F443526

General Info

Members Datasets Scaffolds Average Seq Length
436 179 872 155

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10164300|Ga0105240_101643002
Length 192
Sequence LSAAQRKYFGIEKYLSIRVGAVRRKIECKLTQNQKGKVMASKPTHEQAQLHLQVYDLRRETRLRQARDWFQQNYHPETLEEAMRLAAPGTEHGTFLGMVIGYWEQACTLLNYGLLHEDLFFETSGEFFGVWEQLKPVVPQFRETFHDPNLLANLEQAAKRLEEWSEKRTPGKIAAVRQYMQQERAKAKGAGA

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
160 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
161 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 1.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.38
Rhizosphere 97.94
Stem 0
Stem Tuber 0
Unclassified 27.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10164300 3300009093 Bacteria 2634
2 JGI24742J22300_10050698 3300002244 Bacteria 751
3 JGI25406J46586_10039717 3300003203 Unclassified 1674
4 JGI25406J46586_10042302 3300003203 Unclassified 1596
5 JGI25406J46586_10075199 3300003203 Bacteria 1048
6 rootL2_10314765 3300003322 Bacteria 2447
7 Ga0058859_11193740 3300004798 Bacteria 567
8 Ga0058861_11178560 3300004800 Bacteria 712
9 Ga0058860_12040440 3300004801 Bacteria 826
10 Ga0058862_12447181 3300004803 Bacteria 615
11 Ga0065714_10002198 3300005288 Bacteria 90565
12 Ga0065704_10105602 3300005289 Bacteria 2106
13 Ga0065704_10293659 3300005289 Unclassified 898
14 Ga0065712_10000119 3300005290 Bacteria 137052
15 Ga0065712_10005904 3300005290 Unclassified 3883
16 Ga0065712_10079128 3300005290 Unclassified 3256
17 Ga0065712_10105027 3300005290 Bacteria 1935
18 Ga0065715_10149519 3300005293 Bacteria 1740
19 Ga0065715_10237432 3300005293 Bacteria 1211
20 Ga0065715_10248389 3300005293 Unclassified 1168
21 Ga0065715_10518022 3300005293 Unclassified 766
22 Ga0065707_10003897 3300005295 Bacteria 3794
23 Ga0065707_10025943 3300005295 Bacteria 1222
24 Ga0065707_10109025 3300005295 Bacteria 2476
25 Ga0065707_10241924 3300005295 Bacteria 1153
26 Ga0070676_10453738 3300005328 Unclassified 902
27 Ga0070690_100087689 3300005330 Bacteria 2044
28 Ga0070690_100232637 3300005330 Bacteria 1296
29 Ga0068869_100012610 3300005334 Bacteria 5590
30 Ga0068869_100091520 3300005334 Bacteria 2288
31 Ga0068869_100200482 3300005334 Bacteria 1573
32 Ga0068869_100387402 3300005334 Unclassified 1147
33 Ga0068869_100807612 3300005334 Bacteria 807
34 Ga0070666_10026839 3300005335 Unclassified 3767
35 Ga0070666_10344378 3300005335 Bacteria 1066
36 Ga0070680_100039962 3300005336 Bacteria 3795
37 Ga0070682_100031908 3300005337 Bacteria 3190
38 Ga0068868_101199945 3300005338 Bacteria 701
39 Ga0070689_100051557 3300005340 Bacteria 3181
40 Ga0070689_100466140 3300005340 Unclassified 1077
41 Ga0070689_101566481 3300005340 Unclassified 598
42 Ga0070687_100085601 3300005343 Bacteria 1730
43 Ga0070687_100257077 3300005343 Bacteria 1088
44 Ga0070692_10017429 3300005345 Unclassified 3434
45 Ga0070692_10182154 3300005345 Bacteria 1218
46 Ga0070692_10219510 3300005345 Bacteria 1123
47 Ga0070668_100622451 3300005347 Bacteria 946
