F443595

General Info

Members Datasets Scaffolds Average Seq Length
436 302 340 458

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0014462|Ga0395898_0014462_1292_2791
Length 499
Sequence MPRALCRGLHAAGFLPPVRLSLDQWTAPSGPDHFGGHVLAPKSQLDAIVSLAKRRGFVFQAGEIYGGSRSAWDYGPLGVELKENIKEQWWQTFVRSREDMVGLDSSVILPKQVWEASGHVATFTDPLVECLNCHKRHRQDHLIEAYEAKKGRAPEKGMESITCPDCGITGKWTEPQMFSGLMKTFLGPVDNEEGLHYMRPETAQGIFVNFNNVVTTSRRKPPFGIGQIGKAFRNEITPGNFIFRTREFEQMEIEYFTAPAEADEWFKHWVDACWNWFVDLGINPDNMRKFDVPEHERAHYSAGTIDLEYRFGFQGNEWGELMGIANRTDFDLGSHSKASGHELSYFDQTTNERYVPYVIEPSFGLTRSMMAFLVDAYSEDEAPNTKGGVDKRTVLRLDPRLAPVKAAVLPLSRNEDLSPKARDLGAQLRKHWNIEFDDAGAIGRRYRRQDEIGTPFCITVDFETLEDHAVTIRERDTMTQERVSLDKVQGYLFERLFKN

Samples

Sample ID Description Type Environment
1 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
2 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
3 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
4 2643221546 Microbacterium sp. Root53 Isolate Unclassified
5 2643221553 Microbacterium sp. Root553 Isolate Unclassified
6 2643221566 Microbacterium sp. Root166 Isolate Unclassified
7 2643221575 Microbacterium sp. Root61 Isolate Unclassified
8 2643221597 Microbacterium sp. Root180 Isolate Unclassified
9 2643221616 Leifsonia sp. Root227 Isolate Unclassified
10 2643221630 Microbacterium sp. Root322 Isolate Unclassified
11 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
12 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
13 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
14 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
15 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
16 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
17 2739367653 Kocuria sp. OV113 Isolate Unclassified
18 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
19 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
20 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
21 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
22 2773857759 Microbacterium sp. 1294 Isolate Unclassified
23 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
24 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
25 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
26 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
27 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
28 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
29 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
30 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
31 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
32 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
33 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
34 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
35 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
36 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
37 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
38 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
39 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
40 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
41 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
42 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
43 2857727296 Kocuria sp. R-72562 Isolate Unclassified
44 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
45 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
46 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
47 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
48 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
49 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
50 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
51 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
52 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
53 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
54 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
55 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
56 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
57 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
58 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
59 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
60 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
61 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
62 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
63 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
64 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
65 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
66 2919069694 Microbacterium sp. 1154 Isolate Unclassified
67 2919395869 Microbacterium resistens 2980 Isolate Unclassified
68 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
69 2920879853 Kocuria salina CV6 Isolate Unclassified
70 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
71 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
72 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
73 2928153084 Leifsonia sp. 563 Isolate Unclassified
74 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
75 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
76 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
77 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
78 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
79 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
80 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
81 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
82 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
83 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
84 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
85 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
86 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
87 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
88 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
89 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
90 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
91 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
92 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
93 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
94 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
96 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
97 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
98 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
99 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
100 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
101 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
102 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
103 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
104 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
105 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
106 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
107 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
108 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
109 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
110 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
111 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
112 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
113 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
114 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
115 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
116 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
117 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
118 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
119 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
120 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
121 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
122 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
123 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
124 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
125 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
126 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
127 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
128 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
129 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
130 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
152 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
153 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
155 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
158 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
196 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
197 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
198 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
199 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
200 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
201 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
202 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
203 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
204 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
210 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
211 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
212 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
213 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
214 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
215 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
216 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
217 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
231 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
234 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
235 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
236 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
237 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
260 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
271 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
272 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
273 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
278 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
279 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
280 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
281 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
282 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
283 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
284 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
285 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
286 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
287 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
288 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
289 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
290 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
291 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
294 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
295 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
296 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
297 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
298 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
299 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
300 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
301 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
302 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 77.29
Metatranscriptomes 0.69
Isolates 22.02

