 156
254 3300025949 Ga0207667_10250986 Ga0207667_102509862 156
255 3300025949 Ga0207667_10325279 Ga0207667_103252792 156
256 3300025949 Ga0207667_10737383 Ga0207667_107373831 156
257 3300025949 Ga0207667_11379221 Ga0207667_113792212 156
258 3300025960 Ga0207651_10095750 Ga0207651_100957503 156
259 3300025960 Ga0207651_10303544 Ga0207651_103035441 156
260 3300025961 Ga0207712_10016747 Ga0207712_100167472 156
261 3300025986 Ga0207658_10069358 Ga0207658_100693582 156
262 3300025986 Ga0207658_10237326 Ga0207658_102373262 156
263 3300026023 Ga0207677_10047780 Ga0207677_100477802 156
264 3300026035 Ga0207703_10006240 Ga0207703_100062402 156
265 3300026035 Ga0207703_12235185 Ga0207703_122351851 156
266 3300026041 Ga0207639_10010887 Ga0207639_100108877 156
267 3300026041 Ga0207639_10014040 Ga0207639_100140401 156
268 3300026041 Ga0207639_10121741 Ga0207639_101217412 156
269 3300026041 Ga0207639_10203438 Ga0207639_102034382 156
270 3300026088 Ga0207641_10000661 Ga0207641_1000066124 156
271 3300026088 Ga0207641_10059102 Ga0207641_100591022 156
272 3300026089 Ga0207648_10008517 Ga0207648_100085176 156
273 3300026095 Ga0207676_10038678 Ga0207676_100386782 156
274 3300026095 Ga0207676_10072976 Ga0207676_100729762 156
275 3300026095 Ga0207676_11810000 Ga0207676_118100001 156
276 3300026121 Ga0207683_10009754 Ga0207683_100097546 156
277 3300026142 Ga0207698_10001744 Ga0207698_100017447 156
278 3300026142 Ga0207698_10002995 Ga0207698_1000299511 156
279 3300028379 Ga0268266_10000018 Ga0268266_10000018310 156
280 3300028379 Ga0268266_10057610 Ga0268266_100576102 156
281 3300028381 Ga0268264_10002203 Ga0268264_100022035 156
282 3300028786 Ga0307517_10006765 Ga0307517_100067654 156
283 3300028794 Ga0307515_10000162 Ga0307515_10000162109 156
284 3300028800 Ga0265338_10020762 Ga0265338_100207622 156
285 3300029957 Ga0265324_10008508 Ga0265324_100085082 156
286 3300031456 Ga0307513_10162634 Ga0307513_101626342 156
287 3300033180 Ga0307510_10000766 Ga0307510_1000076616 156
288 3300035172 Ga0373955_0064475 Ga0373955_0064475_1339_1815 156
289 3300035398 Ga0316574_0741514 Ga0316574_0741514_15_488 156
290 3300036401 Ga0373937_0024923 Ga0373937_0024923_629_1105 156
291 3300037418 Ga0395900_0000231 Ga0395900_0000231_7434_8009 156
292 3300037466 Ga0395898_0012430 Ga0395898_0012430_7118_7693 156
293 3300037471 Ga0395905_0000261 Ga0395905_0000261_7428_8003 156
294 3300037853 Ga0436364_0126689 Ga0436364_0126689_634_1158 156
295 3300038443 Ga0395901_0000236 Ga0395901_0000236_61530_62105 156
296 3300039447 Ga0436361_0020381 Ga0436361_0020381_1577_2047 156
297 3300042000 Ga0439437_047902 Ga0439437_047902_15_485 156
298 3300042005 Ga0439448_0026007 Ga0439448_0026007_1283_1753 156
299 3300042014 Ga0439457_056842 Ga0439457_056842_75_545 156
300 3300042436 Ga0439435_0011220 Ga0439435_0011220_609_1112 156
301 3300042876 Ga0451577_0009571 Ga0451577_0009571_2982_3491 156
302 3300044656 Ga0466969_0102905 Ga0466969_0102905_468_938 156
303 3300044658 Ga0466972_0000062 Ga0466972_0000062_8752_9222 156
304 3300044658 Ga0466972_0015232 Ga0466972_0015232_683_1153 156
305 3300044693 Ga0466961_0350116 Ga0466961_0350116_210_680 156
306 3300044719 Ga0466971_0331358 Ga0466971_0331358_36_506 156
307 3300044765 Ga0466970_0298650 Ga0466970_0298650_343_813 156
308 3300045049 Ga0466959_0048157 Ga0466959_0048157_1278_1748 156
309 3300045049 Ga0466959_0172996 Ga0466959_0172996_131_601 156
310 3300045051 Ga0451576_0027340 Ga0451576_0027340_1230_1739 156
311 3300045836 Ga0466958_0722353 Ga0466958_0722353_133_603 156
312 3300046462 Ga0495651_0044860 Ga0495651_0044860_1071_1541 156
313 3300046471 Ga0495650_0042353 Ga0495650_0042353_43_513 156
314 3300046472 Ga0495580_0042540 Ga0495580_0042540_1147_1623 156
315 3300046500 Ga0495596_0052271 Ga0495596_0052271_1095_1565 156