48 Ga0070669_100308150 3300005353 Bacteria 1275
49 Ga0070669_100553133 3300005353 Unclassified 960
50 Ga0070675_100767105 3300005354 Bacteria 880
51 Ga0070671_100000822 3300005355 Bacteria 22486
52 Ga0070671_100016509 3300005355 Bacteria 5969
53 Ga0070674_100219281 3300005356 Bacteria 1479
54 Ga0070673_100130096 3300005364 Bacteria 2110
55 Ga0070673_100464853 3300005364 Bacteria 1140
56 Ga0070673_100638677 3300005364 Bacteria 973
57 Ga0070673_100679065 3300005364 Unclassified 944
58 Ga0070688_100294552 3300005365 Bacteria 1171
59 Ga0070688_101186350 3300005365 Unclassified 613
60 Ga0070667_100401547 3300005367 Bacteria 1248
61 Ga0070701_10417081 3300005438 Bacteria 854
62 Ga0070705_100024545 3300005440 Bacteria 3256
63 Ga0070705_100093172 3300005440 Bacteria 1882
64 Ga0070705_100293953 3300005440 Bacteria 1161
65 Ga0070705_100355461 3300005440 Bacteria 1070
66 Ga0070705_101275097 3300005440 Bacteria 608
67 Ga0070700_100041022 3300005441 Bacteria 2836
68 Ga0070694_100003877 3300005444 Bacteria 8938
69 Ga0070694_100048257 3300005444 Unclassified 2864
70 Ga0070694_100064246 3300005444 Unclassified 2512
71 Ga0070694_100167665 3300005444 Bacteria 1616
72 Ga0070694_100179766 3300005444 Unclassified 1564
73 Ga0070694_100600948 3300005444 Bacteria 886
74 Ga0070694_100844238 3300005444 Unclassified 753
75 Ga0070708_100023240 3300005445 Bacteria 5269
76 Ga0070708_100116722 3300005445 Bacteria 2458
77 Ga0070708_100349011 3300005445 Bacteria 1394
78 Ga0070708_100424840 3300005445 Bacteria 1253
79 Ga0070708_100558670 3300005445 Bacteria 1079
80 Ga0070678_100128448 3300005456 Bacteria 2010
81 Ga0070678_100349112 3300005456 Bacteria 1271
82 Ga0070662_100054740 3300005457 Bacteria 2892
83 Ga0070662_100195465 3300005457 Bacteria 1602
84 Ga0070681_10021774 3300005458 Bacteria 6429
85 Ga0068867_100070588 3300005459 Bacteria 2612
86 Ga0068867_100723696 3300005459 Unclassified 880
87 Ga0068867_100741698 3300005459 Bacteria 870
88 Ga0070685_10458260 3300005466 Bacteria 894
89 Ga0070706_100000050 3300005467 Bacteria 140240
90 Ga0070706_100116963 3300005467 Bacteria 2483
91 Ga0070706_100335677 3300005467 Bacteria 1409
92 Ga0070706_100736565 3300005467 Unclassified 913
93 Ga0070706_100846559 3300005467 Bacteria 846
94 Ga0070707_100020223 3300005468 Bacteria 6277
95 Ga0070707_100233145 3300005468 Bacteria 1791
96 Ga0070707_100287410 3300005468 Bacteria 1598
97 Ga0070707_101239271 3300005468 Unclassified 712
98 Ga0070698_100014008 3300005471 Bacteria 8481
99 Ga0070698_100020225 3300005471 Bacteria 6979
100 Ga0070698_100967917 3300005471 Bacteria 798
101 Ga0070699_100004694 3300005518 Bacteria 12088
102 Ga0070699_100083744 3300005518 Bacteria 2782
103 Ga0070699_100086182 3300005518 Bacteria 2741
104 Ga0070699_100094353 3300005518 Bacteria 2619
105 Ga0070699_100829090 3300005518 Bacteria 847
106 Ga0070699_101213731 3300005518 Unclassified 692
107 Ga0070679_100566033 3300005530 Unclassified 1080
108 Ga0070697_100051558 3300005536 Bacteria 3343