Biome Distribution

Category Percentage (%)
Aerial Root 0.69
Bulb 0
Endosphere 12.16
Nodule 0
Rhizoplane 3.9
Rhizosphere 57.11
Stem 0
Stem Tuber 0.23
Unclassified 25.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002591 3300001979 Bacteria 8152
2 JGI24739J22299_10007264 3300001989 Bacteria 4163
3 JGI25154J39366_1002454 3300002738 Bacteria 4790
4 JGI25164J39214_1000769 3300002772 Bacteria 11753
5 JGI25406J46586_10020397 3300003203 Bacteria 2681
6 JGI25165J46597_1000005 3300003214 Bacteria 623702
7 JGI25407J50210_10000807 3300003373 Bacteria 6675
8 Ga0006562J51391_1010836 3300003578 Bacteria 7790
9 Ga0006562J51391_1018456 3300003578 Bacteria 13701
10 Ga0055533_1000002 3300003756 Bacteria 1196393
11 Ga0055525_1000142 3300003759 Bacteria 100877
12 Ga0055527_1000004 3300003760 Bacteria 570634
13 Ga0055542_1000307 3300003762 Bacteria 53734
14 Ga0055529_1000008 3300003763 Bacteria 394786
15 Ga0070658_10000122 3300005327 Bacteria 69245
16 Ga0070658_10046640 3300005327 Bacteria 3506
17 Ga0070658_10046819 3300005327 Bacteria 3499
18 Ga0070660_100115474 3300005339 Bacteria 2140
19 Ga0070661_100035007 3300005344 Bacteria 3644
20 Ga0070668_100022791 3300005347 Bacteria 4734
21 Ga0070685_10010635 3300005466 Bacteria 4788
22 Ga0070698_100025796 3300005471 Bacteria 6125
23 Ga0068853_100046635 3300005539 Bacteria 3717
24 Ga0068855_100190954 3300005563 Bacteria 2310
25 Ga0068856_100071645 3300005614 Bacteria 3431
26 Ga0068856_100114260 3300005614 Bacteria 2699
27 Ga0068852_100024812 3300005616 Bacteria 4850
28 Ga0068861_100024602 3300005719 Bacteria 4356
29 Ga0068851_10000003 3300005834 Bacteria 293018
30 Ga0081455_10028260 3300005937 Bacteria 5126
31 Ga0081455_10060708 3300005937 Bacteria 3185
32 Ga0081538_10000522 3300005981 Bacteria 42868
33 Ga0081538_10007704 3300005981 Bacteria 9277
34 Ga0081538_10007868 3300005981 Bacteria 9136
35 Ga0081538_10008017 3300005981 Bacteria 9031
36 Ga0081539_10019374 3300005985 Bacteria 4662
37 Ga0075365_10010379 3300006038 Bacteria 5420
38 Ga0075363_100100412 3300006048 Bacteria 1601
39 Ga0075364_10126388 3300006051 Bacteria 1714
40 Ga0075432_10006490 3300006058 Bacteria 3980
41 Ga0075369_10009837 3300006186 Bacteria 3728
42 Ga0075427_10000733 3300006194 Bacteria 3939
43 Ga0075430_100003482 3300006846 Bacteria 13168
44 Ga0075431_100029335 3300006847 Bacteria 5662
45 Ga0075433_10100452 3300006852 Bacteria 2561
46 Ga0075429_100029277 3300006880 Bacteria 4783
47 Ga0105244_10086575 3300009036 Bacteria 1545
48 Ga0105240_10006064 3300009093 Bacteria 17858
49 Ga0105240_10060054 3300009093 Bacteria 4741
50 Ga0111539_10068868 3300009094 Bacteria 4178
51 Ga0105243_10061474 3300009148 Bacteria 3004
52 Ga0105241_10001064 3300009174 Bacteria 20907
53 Ga0105241_10090732 3300009174 Bacteria 2410
54 Ga0105248_10003592 3300009177 Bacteria 17186
55 Ga0105237_10000131 3300009545 Bacteria 105010
56 Ga0105238_10031598 3300009551 Bacteria 5390
57 Ga0105249_10005067 3300009553 Bacteria 11353
58 Ga0157371_10000825 3300013102 Bacteria 35495
59 Ga0157370_10096766 3300013104 Bacteria 2769
60 Ga0157369_10072999 3300013105 Bacteria 3681
61 Ga0157369_10379899 3300013105 Bacteria 1466
62 Ga0171462_1002 3300013250 Bacteria 1052134
63 Ga0163162_10218555 3300013306 Bacteria 2036
64 Ga0157372_10123812 3300013307 Bacteria 2972
65 Ga0157375_10134435 3300013308 Bacteria 2595
66 Ga0163161_10061892 3300017792 Bacteria 2725
67 Ga0197907_10480862 3300020069 Bacteria 2824
68 Ga0209566_100013 3300025225 Bacteria 474033
69 Ga0209674_100001 3300025226 Bacteria 4013750
70 Ga0209672_100011 3300025228 Bacteria 856297
71 Ga0209147_101041 3300025229 Bacteria 11812
72 Ga0209563_100001 3300025230 Bacteria 4013775
73 Ga0209563_100165 3300025230 Bacteria 50808
74 Ga0207427_100325 3300025231 Bacteria 32046
75 Ga0209437_101278 3300025233 Bacteria 6814
76 Ga0209258_101076 3300025242 Bacteria 11745
77 Ga0209646_1000014 3300025246 Bacteria 550484
78 Ga0209677_100001 3300025253 Bacteria 4013787
79 Ga0209677_101085 3300025253 Bacteria 12818
80 Ga0209148_1000023 3300025254 Bacteria 680511
81 Ga0209233_1000001 3300025261 Bacteria 2992747
82 Ga0209455_1000023 3300025272 Bacteria 680449
83 Ga0207656_10000002 3300025321 Bacteria 792178
84 Ga0207655_1002720 3300025728 Bacteria 13828
85 Ga0207705_10000006 3300025909 Bacteria 657147
86 Ga0207654_10000001 3300025911 Bacteria 1816198
87 Ga0207695_10006059 3300025913 Bacteria 15782
88 Ga0207695_10013887 3300025913 Bacteria 9574
89 Ga0207671_10000002 3300025914 Bacteria 1144816
90 Ga0207694_10000092 3300025924 Bacteria 100605
91 Ga0207690_10001146 3300025932 Bacteria 16853
92 Ga0207690_10014454 3300025932 Bacteria 4769
93 Ga0207706_10009133 3300025933 Bacteria 9114
94 Ga0207711_10004780 3300025941 Bacteria 11496
95 Ga0207667_10006393 3300025949 Bacteria 14282
96 Ga0207667_10240240 3300025949 Bacteria 1854
97 Ga0207712_10059472 3300025961 Bacteria 2705
98 Ga0207668_10077968 3300025972 Bacteria 2391
99 Ga0207658_10009467 3300025986 Bacteria 6609
100 Ga0207703_10000031 3300026035 Bacteria 196940
101 Ga0207639_10107199 3300026041 Bacteria 2269
102 Ga0207678_10031516 3300026067 Bacteria 4625
103 Ga0207702_10264739 3300026078 Bacteria 1620
104 Ga0207674_10004399 3300026116 Bacteria 16981
105 Ga0207675_100013381 3300026118 Bacteria 7655
106 Ga0207698_10000277 3300026142 Bacteria 31170
107 Ga0207698_10135901 3300026142 Bacteria 2109
108 Ga0207428_10007161 3300027907 Bacteria 10204
109 Ga0307514_10033590 3300031649 Bacteria 4094
110 Ga0307405_10109082 3300031731 Bacteria 1871
111 Ga0307410_10006276 3300031852 Bacteria 6402
112 Ga0307410_10007489 3300031852 Bacteria 5979
113 Ga0307410_10082538 3300031852 Bacteria 2261
114 Ga0307406_10000040 3300031901 Bacteria 76020
115 Ga0307406_10000541 3300031901 Bacteria 21782
116 Ga0307406_10004111 3300031901 Bacteria 7924
117 Ga0307406_10004408 3300031901 Bacteria 7654
118 Ga0307407_10003100 3300031903 Bacteria 6717
119 Ga0307412_10007073 3300031911 Bacteria 6368
120 Ga0307412_10072203 3300031911 Bacteria 2358
121 Ga0307412_10089037 3300031911 Bacteria 2154
122 Ga0307412_10137416 3300031911 Bacteria 1785
123 Ga0307409_100080012 3300031995 Bacteria 2635
124 Ga0307416_100008846 3300032002 Bacteria 6534
125 Ga0307416_100008967 3300032002 Bacteria 6504
126 Ga0307416_100012622 3300032002 Bacteria 5702
127 Ga0307415_100002964 3300032126 Bacteria 8530
128 Ga0307415_100006120 3300032126 Bacteria 6456
129 Ga0307415_100006787 3300032126 Bacteria 6209
130 Ga0307415_100076931 3300032126 Bacteria 2367
131 Ga0395899_0002887 3300037312 Bacteria 13806
132 Ga0395900_0001268 3300037418 Bacteria 30876
133 Ga0395898_0000270 3300037466 Bacteria 127152
134 Ga0395898_0002175 3300037466 Bacteria 24008
135 Ga0395898_0014462 3300037466 Bacteria 8105
136 Ga0395898_0145080 3300037466 Bacteria 2272
137 Ga0395905_0132496 3300037471 Bacteria 2344
138 Ga0395901_0036962 3300038443 Bacteria 5049
139 Ga0395901_0076757 3300038443 Bacteria 3486
140 Ga0395901_0121716 3300038443 Bacteria 2742
141 Ga0395901_0309169 3300038443 Bacteria 1637
142 Ga0439466_0011593 3300041411 Bacteria 3259
143 Ga0451833_0342895 3300041491 Bacteria 7928
144 Ga0451837_0314787 3300041494 Bacteria 5627
145 Ga0439442_000440 3300042002 Bacteria 9412
146 Ga0439442_002606 3300042002 Bacteria 3540
147 Ga0439449_0001421 3300042007 Bacteria 9359
148 Ga0439450_000036 3300042008 Bacteria 11234
149 Ga0439444_0000340 3300042437 Bacteria 4935
150 Ga0450916_000455 3300042530 Bacteria 3531
151 Ga0466972_0006508 3300044658 Bacteria 5867
152 Ga0466972_0036994 3300044658 Bacteria 2386
153 Ga0466965_0000007 3300044683 Bacteria 131940
154 Ga0466966_0010378 3300044684 Bacteria 6184
155 Ga0466966_0019666 3300044684 Bacteria 4442
156 Ga0466966_0164451 3300044684 Bacteria 1350
157 Ga0466961_0057634 3300044693 Bacteria 2472
158 Ga0466971_0013331 3300044719 Bacteria 3609
159 Ga0466970_0000121 3300044765 Bacteria 35105
160 Ga0466970_0010547 3300044765 Bacteria 4692
161 Ga0466970_0024309 3300044765 Bacteria 3167
162 Ga0495627_000312 3300046453 Bacteria 47799
163 Ga0495590_0000329 3300046457 Bacteria 24701
164 Ga0495644_0016521 3300046523 Bacteria 2825
165 Ga0495609_0052098 3300046538 Bacteria 1821
166 Ga0495656_0003282 3300046615 Bacteria 5457
167 Ga0495659_0019230 3300046664 Bacteria 2285
168 Ga0495661_0093857 3300046665 Bacteria 1702