316 3300046506 Ga0495583_0052018 Ga0495583_0052018_517_987 156
317 3300046506 Ga0495583_0258429 Ga0495583_0258429_159_629 156
318 3300046511 Ga0495608_0114514 Ga0495608_0114514_839_1315 156
319 3300046513 Ga0495616_0035715 Ga0495616_0035715_813_1283 156
320 3300046519 Ga0495632_0094399 Ga0495632_0094399_709_1179 156
321 3300046536 Ga0495587_0084330 Ga0495587_0084330_727_1203 156
322 3300046543 Ga0495645_0433205 Ga0495645_0433205_338_814 156
323 3300046559 Ga0495667_0368178 Ga0495667_0368178_214_690 156
324 3300046616 Ga0495668_0106075 Ga0495668_0106075_667_1137 156
325 3300046616 Ga0495668_0344009 Ga0495668_0344009_157_627 156
326 3300046660 Ga0495625_0000005 Ga0495625_0000005_464239_464709 156
327 3300046660 Ga0495625_0009290 Ga0495625_0009290_4402_4872 156
328 3300046660 Ga0495625_0063142 Ga0495625_0063142_136_606 156
329 3300046660 Ga0495625_0090199 Ga0495625_0090199_461_931 156
330 3300046660 Ga0495625_0433034 Ga0495625_0433034_199_669 156
331 3300046665 Ga0495661_0005445 Ga0495661_0005445_6492_6962 156
332 3300046684 Ga0495669_0023652 Ga0495669_0023652_1592_2062 156
333 3300046694 Ga0495649_0000003 Ga0495649_0000003_644997_645467 156
334 3300046694 Ga0495649_0063220 Ga0495649_0063220_1119_1589 156
335 3300046810 Ga0495660_0048514 Ga0495660_0048514_315_785 156
336 3300047317 Ga0495604_0197126 Ga0495604_0197126_748_1224 156
337 3300047443 Ga0495687_106578 Ga0495687_106578_520_990 156
338 3300047472 Ga0495686_0044810 Ga0495686_0044810_287_757 156
339 3300048088 Ga0495602_0042214 Ga0495602_0042214_1304_1780 156
340 3300049520 Ga0501297_013697 Ga0501297_013697_10_504 156
341 3300049581 Ga0501047_0109067 Ga0501047_0109067_38_514 156
342 3300050493 nmdc:mga0k408_319903_c1 nmdc:mga0k408_319903_c1_325_795 156
343 3300053089 Ga0500581_173266 Ga0500581_173266_236_706 156
344 3300053122 Ga0500608_003726 Ga0500608_003726_536_1006 156
345 3300059639 Ga0587062_064667 Ga0587062_064667_124_594 156
346 2162886007 SwRhRL2b_contig_2198354 SwRhRL2b_0012.00003330 157
347 3300003322 rootL2_10091320 rootL2_100913202 157
348 3300003322 rootL2_10185155 rootL2_101851552 157
349 3300003791 Ga0055530_10005661 Ga0055530_100056615 157
350 3300003794 Ga0055531_10000354 Ga0055531_100003547 157
351 3300005288 Ga0065714_10003480 Ga0065714_100034806 157
352 3300005288 Ga0065714_10016702 Ga0065714_100167021 157
353 3300005289 Ga0065704_10000258 Ga0065704_1000025835 157
354 3300005329 Ga0070683_100028149 Ga0070683_1000281492 157
355 3300005336 Ga0070680_100047401 Ga0070680_1000474012 157
356 3300005436 Ga0070713_100436295 Ga0070713_1004362952 157
357 3300005456 Ga0070678_101077194 Ga0070678_1010771941 157
358 3300005459 Ga0068867_100344420 Ga0068867_1003444201 157
359 3300005535 Ga0070684_100659932 Ga0070684_1006599322 157
360 3300005616 Ga0068852_100467106 Ga0068852_1004671062 157
361 3300005842 Ga0068858_101007505 Ga0068858_1010075051 157
362 3300005843 Ga0068860_101542365 Ga0068860_1015423652 157
363 3300006358 Ga0068871_100851800 Ga0068871_1008518001 157
364 3300006358 Ga0068871_101861024 Ga0068871_1018610241 157
365 3300009101 Ga0105247_10553570 Ga0105247_105535701 157
366 3300009176 Ga0105242_10389042 Ga0105242_103890422 157
367 3300011119 Ga0105246_10336892 Ga0105246_103368922 157
368 3300013100 Ga0157373_10000578 Ga0157373_1000057815 157
369 3300013104 Ga0157370_10012898 Ga0157370_100128985 157
370 3300013104 Ga0157370_10927471 Ga0157370_109274711 157
371 3300013105 Ga0157369_10103496 Ga0157369_101034963 157
372 3300013297 Ga0157378_10126202 Ga0157378_101262022 157
373 3300013306 Ga0163162_10099580 Ga0163162_100995803 157
374 3300013306 Ga0163162_10218310 Ga0163162_102183102 157
375 3300013306 Ga0163162_10288161 Ga0163162_102881612 157
376 3300013306 Ga0163162_10782639 Ga0163162_107826392 157
377 3300013308 Ga0157375_10486316 Ga0157375_104863163 157