109 Ga0070697_100099919 3300005536 Bacteria 2409
110 Ga0070697_100136471 3300005536 Bacteria 2060
111 Ga0070697_100225152 3300005536 Bacteria 1599
112 Ga0070697_100389934 3300005536 Bacteria 1207
113 Ga0070697_100670492 3300005536 Bacteria 914
114 Ga0068853_100110691 3300005539 Bacteria 2439
115 Ga0070672_100196312 3300005543 Bacteria 1686
116 Ga0070672_100270172 3300005543 Bacteria 1436
117 Ga0070672_100795839 3300005543 Bacteria 832
118 Ga0070686_100257943 3300005544 Bacteria 1276
119 Ga0070695_100181164 3300005545 Bacteria 1493
120 Ga0070695_100202891 3300005545 Bacteria 1418
121 Ga0070695_100252845 3300005545 Bacteria 1283
122 Ga0070695_100401887 3300005545 Bacteria 1039
123 Ga0070695_100713766 3300005545 Unclassified 797
124 Ga0070695_101290823 3300005545 Unclassified 603
125 Ga0070696_100094012 3300005546 Bacteria 2139
126 Ga0070696_100257708 3300005546 Bacteria 1321
127 Ga0070696_100386254 3300005546 Bacteria 1092
128 Ga0070696_100697616 3300005546 Unclassified 827
129 Ga0070693_100000271 3300005547 Bacteria 24386
130 Ga0070693_100021457 3300005547 Bacteria 3422
131 Ga0070693_100037660 3300005547 Bacteria 2698
132 Ga0070693_100090901 3300005547 Bacteria 1840
133 Ga0070693_100171225 3300005547 Bacteria 1391
134 Ga0070704_100201340 3300005549 Bacteria 1607
135 Ga0070704_100323679 3300005549 Unclassified 1293
136 Ga0070704_100990538 3300005549 Unclassified 760
137 Ga0070704_101045379 3300005549 Unclassified 740
138 Ga0070664_100261879 3300005564 Bacteria 1556
139 Ga0070664_100383324 3300005564 Bacteria 1283
140 Ga0070664_100565171 3300005564 Bacteria 1053
141 Ga0070664_101424216 3300005564 Bacteria 655
142 Ga0068857_100135356 3300005577 Unclassified 2224
143 Ga0068857_100227746 3300005577 Unclassified 1704
144 Ga0068854_100092065 3300005578 Bacteria 2258
145 Ga0068854_100590034 3300005578 Bacteria 947
146 Ga0068854_100612662 3300005578 Bacteria 931
147 Ga0070702_100012880 3300005615 Bacteria 4210
148 Ga0070702_100671283 3300005615 Unclassified 786
149 Ga0070702_100775915 3300005615 Bacteria 739
150 Ga0068852_100093909 3300005616 Bacteria 2690
151 Ga0068859_100019034 3300005617 Bacteria 6895
152 Ga0068859_100022765 3300005617 Bacteria 6283
153 Ga0068859_100064927 3300005617 Bacteria 3684
154 Ga0068859_100066068 3300005617 Unclassified 3651
155 Ga0068859_100208909 3300005617 Unclassified 2038
156 Ga0068859_100318003 3300005617 Bacteria 1650
157 Ga0068859_100567891 3300005617 Bacteria 1228
158 Ga0068859_100574822 3300005617 Bacteria 1221
159 Ga0068859_100701317 3300005617 Bacteria 1103
160 Ga0068859_101028763 3300005617 Unclassified 905
161 Ga0068859_101042877 3300005617 Bacteria 899
162 Ga0068859_101835381 3300005617 Unclassified 669
163 Ga0068859_102634226 3300005617 Unclassified 553
164 Ga0068859_102997113 3300005617 Unclassified 516
165 Ga0068864_100001404 3300005618 Bacteria 19927
166 Ga0068864_100026696 3300005618 Bacteria 4870
167 Ga0068864_100334166 3300005618 Bacteria 1426
168 Ga0068864_100335617 3300005618 Unclassified 1423