169 Ga0495671_0075960 3300046692 Bacteria 1648
170 Ga0495677_0026611 3300047445 Bacteria 2098
171 Ga0496100_0012480 3300048903 Bacteria 4873
172 Ga0496102_0060300 3300048905 Bacteria 3470
173 Ga0496103_0010300 3300048906 Bacteria 5530
174 Ga0496104_0003233 3300048907 Bacteria 14030
175 Ga0496104_0089339 3300048907 Bacteria 2943
176 Ga0496105_0017470 3300048908 Bacteria 5753
177 Ga0496107_0047279 3300048910 Bacteria 3099
178 Ga0496109_0086210 3300048912 Bacteria 2900
179 Ga0496110_0092839 3300048913 Bacteria 2701
180 Ga0496111_0023834 3300048914 Bacteria 4300
181 Ga0496112_0167003 3300048915 Bacteria 2166
182 Ga0496114_0038195 3300048917 Bacteria 3972
183 Ga0496114_0059432 3300048917 Bacteria 3193
184 Ga0496114_0216085 3300048917 Bacteria 1682
185 Ga0496115_0036408 3300048918 Bacteria 3896
186 Ga0496115_0071800 3300048918 Bacteria 2808
187 Ga0496115_0135959 3300048918 Bacteria 2027
188 Ga0496116_0027774 3300048919 Bacteria 4111
189 Ga0496117_0000014 3300048920 Bacteria 584427
190 Ga0496117_0000808 3300048920 Bacteria 48592
191 Ga0496117_0001925 3300048920 Bacteria 27694
192 Ga0496117_0006325 3300048920 Bacteria 12050
193 Ga0496117_0006847 3300048920 Bacteria 11327
194 Ga0496117_0014300 3300048920 Bacteria 6847
195 Ga0496118_0000601 3300048921 Bacteria 59471
196 Ga0496118_0014034 3300048921 Bacteria 7523
197 Ga0496118_0038477 3300048921 Bacteria 3833
198 Ga0496119_0001243 3300048922 Bacteria 31699
199 Ga0496119_0002674 3300048922 Bacteria 19260
200 Ga0496119_0002944 3300048922 Bacteria 18108
201 Ga0496119_0006163 3300048922 Bacteria 11216
202 Ga0496119_0007487 3300048922 Bacteria 9815
203 Ga0496119_0013750 3300048922 Bacteria 6409
204 Ga0496119_0023820 3300048922 Bacteria 4327
205 Ga0496119_0029470 3300048922 Bacteria 3721
206 Ga0496119_0035518 3300048922 Bacteria 3265
207 Ga0496119_0063512 3300048922 Bacteria 2196
208 Ga0496120_0000655 3300048923 Bacteria 50898
209 Ga0496120_0001070 3300048923 Bacteria 36178
210 Ga0496120_0001359 3300048923 Bacteria 30036
211 Ga0496120_0003745 3300048923 Bacteria 13474
212 Ga0496120_0095036 3300048923 Bacteria 1585
213 Ga0496121_0000277 3300048924 Bacteria 107014
214 Ga0496121_0053372 3300048924 Bacteria 3387
215 Ga0496121_0175996 3300048924 Bacteria 1549
216 Ga0496122_0000358 3300048925 Bacteria 98103
217 Ga0496122_0000475 3300048925 Bacteria 83356
218 Ga0496122_0003643 3300048925 Bacteria 20024
219 Ga0496122_0004671 3300048925 Bacteria 16822
220 Ga0496122_0015130 3300048925 Bacteria 7395
221 Ga0496122_0058642 3300048925 Bacteria 2847
222 Ga0496123_0000011 3300048926 Bacteria 493925
223 Ga0496123_0000280 3300048926 Bacteria 100544
224 Ga0496123_0001137 3300048926 Bacteria 39763
225 Ga0496123_0053449 3300048926 Bacteria 2669
226 Ga0496124_0000899 3300048927 Bacteria 48070
227 Ga0496124_0011327 3300048927 Bacteria 8920
228 Ga0496124_0015407 3300048927 Bacteria 7328
229 Ga0496124_0087223 3300048927 Bacteria 2552
230 Ga0496125_0000444 3300048928 Bacteria 75459
231 Ga0496125_0002089 3300048928 Bacteria 26891
232 Ga0496125_0009474 3300048928 Bacteria 9997
233 Ga0496125_0020834 3300048928 Bacteria 6138
234 Ga0496125_0030397 3300048928 Bacteria 4833
235 Ga0496125_0048354 3300048928 Bacteria 3548
236 Ga0496126_0000912 3300048929 Bacteria 51111
237 Ga0496126_0007451 3300048929 Bacteria 11999
238 Ga0496126_0008290 3300048929 Bacteria 11224
239 Ga0496126_0014990 3300048929 Bacteria 7815
240 Ga0496126_0015932 3300048929 Bacteria 7541
241 Ga0496126_0044700 3300048929 Bacteria 4077
242 Ga0496126_0053916 3300048929 Bacteria 3645
243 Ga0496126_0069136 3300048929 Bacteria 3151
244 Ga0501031_0124278 3300049568 Bacteria 1685
245 Ga0501032_0073041 3300049569 Bacteria 2286
246 Ga0501033_0015202 3300049570 Bacteria 5842
247 Ga0501033_0025171 3300049570 Bacteria 4483
248 Ga0501034_0001656 3300049571 Bacteria 28757
249 Ga0501034_0051673 3300049571 Bacteria 4144
250 Ga0501034_0051679 3300049571 Bacteria 4144
251 Ga0501034_0113297 3300049571 Bacteria 2702
252 Ga0501034_0122520 3300049571 Bacteria 2586
253 Ga0501036_0001354 3300049572 Bacteria 18784
254 Ga0501037_0006742 3300049573 Bacteria 8401
255 Ga0501038_0004443 3300049574 Bacteria 13032
256 Ga0501038_0005477 3300049574 Bacteria 11792
257 Ga0501038_0043374 3300049574 Bacteria 3911
258 Ga0501038_0049611 3300049574 Bacteria 3629
259 Ga0501038_0071265 3300049574 Bacteria 2948
260 Ga0501040_0019707 3300049576 Bacteria 4489
261 Ga0501041_0000506 3300049577 Bacteria 20074
262 Ga0501042_0034185 3300049578 Bacteria 3605
263 Ga0501042_0052649 3300049578 Bacteria 2903
264 Ga0501043_0002084 3300049579 Bacteria 17078
265 Ga0501043_0005043 3300049579 Bacteria 10680
266 Ga0501046_0189329 3300049580 Bacteria 1535
267 Ga0501047_0006712 3300049581 Bacteria 10821
268 Ga0501047_0128913 3300049581 Bacteria 2410
269 Ga0501048_0002335 3300049582 Bacteria 14481
270 Ga0501048_0003348 3300049582 Bacteria 12191
271 Ga0501068_0081290 3300049584 Bacteria 1989
272 Ga0501070_0000098 3300049586 Bacteria 75579
273 Ga0501070_0001718 3300049586 Bacteria 19376
274 Ga0501070_0003134 3300049586 Bacteria 14398
275 Ga0501070_0024230 3300049586 Bacteria 5089
276 Ga0501071_0027455 3300049587 Bacteria 4005
277 Ga0501072_0006748 3300049588 Bacteria 8719
278 Ga0501072_0151003 3300049588 Bacteria 1852
279 Ga0501072_0187237 3300049588 Bacteria 1651
280 Ga0501073_0001325 3300049589 Bacteria 18227
281 Ga0501074_0000608 3300049590 Bacteria 22237
282 Ga0501074_0002170 3300049590 Bacteria 13599
283 Ga0501076_0000984 3300049592 Bacteria 18631
284 Ga0501076_0005274 3300049592 Bacteria 9264
285 Ga0501077_0001005 3300049593 Bacteria 17012
286 Ga0501079_0000901 3300049741 Bacteria 20360
287 Ga0501079_0005409 3300049741 Bacteria 9510
288 Ga0501079_0021276 3300049741 Bacteria 4961
289 Ga0501080_0003872 3300049742 Bacteria 13239
290 Ga0501080_0023742 3300049742 Bacteria 5682
291 Ga0501081_0000387 3300049743 Bacteria 24281
292 Ga0501081_0035491 3300049743 Bacteria 3394
293 Ga0501083_0000495 3300049744 Bacteria 25187
294 Ga0501083_0028230 3300049744 Bacteria 3870
295 Ga0501035_0005181 3300049822 Bacteria 12332
296 Ga0501035_0082816 3300049822 Bacteria 2831
297 Ga0501044_0007396 3300049823 Bacteria 12079
298 Ga0501045_0000201 3300049824 Bacteria 33911
299 Ga0501045_0009117 3300049824 Bacteria 6930
300 nmdc:mga00v17_33771_c1 3300050491 Bacteria 3034
301 nmdc:mga00v17_39890_c1 3300050491 Bacteria 2814
302 nmdc:mga00v17_43942_c1 3300050491 Bacteria 2692
303 nmdc:mga0yw44_86377_c1 3300050492 Bacteria 1976
304 nmdc:mga05p37_17532_c2 3300050507 Bacteria 5177
305 nmdc:mga05p37_4336_c1 3300050507 Bacteria 16567
306 nmdc:mga09592_9942_c1 3300050508 Bacteria 7740
307 nmdc:mga06r32_3863_c1 3300050510 Bacteria 13409
308 nmdc:mga08y16_5916_c1 3300050511 Bacteria 12823
309 nmdc:mga0a205_2648_c1 3300050515 Bacteria 15825
310 nmdc:mga0sz30_49439_c1 3300050516 Bacteria 1781
311 Ga0500635_0000038 3300053080 Bacteria 93707
312 Ga0500643_000487 3300053087 Bacteria 28865
313 Ga0500651_0000300 3300053093 Bacteria 28581
314 Ga0500650_0052841 3300053098 Bacteria 1889
315 Ga0500556_0000001 3300053104 Bacteria 1135060
316 Ga0500556_0000140 3300053104 Bacteria 60381
317 Ga0500562_000303 3300053108 Bacteria 12023
318 Ga0500655_004464 3300053133 Bacteria 2522
319 Ga0500559_0000156 3300053136 Bacteria 53941
320 Ga0500559_0000372 3300053136 Bacteria 33038
321 Ga0500559_0002090 3300053136 Bacteria 10658
322 Ga0500559_0006409 3300053136 Bacteria 5317
323 Ga0500568_0000006 3300053139 Bacteria 522235
324 Ga0500568_0000026 3300053139 Bacteria 165582
325 Ga0500568_0000172 3300053139 Bacteria 56463
326 Ga0500568_0012873 3300053139 Bacteria 3832
327 Ga0500573_0000013 3300053140 Bacteria 196637
328 Ga0500573_0002394 3300053140 Bacteria 9351
329 Ga0500577_0002423 3300053142 Bacteria 4769
330 Ga0500590_011687 3300053148 Bacteria 4455
331 Ga0500616_0000156 3300053153 Bacteria 114514
332 Ga0500616_0000523 3300053153 Bacteria 48569
333 Ga0500620_000060 3300053155 Bacteria 20194
334 Ga0501084_0001057 3300054114 Bacteria 21384
335 Ga0501084_0021715 3300054114 Bacteria 5352
336 Ga0590075_001202 3300059424 Bacteria 6547
337 Ga0501082_0030912 3300060353 Bacteria 4616
338 Ga0466962_0019234 3300061719 Bacteria 3280
339 Ga0530510_0000116 3300061734 Bacteria 45075
340 Ga0530510_0002578 3300061734 Bacteria 12452