378 3300013308 Ga0157375_10532032 Ga0157375_105320322 157
379 3300017792 Ga0163161_10337241 Ga0163161_103372412 157
380 3300025292 Ga0209676_1000001 Ga0209676_1000001968 157
381 3300025298 Ga0209050_1000018 Ga0209050_1000018615 157
382 3300025304 Ga0209257_1000008 Ga0209257_1000008983 157
383 3300025899 Ga0207642_10343912 Ga0207642_103439121 157
384 3300025917 Ga0207660_10040488 Ga0207660_100404882 157
385 3300025920 Ga0207649_11578123 Ga0207649_115781231 157
386 3300025923 Ga0207681_10524243 Ga0207681_105242432 157
387 3300025928 Ga0207700_10101554 Ga0207700_101015542 157
388 3300025931 Ga0207644_10006375 Ga0207644_100063756 157
389 3300025940 Ga0207691_10464867 Ga0207691_104648672 157
390 3300026089 Ga0207648_10108564 Ga0207648_101085642 157
391 3300028786 Ga0307517_10011991 Ga0307517_100119919 157
392 3300031507 Ga0307509_10023175 Ga0307509_100231754 157
393 3300031911 Ga0307412_10000031 Ga0307412_100000314 157
394 3300032004 Ga0307414_10001701 Ga0307414_100017013 157
395 3300035118 Ga0373954_0322448 Ga0373954_0322448_149_622 157
396 3300035172 Ga0373955_0110386 Ga0373955_0110386_439_912 157
397 3300036401 Ga0373937_0787200 Ga0373937_0787200_89_565 157
398 3300036401 Ga0373937_0837019 Ga0373937_0837019_314_787 157
399 3300037312 Ga0395899_0110378 Ga0395899_0110378_1123_1596 157
400 3300037418 Ga0395900_0026896 Ga0395900_0026896_177_650 157
401 3300037466 Ga0395898_0076397 Ga0395898_0076397_1972_2445 157
402 3300037471 Ga0395905_0000769 Ga0395905_0000769_7021_7494 157
403 3300038443 Ga0395901_0003843 Ga0395901_0003843_8803_9276 157
404 3300041997 Ga0439431_0027889 Ga0439431_0027889_180_653 157
405 3300042876 Ga0451577_0202546 Ga0451577_0202546_234_716 157
406 3300042876 Ga0451577_0261008 Ga0451577_0261008_998_1471 157
407 3300046459 Ga0495629_0083755 Ga0495629_0083755_1281_1754 157
408 3300046460 Ga0495638_0148451 Ga0495638_0148451_806_1279 157
409 3300046507 Ga0495606_0254605 Ga0495606_0254605_459_932 157
410 3300046513 Ga0495616_0009420 Ga0495616_0009420_2651_3124 157
411 3300046517 Ga0495630_0038337 Ga0495630_0038337_1187_1660 157
412 3300046529 Ga0495652_0585825 Ga0495652_0585825_115_588 157
413 3300046531 Ga0495665_0272735 Ga0495665_0272735_356_829 157
414 3300046535 Ga0495586_0054309 Ga0495586_0054309_213_686 157
415 3300046543 Ga0495645_0120134 Ga0495645_0120134_1236_1709 157
416 3300046558 Ga0495633_0000014 Ga0495633_0000014_111240_111713 157
417 3300046558 Ga0495633_0000104 Ga0495633_0000104_42310_42783 157
418 3300046558 Ga0495633_0000104 Ga0495633_0000104_45414_45887 157
419 3300046559 Ga0495667_0521402 Ga0495667_0521402_30_503 157
420 3300046660 Ga0495625_0055057 Ga0495625_0055057_1090_1563 157
421 3300046692 Ga0495671_0193084 Ga0495671_0193084_124_597 157
422 3300047317 Ga0495604_0364254 Ga0495604_0364254_343_816 157
423 3300047319 Ga0495674_0074974 Ga0495674_0074974_2116_2589 157
424 3300047443 Ga0495687_002745 Ga0495687_002745_7877_8350 157
425 3300048918 Ga0496115_1104766 Ga0496115_1104766_89_562 157
426 3300048929 Ga0496126_0046152 Ga0496126_0046152_2785_3258 157
427 3300049459 Ga0495678_049516 Ga0495678_049516_654_1127 157
428 3300049758 Ga0501241_000943 Ga0501241_000943_1625_2098 157
429 3300049758 Ga0501241_002500 Ga0501241_002500_2480_2953 157
430 3300053088 Ga0500644_0140514 Ga0500644_0140514_255_737 157
431 3300053093 Ga0500651_0016121 Ga0500651_0016121_2563_3036 157
432 3300053093 Ga0500651_0036214 Ga0500651_0036214_2569_3042 157
433 3300053147 Ga0500589_017274 Ga0500589_017274_2083_2571 157
434 3300053156 Ga0500622_0000844 Ga0500622_0000844_5977_6483 157
435 3300053156 Ga0500622_0013499 Ga0500622_0013499_1738_2241 157
436 3300053157 Ga0500624_000909 Ga0500624_000909_3699_4172 157
437 3300053730 Ga0500645_004358 Ga0500645_004358_4523_5005 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