169 Ga0068864_100698879 3300005618 Unclassified 991
170 Ga0068864_100700394 3300005618 Unclassified 989
171 Ga0068864_100841654 3300005618 Bacteria 903
172 Ga0068864_101478662 3300005618 Bacteria 682
173 Ga0068866_10129546 3300005718 Bacteria 1433
174 Ga0068870_10005743 3300005840 Bacteria 5435
175 Ga0068870_10177139 3300005840 Bacteria 1277
176 Ga0068870_10255722 3300005840 Bacteria 1088
177 Ga0068863_100104342 3300005841 Bacteria 2696
178 Ga0068863_100289247 3300005841 Bacteria 1588
179 Ga0068863_100439128 3300005841 Unclassified 1280
180 Ga0068863_100517116 3300005841 Bacteria 1177
181 Ga0068863_100669015 3300005841 Bacteria 1030
182 Ga0068863_101040432 3300005841 Unclassified 822
183 Ga0068858_100162721 3300005842 Bacteria 2101
184 Ga0068858_100356958 3300005842 Bacteria 1400
185 Ga0068858_100438360 3300005842 Bacteria 1258
186 Ga0068858_100999756 3300005842 Bacteria 820
187 Ga0068860_100143442 3300005843 Bacteria 2296
188 Ga0068860_100362229 3300005843 Unclassified 1429
189 Ga0068860_100520412 3300005843 Bacteria 1189
190 Ga0068860_100947753 3300005843 Bacteria 878
191 Ga0068860_101101516 3300005843 Bacteria 813
192 Ga0068860_101827992 3300005843 Unclassified 629
193 Ga0068862_100121753 3300005844 Bacteria 2300
194 Ga0068862_100134150 3300005844 Bacteria 2193
195 Ga0068862_100189307 3300005844 Bacteria 1851
196 Ga0068862_100589113 3300005844 Bacteria 1066
197 Ga0068862_101154304 3300005844 Bacteria 771
198 Ga0081455_10003869 3300005937 Bacteria 17062
199 Ga0081539_10000043 3300005985 Bacteria 288108
200 Ga0081539_10002984 3300005985 Bacteria 22183
201 Ga0081539_10055025 3300005985 Bacteria 2216
202 Ga0075432_10122131 3300006058 Bacteria 979
203 Ga0070716_100038760 3300006173 Bacteria 2640
204 Ga0097621_100020584 3300006237 Bacteria 5084
205 Ga0097621_100097352 3300006237 Bacteria 2470
206 Ga0097621_100529531 3300006237 Bacteria 1070
207 Ga0097621_100591232 3300006237 Bacteria 1014
208 Ga0068871_100021066 3300006358 Bacteria 5004
209 Ga0068871_100095363 3300006358 Bacteria 2484
210 Ga0068871_100176450 3300006358 Bacteria 1834
211 Ga0075428_100140239 3300006844 Bacteria 2628
212 Ga0075428_100484617 3300006844 Bacteria 1323
213 Ga0075430_100050038 3300006846 Bacteria 3525
214 Ga0075431_100064624 3300006847 Unclassified 3778
215 Ga0075433_10089795 3300006852 Bacteria 2716
216 Ga0075433_10105665 3300006852 Bacteria 2495
217 Ga0075433_10263714 3300006852 Bacteria 1527
218 Ga0075433_10339026 3300006852 Bacteria 1329
219 Ga0075433_10823274 3300006852 Bacteria 811
220 Ga0075433_11664219 3300006852 Unclassified 550
221 Ga0075434_100015110 3300006871 Bacteria 7394
222 Ga0075434_100207914 3300006871 Archaea 1978
223 Ga0075434_100216046 3300006871 Bacteria 1937
224 Ga0075434_100262111 3300006871 Bacteria 1747
225 Ga0075429_100304646 3300006880 Bacteria 1395
226 Ga0068865_100393299 3300006881 Bacteria 1134
227 Ga0068865_100592931 3300006881 Bacteria 936
228 Ga0068865_101586055 3300006881 Bacteria 588