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049824 Ga0501045_0009117 Ga0501045_0009117_5760_6917 363
2 3300048918 Ga0496115_0135959 Ga0496115_0135959_41_1243 378
3 3300048922 Ga0496119_0035518 Ga0496119_0035518_19_1221 378
4 3300038443 Ga0395901_0309169 Ga0395901_0309169_392_1615 385
5 3300044684 Ga0466966_0164451 Ga0466966_0164451_20_1243 385
6 3300048918 Ga0496115_0071800 Ga0496115_0071800_27_1295 399
7 3300050515 nmdc:mga0a205_2648_c1 nmdc:mga0a205_2648_c1_12018_13328 414
8 3300031911 Ga0307412_10137416 Ga0307412_101374162 417
9 3300002738 JGI25154J39366_1002454 JGI25154J39366_10024542 418
10 3300006051 Ga0075364_10126388 Ga0075364_101263882 418
11 3300025246 Ga0209646_1000014 Ga0209646_1000014478 418
12 3300031901 Ga0307406_10000541 Ga0307406_100005414 418
13 3300048928 Ga0496125_0020834 Ga0496125_0020834_1543_2928 418
14 3300050491 nmdc:mga00v17_43942_c1 nmdc:mga00v17_43942_c1_1237_2622 418
15 3300050516 nmdc:mga0sz30_49439_c1 nmdc:mga0sz30_49439_c1_312_1697 418
16 3300049574 Ga0501038_0005477 Ga0501038_0005477_4148_5533 421
17 3300031911 Ga0307412_10072203 Ga0307412_100722032 424
18 3300005347 Ga0070668_100022791 Ga0070668_1000227912 426
19 3300005719 Ga0068861_100024602 Ga0068861_1000246024 426
20 3300009094 Ga0111539_10068868 Ga0111539_100688683 426
21 3300009553 Ga0105249_10005067 Ga0105249_100050674 426
22 3300013306 Ga0163162_10218555 Ga0163162_102185552 426
23 3300017792 Ga0163161_10061892 Ga0163161_100618922 426
24 3300025933 Ga0207706_10009133 Ga0207706_100091333 426
25 3300025961 Ga0207712_10059472 Ga0207712_100594722 426
26 3300025972 Ga0207668_10077968 Ga0207668_100779682 426
27 3300026118 Ga0207675_100013381 Ga0207675_1000133815 426
28 3300031901 Ga0307406_10004111 Ga0307406_100041118 426
29 3300031903 Ga0307407_10003100 Ga0307407_100031003 426
30 3300031911 Ga0307412_10089037 Ga0307412_100890372 426
31 3300031995 Ga0307409_100080012 Ga0307409_1000800122 426
32 3300032002 Ga0307416_100008846 Ga0307416_1000088465 426
33 3300032126 Ga0307415_100006787 Ga0307415_1000067873 426
34 3300038443 Ga0395901_0036962 Ga0395901_0036962_1313_2659 426
35 3300042008 Ga0439450_000036 Ga0439450_000036_1161_2510 426
36 3300042437 Ga0439444_0000340 Ga0439444_0000340_2729_4078 426
37 3300042530 Ga0450916_000455 Ga0450916_000455_911_2260 426
38 3300046523 Ga0495644_0016521 Ga0495644_0016521_1325_2671 426
39 3300046538 Ga0495609_0052098 Ga0495609_0052098_388_1734 426
40 3300046615 Ga0495656_0003282 Ga0495656_0003282_2391_3737 426
41 3300046664 Ga0495659_0019230 Ga0495659_0019230_920_2266 426
42 3300046665 Ga0495661_0093857 Ga0495661_0093857_328_1674 426
43 3300046692 Ga0495671_0075960 Ga0495671_0075960_246_1592 426
44 3300047445 Ga0495677_0026611 Ga0495677_0026611_704_2050 426
45 3300049568 Ga0501031_0124278 Ga0501031_0124278_48_1394 426
46 3300049572 Ga0501036_0001354 Ga0501036_0001354_4478_5824 426
47 3300049574 Ga0501038_0043374 Ga0501038_0043374_2270_3616 426
48 3300049577 Ga0501041_0000506 Ga0501041_0000506_32_1378 426
49 3300049579 Ga0501043_0005043 Ga0501043_0005043_1453_2799 426
50 3300049582 Ga0501048_0002335 Ga0501048_0002335_7507_8853 426
51 3300049582 Ga0501048_0003348 Ga0501048_0003348_9219_10565 426
52 3300049584 Ga0501068_0081290 Ga0501068_0081290_602_1948 426
53 3300049588 Ga0501072_0006748 Ga0501072_0006748_130_1476 426
54 3300049590 Ga0501074_0000608 Ga0501074_0000608_16606_17952 426
55 3300049592 Ga0501076_0000984 Ga0501076_0000984_4154_5500 426
56 3300049592 Ga0501076_0005274 Ga0501076_0005274_4304_5650 426
57 3300049593 Ga0501077_0001005 Ga0501077_0001005_13198_14544 426
58 3300049741 Ga0501079_0000901 Ga0501079_0000901_4998_6344 426
59 3300049741 Ga0501079_0005409 Ga0501079_0005409_3762_5108 426
60 3300049742 Ga0501080_0023742 Ga0501080_0023742_230_1576 426
61 3300049743 Ga0501081_0000387 Ga0501081_0000387_14806_16152 426
62 3300049743 Ga0501081_0035491 Ga0501081_0035491_1763_3109 426
63 3300049822 Ga0501035_0082816 Ga0501035_0082816_1229_2575 426
64 3300049824 Ga0501045_0000201 Ga0501045_0000201_9285_10631 426
65 3300050507 nmdc:mga05p37_17532_c2 nmdc:mga05p37_17532_c2_1773_3119 426
66 3300054114 Ga0501084_0001057 Ga0501084_0001057_15793_17139 426
67 3300060353 Ga0501082_0030912 Ga0501082_0030912_3160_4506 426
68 3300061734 Ga0530510_0000116 Ga0530510_0000116_3178_4524 426
69 3300061734 Ga0530510_0002578 Ga0530510_0002578_3489_4835 426
70 3300049574 Ga0501038_0004443 Ga0501038_0004443_3479_4828 427
71 3300049578 Ga0501042_0052649 Ga0501042_0052649_124_1473 427
72 3300049580 Ga0501046_0189329 Ga0501046_0189329_37_1386 427
73 3300049588 Ga0501072_0187237 Ga0501072_0187237_178_1527 427
74 3300003203 JGI25406J46586_10020397 JGI25406J46586_100203972 431
75 3300003373 JGI25407J50210_10000807 JGI25407J50210_100008072 431
76 3300005937 Ga0081455_10028260 Ga0081455_100282604 431
77 3300005981 Ga0081538_10000522 Ga0081538_1000052229 431
78 3300005981 Ga0081538_10007704 Ga0081538_100077046 431
79 3300005981 Ga0081538_10007868 Ga0081538_100078684 431
80 3300005981 Ga0081538_10008017 Ga0081538_100080175 431
81 3300005985 Ga0081539_10019374 Ga0081539_100193742 431
82 3300006058 Ga0075432_10006490 Ga0075432_100064903 431
83 3300006194 Ga0075427_10000733 Ga0075427_100007332 431
84 3300006846 Ga0075430_100003482 Ga0075430_1000034825 431
85 3300006847 Ga0075431_100029335 Ga0075431_1000293352 431
86 3300006852 Ga0075433_10100452 Ga0075433_101004522 431
87 3300006880 Ga0075429_100029277 Ga0075429_1000292775 431
88 3300027907 Ga0207428_10007161 Ga0207428_100071612 431
89 3300031731 Ga0307405_10109082 Ga0307405_101090822 431
90 3300031852 Ga0307410_10006276 Ga0307410_100062762 431
91 3300031852 Ga0307410_10007489 Ga0307410_100074893 431
92 3300031901 Ga0307406_10004408 Ga0307406_100044086 431
93 3300032002 Ga0307416_100012622 Ga0307416_1000126224 431
94 3300032126 Ga0307415_100002964 Ga0307415_1000029647 431
95 3300032126 Ga0307415_100006120 Ga0307415_1000061204 431
96 3300032126 Ga0307415_100076931 Ga0307415_1000769312 431
97 3300050507 nmdc:mga05p37_4336_c1 nmdc:mga05p37_4336_c1_11239_12600 431
98 3300050508 nmdc:mga09592_9942_c1 nmdc:mga09592_9942_c1_5942_7303 431
99 3300050510 nmdc:mga06r32_3863_c1 nmdc:mga06r32_3863_c1_3722_5083 431
100 3300050511 nmdc:mga08y16_5916_c1 nmdc:mga08y16_5916_c1_8327_9688 431
101 3300059424 Ga0590075_001202 Ga0590075_001202_1163_2524 431
102 3300005471 Ga0070698_100025796 Ga0070698_1000257965 432
103 3300005937 Ga0081455_10060708 Ga0081455_100607082 432