108

180

0.95

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

40

106

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.8712 2 152
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.855 2 151
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.8524 2 151
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.8498 2 152
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.8459 2 153
ID Description Score Start End Superfamily
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.8863 82 149 1.10.150.120
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.884 82 150 1.10.150.120
1ffuD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.8705 82 149 1.10.150.120
3hrdH02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.8589 83 149 1.10.150.120
1alo002 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.8575 82 153 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A7Y9HYG7-F1-model_v4 Aerobic-type carbon monoxide dehydrogenase small subunit (CoxS/CutS family) 0.9326 55 154 GO:0016491
GO:0046872
GO:0051537
AF-A0A2V7RUN0-F1-model_v4 [2Fe-2S]-binding domain-containing protein 0.9218 51 149 GO:0016491
GO:0046872
GO:0051537
AF-A0A2V7FSL9-F1-model_v4 (2Fe-2S)-binding protein 0.9213 43 152 GO:0016491
GO:0046872
GO:0051537
AF-A0A7Y3G6D5-F1-model_v4 (2Fe-2S)-binding protein 0.9154 44 149 GO:0016491
GO:0046872
GO:0051537
AF-A0A2R6M1L7-F1-model_v4 Carbon monoxide dehydrogenase 0.9105 43 154 GO:0016491
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
87.75 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map