229 Ga0097620_100019034 3300006931 Bacteria 6895
230 Ga0097620_100022766 3300006931 Bacteria 6283
231 Ga0097620_100064927 3300006931 Bacteria 3684
232 Ga0097620_100066068 3300006931 Unclassified 3651
233 Ga0097620_100208902 3300006931 Unclassified 2038
234 Ga0097620_100318029 3300006931 Bacteria 1650
235 Ga0097620_100567849 3300006931 Bacteria 1228
236 Ga0097620_100574821 3300006931 Bacteria 1221
237 Ga0097620_100701243 3300006931 Bacteria 1103
238 Ga0097620_101028892 3300006931 Unclassified 905
239 Ga0097620_101042871 3300006931 Bacteria 899
240 Ga0097620_101835387 3300006931 Unclassified 669
241 Ga0097620_102634003 3300006931 Unclassified 553
242 Ga0097620_102995861 3300006931 Unclassified 516
243 Ga0075435_100931921 3300007076 Bacteria 758
244 Ga0099794_10221587 3300007265 Bacteria 972
245 Ga0105244_10272249 3300009036 Bacteria 786
246 Ga0105240_11765308 3300009093 Bacteria 645
247 Ga0111539_10004522 3300009094 Bacteria 18187
248 Ga0111539_10008733 3300009094 Bacteria 12854
249 Ga0111539_10529683 3300009094 Bacteria 1373
250 Ga0111539_10664852 3300009094 Bacteria 1213
251 Ga0105245_10263765 3300009098 Bacteria 1677
252 Ga0105247_10061780 3300009101 Bacteria 2323
253 Ga0105247_10180433 3300009101 Bacteria 1409
254 Ga0105247_10207043 3300009101 Bacteria 1321
255 Ga0105247_10397464 3300009101 Unclassified 981
256 Ga0105247_10456738 3300009101 Unclassified 922
257 Ga0114129_10134023 3300009147 Bacteria 3400
258 Ga0114129_10264566 3300009147 Bacteria 2303
259 Ga0114129_12596147 3300009147 Unclassified 605
260 Ga0105243_10011052 3300009148 Bacteria 6829
261 Ga0105243_10246452 3300009148 Bacteria 1593
262 Ga0105243_10287685 3300009148 Bacteria 1483
263 Ga0105243_10550054 3300009148 Unclassified 1103
264 Ga0105243_10684532 3300009148 Bacteria 998
265 Ga0105243_11091095 3300009148 Unclassified 806
266 Ga0105243_11501029 3300009148 Unclassified 698
267 Ga0105241_10075314 3300009174 Bacteria 2630
268 Ga0105241_10230340 3300009174 Unclassified 1562
269 Ga0105241_11489112 3300009174 Unclassified 651
270 Ga0105242_10027321 3300009176 Bacteria 4529
271 Ga0105242_10322854 3300009176 Bacteria 1416
272 Ga0105242_10976481 3300009176 Bacteria 853
273 Ga0105242_12450355 3300009176 Unclassified 570
274 Ga0105248_10012449 3300009177 Bacteria 9383
275 Ga0105248_10066951 3300009177 Bacteria 4032
276 Ga0105248_10810878 3300009177 Bacteria 1056
277 Ga0105237_10086237 3300009545 Bacteria 3130
278 Ga0105237_10756530 3300009545 Bacteria 978
279 Ga0105238_10217397 3300009551 Bacteria 1887
280 Ga0105238_10741619 3300009551 Unclassified 996
281 Ga0105249_10038351 3300009553 Unclassified 4347
282 Ga0105249_10279789 3300009553 Bacteria 1666
283 Ga0105249_10801481 3300009553 Unclassified 1006
284 Ga0105249_11249132 3300009553 Unclassified 814
285 Ga0105239_10537123 3300010375 Bacteria 1331
286 Ga0105239_11801023 3300010375 Unclassified 709
287 Ga0105246_10048547 3300011119 Bacteria 2902
288 Ga0105246_10150741 3300011119 Bacteria 1760
289 Ga0105246_12242920 3300011119 Unclassified 532