104 3300049576 Ga0501040_0019707 Ga0501040_0019707_1626_2990 432
105 3300049587 Ga0501071_0027455 Ga0501071_0027455_1507_2871 432
106 3300049590 Ga0501074_0002170 Ga0501074_0002170_6591_7955 432
107 3300049741 Ga0501079_0021276 Ga0501079_0021276_811_2175 432
108 iso_pu_bacteria 2857710386 2857711558 432
109 iso_pu_bacteria 2852677369 2852679137 433
110 iso_pu_bacteria 2857479173 2857480310 433
111 iso_pu_bacteria 2857632687 2857634294 433
112 iso_pu_bacteria 2870801768 2870803106 433
113 iso_pu_bacteria 2870804320 2870805163 433
114 iso_pu_bacteria 2893684298 2893684981 433
115 iso_pu_bacteria 2728369276 2729905885 434
116 iso_pu_bacteria 2739367653 2739604180 434
117 iso_pu_bacteria 2816332305 2817509568 434
118 iso_pu_bacteria 2852643534 2852645672 434
119 iso_pu_bacteria 2857727296 2857729124 434
120 iso_pu_bacteria 2919051321 2919053314 434
121 iso_pu_bacteria 2920879853 2920883633 434
122 iso_pu_bacteria 2974294766 2974295837 434
123 iso_pu_bacteria 2974324384 2974327899 434
124 iso_pu_bacteria 2554235227 2555229786 435
125 iso_pu_bacteria 2585428157 2588107312 435
126 iso_pu_bacteria 2643221542 2643732931 435
127 iso_pu_bacteria 2643221546 2643751641 435
128 iso_pu_bacteria 2643221553 2643784744 435
129 iso_pu_bacteria 2643221566 2643847143 435
130 iso_pu_bacteria 2643221575 2643887932 435
131 iso_pu_bacteria 2643221597 2643997088 435
132 iso_pu_bacteria 2643221616 2644097215 435
133 iso_pu_bacteria 2643221630 2644171721 435
134 iso_pu_bacteria 2643221635 2644199115 435
135 iso_pu_bacteria 2643221724 2644681518 435
136 iso_pu_bacteria 2654587600 2655031827 435
137 iso_pu_bacteria 2721755702 2723640170 435
138 iso_pu_bacteria 2728369380 2730231078 435
139 iso_pu_bacteria 2747842429 2747953261 435
140 iso_pu_bacteria 2751185788 2753301728 435
141 iso_pu_bacteria 2757320536 2758225559 435
142 iso_pu_bacteria 2773857758 2774379666 435
143 iso_pu_bacteria 2773857759 2774382113 435
144 iso_pu_bacteria 2773857763 2774397765 435
145 iso_pu_bacteria 2808606306 2808629234 435
146 iso_pu_bacteria 2808606368 2808884036 435
147 iso_pu_bacteria 2808606447 2809226159 435
148 iso_pu_bacteria 2811994872 2812324907 435
149 iso_pu_bacteria 2821268502 2821271458 435
150 iso_pu_bacteria 2833709550 2833712668 435
151 iso_pu_bacteria 2844841374 2844844452 435
152 iso_pu_bacteria 2852632344 2852632416 435
153 iso_pu_bacteria 2852646457 2852647961 435
154 iso_pu_bacteria 2852663356 2852663685 435
155 iso_pu_bacteria 2857720070 2857721315 435
156 iso_pu_bacteria 2857723135 2857726416 435
157 iso_pu_bacteria 2857729791 2857731070 435
158 iso_pu_bacteria 2857733635 2857735868 435
159 iso_pu_bacteria 2857737099 2857739684 435
160 iso_pu_bacteria 2862993130 2862995849 435
161 iso_pu_bacteria 2870622029 2870623776 435
162 iso_pu_bacteria 2870628048 2870629118 435
163 iso_pu_bacteria 2884763398 2884763589 435
164 iso_pu_bacteria 2904430863 2904433123 435
165 iso_pu_bacteria 2904501621 2904502756 435
166 iso_pu_bacteria 2904509784 2904512458 435
167 iso_pu_bacteria 2905926851 2905927546 435
168 iso_pu_bacteria 2905926851 2905929005 435
169 iso_pu_bacteria 2906799679 2906802358 435
170 iso_pu_bacteria 2908674828 2908677561 435
171 iso_pu_bacteria 2908678064 2908679302 435
172 iso_pu_bacteria 2909074476 2909075129 435
173 iso_pu_bacteria 2919039151 2919040543 435
174 iso_pu_bacteria 2919042368 2919043671 435
175 iso_pu_bacteria 2919055335 2919056409 435
176 iso_pu_bacteria 2919069694 2919069949 435
177 iso_pu_bacteria 2919395869 2919397376 435
178 iso_pu_bacteria 2919523602 2919526402 435
179 iso_pu_bacteria 2928090899 2928093052 435
180 iso_pu_bacteria 2928104781 2928106555 435
181 iso_pu_bacteria 2928121344 2928122370 435
182 iso_pu_bacteria 2928153084 2928155212 435
183 iso_pu_bacteria 2928500415 2928501629 435
184 iso_pu_bacteria 2939657138 2939658267 435
185 iso_pu_bacteria 2945968032 2945969208 435
186 iso_pu_bacteria 2946024296 2946025131 435
187 iso_pu_bacteria 2946041624 2946041664 435
188 iso_pu_bacteria 2946080515 2946083634 435
189 iso_pu_bacteria 2966921586 2966923004 435
190 iso_pu_bacteria 2977236895 2977238446 435
191 iso_pu_bacteria 2977264416 2977264714 435
192 iso_pu_bacteria 2984542743 2984543774 435
193 iso_pu_bacteria 2984551494 2984553891 435
194 iso_pu_bacteria 2984580707 2984583348 435
195 iso_pu_bacteria 8004021418 8004024036 435
196 iso_pu_bacteria 8004025490 8004029215 435
197 iso_pu_bacteria 8004182704 8004184076 435
198 iso_pu_bacteria 8004212874 8004215170 435
199 iso_pu_bacteria 8016254467 8016256061 435
200 3300048929 Ga0496126_0069136 Ga0496126_0069136_309_1736 436
201 iso_pu_bacteria 3001119090 3001119155 436
202 3300031649 Ga0307514_10033590 Ga0307514_100335901 437
203 3300053153 Ga0500616_0000523 Ga0500616_0000523_4466_5845 437
204 iso_pu_bacteria 2848551377 2848552571 437
205 3300031852 Ga0307410_10082538 Ga0307410_100825382 438
206 3300048923 Ga0496120_0095036 Ga0496120_0095036_56_1441 438
207 3300048929 Ga0496126_0014990 Ga0496126_0014990_2139_3521 438
208 3300048929 Ga0496126_0044700 Ga0496126_0044700_68_1450 438
209 3300049569 Ga0501032_0073041 Ga0501032_0073041_96_1478 438
210 3300049586 Ga0501070_0024230 Ga0501070_0024230_2163_3545 438
211 3300049589 Ga0501073_0001325 Ga0501073_0001325_4860_6242 438
212 3300049742 Ga0501080_0003872 Ga0501080_0003872_6437_7819 438
213 3300053104 Ga0500556_0000140 Ga0500556_0000140_7571_8953 438
214 3300053108 Ga0500562_000303 Ga0500562_000303_9023_10405 438
215 3300053133 Ga0500655_004464 Ga0500655_004464_261_1643 438
216 3300053136 Ga0500559_0000156 Ga0500559_0000156_25426_26808 438
217 3300001989 JGI24739J22299_10007264 JGI24739J22299_100072643 439
218 3300002772 JGI25164J39214_1000769 JGI25164J39214_100076913 439
219 3300003214 JGI25165J46597_1000005 JGI25165J46597_1000005606 439
220 3300003578 Ga0006562J51391_1010836 Ga0006562J51391_10108366 439
221 3300003578 Ga0006562J51391_1018456 Ga0006562J51391_101845612 439
222 3300003756 Ga0055533_1000002 Ga0055533_1000002673 439
223 3300003759 Ga0055525_1000142 Ga0055525_100014245 439
224 3300003760 Ga0055527_1000004 Ga0055527_1000004203 439
225 3300003762 Ga0055542_1000307 Ga0055542_100030743 439
226 3300003763 Ga0055529_1000008 Ga0055529_1000008374 439
227 3300005327 Ga0070658_10046640 Ga0070658_100466402 439
228 3300005327 Ga0070658_10046819 Ga0070658_100468194 439
229 3300005344 Ga0070661_100035007 Ga0070661_1000350072 439
230 3300005466 Ga0070685_10010635 Ga0070685_100106352 439
231 3300005539 Ga0068853_100046635 Ga0068853_1000466352 439