290 Ga0157373_10018468 3300013100 Bacteria 5077
291 Ga0157373_10176331 3300013100 Bacteria 1505
292 Ga0157373_10765673 3300013100 Bacteria 710
293 Ga0157374_10005677 3300013296 Bacteria 10520
294 Ga0157378_10000878 3300013297 Bacteria 27758
295 Ga0157378_10080849 3300013297 Bacteria 2936
296 Ga0157378_10475503 3300013297 Bacteria 1244
297 Ga0163162_10000838 3300013306 Bacteria 28591
298 Ga0163162_10325566 3300013306 Bacteria 1669
299 Ga0163162_11285695 3300013306 Bacteria 831
300 Ga0163162_12125435 3300013306 Unclassified 644
301 Ga0157375_10004678 3300013308 Bacteria 11904
302 Ga0157375_10019783 3300013308 Bacteria 6134
303 Ga0157375_10145348 3300013308 Bacteria 2502
304 Ga0157375_10509252 3300013308 Unclassified 1368
305 Ga0157375_11844909 3300013308 Bacteria 717
306 Ga0163163_10004068 3300014325 Bacteria 12470
307 Ga0163163_10036476 3300014325 Unclassified 4776
308 Ga0163163_10058369 3300014325 Unclassified 3815
309 Ga0163163_10709154 3300014325 Bacteria 1070
310 Ga0163163_10804357 3300014325 Bacteria 1003
311 Ga0157380_10024482 3300014326 Bacteria 4570
312 Ga0157380_10063475 3300014326 Bacteria 2961
313 Ga0157380_11689217 3300014326 Unclassified 690
314 Ga0157380_12787563 3300014326 Unclassified 555
315 Ga0157377_10086571 3300014745 Bacteria 1842
316 Ga0157377_10107205 3300014745 Bacteria 1674
317 Ga0157377_10230528 3300014745 Bacteria 1190
318 Ga0157377_10308607 3300014745 Unclassified 1047
319 Ga0157377_10419478 3300014745 Bacteria 916
320 Ga0157379_10512316 3300014968 Bacteria 1113
321 Ga0157379_11341544 3300014968 Bacteria 692
322 Ga0157376_10287830 3300014969 Bacteria 1550
323 Ga0163161_10312170 3300017792 Bacteria 1241
324 Ga0207697_10078854 3300025315 Bacteria 1386
325 Ga0207642_10096704 3300025899 Bacteria 1473
326 Ga0207688_10159596 3300025901 Bacteria 1336
327 Ga0207680_10218846 3300025903 Bacteria 1304
328 Ga0207680_10497124 3300025903 Unclassified 868
329 Ga0207647_10037335 3300025904 Unclassified 3081
330 Ga0207645_10253871 3300025907 Unclassified 1164
331 Ga0207643_10391349 3300025908 Unclassified 878
332 Ga0207643_10827707 3300025908 Unclassified 600
333 Ga0207684_10017089 3300025910 Bacteria 6229
334 Ga0207684_10085572 3300025910 Bacteria 2685
335 Ga0207684_10221580 3300025910 Unclassified 1632
336 Ga0207684_10605444 3300025910 Unclassified 936
337 Ga0207684_11086932 3300025910 Unclassified 666
338 Ga0207654_10169472 3300025911 Unclassified 1417
339 Ga0207693_10889483 3300025915 Bacteria 684
340 Ga0207660_10037294 3300025917 Unclassified 3386
341 Ga0207662_10011380 3300025918 Bacteria 4932
342 Ga0207646_10089669 3300025922 Bacteria 2752
343 Ga0207646_10194688 3300025922 Bacteria 1831
344 Ga0207646_10595444 3300025922 Unclassified 993
345 Ga0207646_10642650 3300025922 Unclassified 951
346 Ga0207681_10384377 3300025923 Bacteria 1130
347 Ga0207659_11435378 3300025926 Unclassified 591
348 Ga0207687_10696793 3300025927 Bacteria 862
349 Ga0207644_10348986 3300025931 Bacteria 1201