232 3300005614 Ga0068856_100071645 Ga0068856_1000716453 439
233 3300005614 Ga0068856_100114260 Ga0068856_1001142602 439
234 3300005616 Ga0068852_100024812 Ga0068852_1000248123 439
235 3300005834 Ga0068851_10000003 Ga0068851_1000000378 439
236 3300006038 Ga0075365_10010379 Ga0075365_100103792 439
237 3300006048 Ga0075363_100100412 Ga0075363_1001004121 439
238 3300006186 Ga0075369_10009837 Ga0075369_100098372 439
239 3300009036 Ga0105244_10086575 Ga0105244_100865751 439
240 3300009093 Ga0105240_10006064 Ga0105240_1000606411 439
241 3300009093 Ga0105240_10060054 Ga0105240_100600542 439
242 3300009174 Ga0105241_10001064 Ga0105241_1000106415 439
243 3300009174 Ga0105241_10090732 Ga0105241_100907322 439
244 3300009177 Ga0105248_10003592 Ga0105248_1000359211 439
245 3300009545 Ga0105237_10000131 Ga0105237_1000013178 439
246 3300009551 Ga0105238_10031598 Ga0105238_100315983 439
247 3300013105 Ga0157369_10072999 Ga0157369_100729993 439
248 3300013105 Ga0157369_10379899 Ga0157369_103798991 439
249 3300013250 Ga0171462_1002 Ga0171462_1002374 439
250 3300013308 Ga0157375_10134435 Ga0157375_101344353 439
251 3300020069 Ga0197907_10480862 Ga0197907_104808621 439
252 3300025225 Ga0209566_100013 Ga0209566_100013115 439
253 3300025226 Ga0209674_100001 Ga0209674_1000012890 439
254 3300025228 Ga0209672_100011 Ga0209672_100011205 439
255 3300025229 Ga0209147_101041 Ga0209147_1010419 439
256 3300025230 Ga0209563_100001 Ga0209563_1000012890 439
257 3300025230 Ga0209563_100165 Ga0209563_10016535 439
258 3300025231 Ga0207427_100325 Ga0207427_1003251 439
259 3300025233 Ga0209437_101278 Ga0209437_1012787 439
260 3300025242 Ga0209258_101076 Ga0209258_1010768 439
261 3300025253 Ga0209677_100001 Ga0209677_1000012890 439
262 3300025253 Ga0209677_101085 Ga0209677_1010855 439
263 3300025254 Ga0209148_1000023 Ga0209148_100002343 439
264 3300025261 Ga0209233_1000001 Ga0209233_100000143 439
265 3300025272 Ga0209455_1000023 Ga0209455_100002343 439
266 3300025321 Ga0207656_10000002 Ga0207656_10000002159 439
267 3300025728 Ga0207655_1002720 Ga0207655_100272012 439
268 3300025911 Ga0207654_10000001 Ga0207654_100000011696 439
269 3300025913 Ga0207695_10006059 Ga0207695_1000605912 439
270 3300025913 Ga0207695_10013887 Ga0207695_100138873 439
271 3300025914 Ga0207671_10000002 Ga0207671_10000002453 439
272 3300025924 Ga0207694_10000092 Ga0207694_1000009257 439
273 3300025932 Ga0207690_10001146 Ga0207690_1000114610 439
274 3300025941 Ga0207711_10004780 Ga0207711_100047809 439
275 3300025949 Ga0207667_10006393 Ga0207667_100063936 439
276 3300025949 Ga0207667_10240240 Ga0207667_102402402 439
277 3300025986 Ga0207658_10009467 Ga0207658_100094675 439
278 3300026035 Ga0207703_10000031 Ga0207703_1000003134 439
279 3300026041 Ga0207639_10107199 Ga0207639_101071992 439
280 3300026078 Ga0207702_10264739 Ga0207702_102647391 439
281 3300026116 Ga0207674_10004399 Ga0207674_100043993 439
282 3300026142 Ga0207698_10000277 Ga0207698_100002778 439
283 3300026142 Ga0207698_10135901 Ga0207698_101359012 439
284 3300031901 Ga0307406_10000040 Ga0307406_1000004036 439
285 3300031911 Ga0307412_10007073 Ga0307412_100070737 439
286 3300032002 Ga0307416_100008967 Ga0307416_1000089672 439
287 3300037312 Ga0395899_0002887 Ga0395899_0002887_6819_8207 439
288 3300037418 Ga0395900_0001268 Ga0395900_0001268_14297_15685 439
289 3300037466 Ga0395898_0000270 Ga0395898_0000270_50206_51594 439
290 3300037466 Ga0395898_0002175 Ga0395898_0002175_21642_23027 439
291 3300037466 Ga0395898_0145080 Ga0395898_0145080_171_1559 439
292 3300037471 Ga0395905_0132496 Ga0395905_0132496_144_1529 439
293 3300038443 Ga0395901_0076757 Ga0395901_0076757_1809_3197 439
294 3300038443 Ga0395901_0121716 Ga0395901_0121716_588_1973 439
295 3300041411 Ga0439466_0011593 Ga0439466_0011593_894_2279 439
296 3300042002 Ga0439442_000440 Ga0439442_000440_1584_2969 439
297 3300042002 Ga0439442_002606 Ga0439442_002606_688_2073 439
298 3300042007 Ga0439449_0001421 Ga0439449_0001421_5019_6404 439
299 3300044658 Ga0466972_0006508 Ga0466972_0006508_2910_4298 439
300 3300044683 Ga0466965_0000007 Ga0466965_0000007_70145_71530 439
301 3300044684 Ga0466966_0010378 Ga0466966_0010378_1690_3078 439
302 3300044684 Ga0466966_0019666 Ga0466966_0019666_142_1530 439
303 3300044693 Ga0466961_0057634 Ga0466961_0057634_463_1851 439
304 3300044719 Ga0466971_0013331 Ga0466971_0013331_1803_3191 439
305 3300046457 Ga0495590_0000329 Ga0495590_0000329_10068_11453 439
306 3300048907 Ga0496104_0089339 Ga0496104_0089339_1312_2697 439
307 3300048908 Ga0496105_0017470 Ga0496105_0017470_534_1919 439
308 3300048910 Ga0496107_0047279 Ga0496107_0047279_545_1933 439
309 3300048917 Ga0496114_0038195 Ga0496114_0038195_1938_3323 439
310 3300048917 Ga0496114_0216085 Ga0496114_0216085_105_1493 439
311 3300048920 Ga0496117_0000014 Ga0496117_0000014_451979_453367 439
312 3300048920 Ga0496117_0000808 Ga0496117_0000808_41988_43373 439
313 3300048920 Ga0496117_0001925 Ga0496117_0001925_12541_13926 439
314 3300048920 Ga0496117_0006325 Ga0496117_0006325_6218_7606 439
315 3300048920 Ga0496117_0006847 Ga0496117_0006847_4116_5501 439
316 3300048920 Ga0496117_0014300 Ga0496117_0014300_5392_6777 439
317 3300048921 Ga0496118_0000601 Ga0496118_0000601_56125_57510 439
318 3300048921 Ga0496118_0014034 Ga0496118_0014034_1132_2520 439
319 3300048921 Ga0496118_0038477 Ga0496118_0038477_494_1879 439
320 3300048922 Ga0496119_0001243 Ga0496119_0001243_16451_17839 439
321 3300048922 Ga0496119_0002674 Ga0496119_0002674_14782_16167 439
322 3300048922 Ga0496119_0006163 Ga0496119_0006163_2424_3812 439
323 3300048922 Ga0496119_0007487 Ga0496119_0007487_3913_5301 439
324 3300048922 Ga0496119_0013750 Ga0496119_0013750_1649_3034 439
325 3300048922 Ga0496119_0023820 Ga0496119_0023820_1749_3134 439
326 3300048922 Ga0496119_0029470 Ga0496119_0029470_50_1435 439
327 3300048922 Ga0496119_0063512 Ga0496119_0063512_30_1415 439
328 3300048923 Ga0496120_0000655 Ga0496120_0000655_37787_39172 439
329 3300048923 Ga0496120_0001359 Ga0496120_0001359_12114_13502 439
330 3300048923 Ga0496120_0003745 Ga0496120_0003745_8959_10347 439
331 3300048924 Ga0496121_0000277 Ga0496121_0000277_27796_29184 439
332 3300048924 Ga0496121_0053372 Ga0496121_0053372_987_2375 439
333 3300048924 Ga0496121_0175996 Ga0496121_0175996_31_1416 439
334 3300048925 Ga0496122_0000475 Ga0496122_0000475_37389_38774 439
335 3300048925 Ga0496122_0003643 Ga0496122_0003643_66_1451 439
336 3300048925 Ga0496122_0004671 Ga0496122_0004671_5247_6635 439
337 3300048925 Ga0496122_0015130 Ga0496122_0015130_4361_5746 439
338 3300048925 Ga0496122_0058642 Ga0496122_0058642_729_2114 439
339 3300048926 Ga0496123_0000011 Ga0496123_0000011_455150_456535 439
340 3300048926 Ga0496123_0001137 Ga0496123_0001137_6111_7496 439
341 3300048926 Ga0496123_0053449 Ga0496123_0053449_956_2341 439
342 3300048927 Ga0496124_0000899 Ga0496124_0000899_9298_10683 439
343 3300048927 Ga0496124_0011327 Ga0496124_0011327_6429_7814 439
344 3300048927 Ga0496124_0015407 Ga0496124_0015407_629_2017 439
345 3300048927 Ga0496124_0087223 Ga0496124_0087223_230_1615 439
346 3300048928 Ga0496125_0000444 Ga0496125_0000444_72872_74260 439
347 3300048928 Ga0496125_0009474 Ga0496125_0009474_304_1689 439
348 3300048928 Ga0496125_0030397 Ga0496125_0030397_2456_3844 439
349 3300048928 Ga0496125_0048354 Ga0496125_0048354_1183_2568 439
350 3300048929 Ga0496126_0000912 Ga0496126_0000912_44543_45928 439
351 3300048929 Ga0496126_0007451 Ga0496126_0007451_8192_9580 439
352 3300048929 Ga0496126_0008290 Ga0496126_0008290_7013_8401 439
353 3300048929 Ga0496126_0053916 Ga0496126_0053916_686_2074 439
354 3300049570 Ga0501033_0015202 Ga0501033_0015202_2180_3565 439
355 3300049570 Ga0501033_0025171 Ga0501033_0025171_2770_4158 439
356 3300049571 Ga0501034_0001656 Ga0501034_0001656_4958_6343 439
357 3300049571 Ga0501034_0051673 Ga0501034_0051673_2047_3432 439
358 3300049571 Ga0501034_0051679 Ga0501034_0051679_1663_3048 439
359 3300049571 Ga0501034_0113297 Ga0501034_0113297_1235_2620 439
360 3300049571 Ga0501034_0122520 Ga0501034_0122520_969_2357 439
361 3300049573 Ga0501037_0006742 Ga0501037_0006742_2686_4074 439
362 3300049574 Ga0501038_0049611 Ga0501038_0049611_1414_2799 439
363 3300049574 Ga0501038_0071265 Ga0501038_0071265_1167_2552 439
364 3300049578 Ga0501042_0034185 Ga0501042_0034185_52_1440 439
365 3300049579 Ga0501043_0002084 Ga0501043_0002084_10594_11979 439
366 3300049581 Ga0501047_0006712 Ga0501047_0006712_7241_8629 439
367 3300049581 Ga0501047_0128913 Ga0501047_0128913_628_2013 439
368 3300049586 Ga0501070_0000098 Ga0501070_0000098_34742_36130 439
369 3300049586 Ga0501070_0001718 Ga0501070_0001718_15810_17195 439
370 3300049586 Ga0501070_0003134 Ga0501070_0003134_1213_2598 439
371 3300049588 Ga0501072_0151003 Ga0501072_0151003_79_1464 439
372 3300049744 Ga0501083_0000495 Ga0501083_0000495_21571_22959 439
373 3300049744 Ga0501083_0028230 Ga0501083_0028230_1946_3334 439
374 3300049822 Ga0501035_0005181 Ga0501035_0005181_5253_6641 439
375 3300049823 Ga0501044_0007396 Ga0501044_0007396_10423_11811 439
376 3300050491 nmdc:mga00v17_39890_c1 nmdc:mga00v17_39890_c1_1184_2569 439
377 3300053080 Ga0500635_0000038 Ga0500635_0000038_41658_43046 439
378 3300053087 Ga0500643_000487 Ga0500643_000487_25538_26923 439
379 3300053093 Ga0500651_0000300 Ga0500651_0000300_11316_12701 439
380 3300053098 Ga0500650_0052841 Ga0500650_0052841_240_1625 439
381 3300053104 Ga0500556_0000001 Ga0500556_0000001_463574_464959 439
382 3300053136 Ga0500559_0000372 Ga0500559_0000372_28340_29725 439
383 3300053136 Ga0500559_0002090 Ga0500559_0002090_907_2292 439
384 3300053136 Ga0500559_0006409 Ga0500559_0006409_209_1594 439
385 3300053139 Ga0500568_0000006 Ga0500568_0000006_230592_231977 439
386 3300053139 Ga0500568_0000026 Ga0500568_0000026_61785_63170 439
387 3300053139 Ga0500568_0000172 Ga0500568_0000172_46132_47517 439
388 3300053139 Ga0500568_0012873 Ga0500568_0012873_46_1431 439
389 3300053140 Ga0500573_0000013 Ga0500573_0000013_8205_9590 439
390 3300053140 Ga0500573_0002394 Ga0500573_0002394_1584_2969 439
391 3300053142 Ga0500577_0002423 Ga0500577_0002423_2094_3479 439
392 3300053148 Ga0500590_011687 Ga0500590_011687_856_2241 439
393 3300053153 Ga0500616_0000156 Ga0500616_0000156_99395_100780 439
394 3300053155 Ga0500620_000060 Ga0500620_000060_16350_17735 439
395 3300054114 Ga0501084_0021715 Ga0501084_0021715_3488_4873 439
396 3300061719 Ga0466962_0019234 Ga0466962_0019234_331_1719 439
397 iso_pu_bacteria 2977228692 2977229506 439
398 3300005327 Ga0070658_10000122 Ga0070658_1000012261 440
399 3300005339 Ga0070660_100115474 Ga0070660_1001154741 440
400 3300005563 Ga0068855_100190954 Ga0068855_1001909542 440
401 3300013102 Ga0157371_10000825 Ga0157371_100008253 440
402 3300013104 Ga0157370_10096766 Ga0157370_100967662 440
403 3300025909 Ga0207705_10000006 Ga0207705_10000006220 440
404 3300025932 Ga0207690_10014454 Ga0207690_100144545 440
405 3300026067 Ga0207678_10031516 Ga0207678_100315161 440
406 3300041491 Ga0451833_0342895 Ga0451833_0342895_3778_5172 440
407 3300041494 Ga0451837_0314787 Ga0451837_0314787_4078_5472 440
408 3300044765 Ga0466970_0010547 Ga0466970_0010547_3067_4464 440
409 3300048907 Ga0496104_0003233 Ga0496104_0003233_10981_12414 445
410 3300050491 nmdc:mga00v17_33771_c1 nmdc:mga00v17_33771_c1_846_2297 448
411 3300013307 Ga0157372_10123812 Ga0157372_101238122 451
412 3300044658 Ga0466972_0036994 Ga0466972_0036994_556_1995 451
413 3300044765 Ga0466970_0024309 Ga0466970_0024309_86_1525 451
414 3300046453 Ga0495627_000312 Ga0495627_000312_45371_46804 451
415 3300048903 Ga0496100_0012480 Ga0496100_0012480_2442_3932 451
416 3300048905 Ga0496102_0060300 Ga0496102_0060300_483_1973 451
417 3300048906 Ga0496103_0010300 Ga0496103_0010300_2965_4455 451
418 3300048912 Ga0496109_0086210 Ga0496109_0086210_293_1783 451
419 3300048913 Ga0496110_0092839 Ga0496110_0092839_601_2091 451
420 3300048914 Ga0496111_0023834 Ga0496111_0023834_2234_3724 451
421 3300048915 Ga0496112_0167003 Ga0496112_0167003_208_1698 451
422 3300048917 Ga0496114_0059432 Ga0496114_0059432_218_1708 451
423 3300048918 Ga0496115_0036408 Ga0496115_0036408_921_2411 451
424 3300048919 Ga0496116_0027774 Ga0496116_0027774_1302_2729 451
425 3300048922 Ga0496119_0002944 Ga0496119_0002944_4239_5666 451
426 3300048923 Ga0496120_0001070 Ga0496120_0001070_26132_27559 451
427 3300048925 Ga0496122_0000358 Ga0496122_0000358_59302_60729 451
428 3300048926 Ga0496123_0000280 Ga0496123_0000280_59355_60782 451
429 3300048928 Ga0496125_0002089 Ga0496125_0002089_16315_17742 451
430 3300048929 Ga0496126_0015932 Ga0496126_0015932_5404_6831 451
431 3300050492 nmdc:mga0yw44_86377_c1 nmdc:mga0yw44_86377_c1_176_1609 451
432 iso_pu_bacteria 8045830549 8045833470 451
433 3300001979 JGI24740J21852_10002591 JGI24740J21852_100025912 452
434 3300009148 Ga0105243_10061474 Ga0105243_100614743 452
435 3300037466 Ga0395898_0014462 Ga0395898_0014462_1292_2791 452
436 3300044765 Ga0466970_0000121 Ga0466970_0000121_10933_12369 452