350 Ga0207644_11065394 3300025931 Unclassified 679
351 Ga0207706_10444557 3300025933 Bacteria 1122
352 Ga0207686_10499572 3300025934 Bacteria 943
353 Ga0207709_10435921 3300025935 Bacteria 1010
354 Ga0207670_10305330 3300025936 Unclassified 1247
355 Ga0207670_10463880 3300025936 Bacteria 1023
356 Ga0207669_10778105 3300025937 Bacteria 792
357 Ga0207704_10582574 3300025938 Bacteria 913
358 Ga0207704_10851334 3300025938 Bacteria 764
359 Ga0207665_10013301 3300025939 Bacteria 5410
360 Ga0207665_10053506 3300025939 Bacteria 2721
361 Ga0207691_10029882 3300025940 Bacteria 5097
362 Ga0207689_10024503 3300025942 Bacteria 5063
363 Ga0207689_10205292 3300025942 Bacteria 1627
364 Ga0207689_10258644 3300025942 Bacteria 1440
365 Ga0207679_10157145 3300025945 Bacteria 1858
366 Ga0207679_10261808 3300025945 Bacteria 1475
367 Ga0207679_11728633 3300025945 Unclassified 572
368 Ga0207651_10266615 3300025960 Unclassified 1409
369 Ga0207651_10890084 3300025960 Bacteria 792
370 Ga0207651_10971889 3300025960 Bacteria 758
371 Ga0207651_11617547 3300025960 Unclassified 583
372 Ga0207712_10491472 3300025961 Bacteria 1048
373 Ga0207658_10195207 3300025986 Bacteria 1686
374 Ga0207703_10340562 3300026035 Unclassified 1378
375 Ga0207703_10997653 3300026035 Unclassified 803
376 Ga0207639_10508527 3300026041 Bacteria 1102
377 Ga0207708_10062296 3300026075 Bacteria 2849
378 Ga0207641_10074478 3300026088 Bacteria 2929
379 Ga0207641_10242737 3300026088 Bacteria 1679
380 Ga0207641_10989728 3300026088 Unclassified 837
381 Ga0207648_10107248 3300026089 Bacteria 2451
382 Ga0207676_10006622 3300026095 Bacteria 8191
383 Ga0207676_10161287 3300026095 Unclassified 1943
384 Ga0207676_10441298 3300026095 Bacteria 1225
385 Ga0207676_12085998 3300026095 Unclassified 565
386 Ga0207674_10096456 3300026116 Unclassified 2942
387 Ga0207674_10962917 3300026116 Unclassified 822
388 Ga0207675_100014959 3300026118 Bacteria 7242
389 Ga0207675_100183534 3300026118 Bacteria 2004
390 Ga0207683_10112756 3300026121 Bacteria 2435
391 Ga0207683_10193558 3300026121 Bacteria 1847
392 Ga0209588_1088654 3300027671 Bacteria 997
393 Ga0207428_10028723 3300027907 Bacteria 4618
394 Ga0268266_10362074 3300028379 Bacteria 1365
395 Ga0268265_10519690 3300028380 Bacteria 1125
396 Ga0268265_12017006 3300028380 Unclassified 584
397 Ga0268264_10284446 3300028381 Bacteria 1550
398 Ga0268264_10876755 3300028381 Unclassified 900
399 Ga0268264_11310212 3300028381 Bacteria 734
400 Ga0265762_1074120 3300030760 Unclassified 719
401 Ga0307405_11481402 3300031731 Unclassified 596
402 Ga0307409_101499312 3300031995 Bacteria 702
403 Ga0373949_0108608 3300035090 Unclassified 767
404 Ga0373951_0142009 3300035091 Unclassified 667
405 Ga0373937_0089457 3300036401 Bacteria 2851
406 Ga0242420_026779 3300038996 Bacteria 1054
407 Ga0439433_0067143 3300041999 Unclassified 861
408 Ga0439449_0229999 3300042007 Unclassified 696
409 Ga0451577_0615352 3300042876 Bacteria 985
410 Ga0453683_0248216 3300044673 Unclassified 1134