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03129

HGTP_anticodon

Anticodon binding domain

405

495

0.94

PF00587

tRNA-synt_2b

tRNA synthetase class II core domain (G, H, P, S and T)

185

377

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8sld-assembly1.cif.gz_A-2 crystal structure of glycine trna ligase from mycobacterium thermoresistibile (apo) 0.9239 18 451
8slh-assembly1.cif.gz_A-2 crystal structure of glycine trna ligase from mycobacterium thermoresistibile (amp bound, hexagonal form) 0.8998 18 451
8u2q-assembly1.cif.gz_A crystal structure of glycine--trna ligase active site chimera from mycobacterium thermoresistibile/tuberculosis (g5a bound) 0.8971 18 451
8slf-assembly1.cif.gz_A crystal structure of glycine trna ligase from mycobacterium thermoresistibile (amp bound) 0.8938 18 451
8u2p-assembly1.cif.gz_A-2 crystal structure of glycine--trna ligase from mycobacterium tuberculosis (g5a bound) 0.8909 18 451
ID Description Score Start End Superfamily
af_Q57681_481_577_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9485 379 451 3.40.50.800
af_Q2FY08_370_463_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9348 380 451 3.40.50.800
af_Q54PF9_562_677_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9152 379 451 3.40.50.800
af_Q58406_325_416_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9144 379 449 3.40.50.800
af_Q9VUK8_646_762_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9142 379 451 3.40.50.800
ID Description Score Start End GO Terms
AF-A0A3D0RVW4-F1-model_v4 Glycine--tRNA ligase 0.9809 225 339 GO:0004820
GO:0005737
GO:0006426
AF-A0A2V7KIP6-F1-model_v4 Glycine--tRNA ligase 0.9699 374 450 GO:0004820
GO:0005737
GO:0006426
AF-A0A2W4ZJP8-F1-model_v4 Glycine--tRNA ligase 0.9649 380 449 GO:0004820
GO:0005737
GO:0006426
AF-A0A3D0RVW4-F1-model_v4 Glycine--tRNA ligase 0.9644 225 339 GO:0004820
GO:0005737
GO:0006426
AF-A0A7J4MMH8-F1-model_v4 Anticodon-binding domain-containing protein 0.9616 376 450 GO:0004820
GO:0005737
GO:0006426

Feature Viewer

pLDDT pTM Quality
81.75 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map