411 Ga0453684_0053588 3300044712 Bacteria 5264
412 Ga0453684_1611861 3300044712 Unclassified 666
413 Ga0495580_0415382 3300046472 Unclassified 906
414 Ga0495582_0043120 3300046473 Bacteria 2484
415 Ga0495672_0007622 3300047320 Bacteria 8122
416 Ga0496104_0068486 3300048907 Bacteria 3373
417 Ga0496106_0037646 3300048909 Unclassified 3620
418 Ga0496108_0063553 3300048911 Unclassified 3109
419 Ga0496108_0439240 3300048911 Unclassified 1140
420 Ga0496110_1320545 3300048913 Unclassified 631
421 Ga0496113_0332278 3300048916 Bacteria 1219
422 nmdc:mga05p37_520316_c1 3300050507 Unclassified 1361
423 nmdc:mga05p37_73139_c1 3300050507 Bacteria 4218
424 nmdc:mga05p37_83474_c1 3300050507 Bacteria 3936
425 nmdc:mga06r32_1043542_c1 3300050510 Unclassified 768
426 nmdc:mga08y16_174734_c1 3300050511 Bacteria 2230
427 nmdc:mga08y16_2775_c1 3300050511 Bacteria 17954
428 nmdc:mga0n895_206679_c1 3300050512 Bacteria 1994
429 nmdc:mga0n895_589561_c1 3300050512 Bacteria 1115
430 nmdc:mga08x19_442382_c1 3300050514 Bacteria 914
431 nmdc:mga0a205_164069_c1 3300050515 Bacteria 2117
432 nmdc:mga0a205_312356_c1 3300050515 Bacteria 1444
433 nmdc:mga0a205_446545_c1 3300050515 Bacteria 1154
434 nmdc:mga0a205_59660_c1 3300050515 Bacteria 3685
435 Ga0530510_0081708 3300061734 Bacteria 2353
436 Ga0530510_0268886 3300061734 Bacteria 1272
437 Ga0105240_10164300
438 JGI24742J22300_10050698
439 JGI25406J46586_10039717
440 JGI25406J46586_10042302
441 JGI25406J46586_10075199
442 rootL2_10314765
443 Ga0058859_11193740
444 Ga0058861_11178560
445 Ga0058860_12040440
446 Ga0058862_12447181
447 Ga0065714_10002198
448 Ga0065704_10105602
449 Ga0065704_10293659
450 Ga0065712_10000119
451 Ga0065712_10005904
452 Ga0065712_10079128
453 Ga0065712_10105027
454 Ga0065715_10149519
455 Ga0065715_10237432
456 Ga0065715_10248389
457 Ga0065715_10518022
458 Ga0065707_10003897
459 Ga0065707_10025943
460 Ga0065707_10109025
461 Ga0065707_10241924
462 Ga0070676_10453738
463 Ga0070690_100087689
464 Ga0070690_100232637
465 Ga0068869_100012610
466 Ga0068869_100091520
467 Ga0068869_100200482
468 Ga0068869_100387402
469 Ga0068869_100807612
470 Ga0070666_10026839
471 Ga0070666_10344378
472 Ga0070680_100039962
473 Ga0070682_100031908
474 Ga0068868_101199945
475 Ga0070689_100051557
476 Ga0070689_100466140
477 Ga0070689_101566481
478 Ga0070687_100085601
479 Ga0070687_100257077
480 Ga0070692_10017429
481 Ga0070692_10182154
482 Ga0070692_10219510
483 Ga0070668_100622451
484 Ga0070669_100308150
485 Ga0070669_100553133
486 Ga0070675_100767105
487 Ga0070671_100000822
488 Ga0070671_100016509
489 Ga0070674_100219281
490 Ga0070673_100130096
491 Ga0070673_100464853
492 Ga0070673_100638677
493 Ga0070673_100679065
494 Ga0070688_100294552
495 Ga0070688_101186350
496 Ga0070667_100401547
497 Ga0070701_10417081
498 Ga0070705_100024545
499 Ga0070705_100093172
500 Ga0070705_100293953
501 Ga0070705_100355461
502 Ga0070705_101275097
503 Ga0070700_100041022
504 Ga0070694_100003877
505 Ga0070694_100048257
506 Ga0070694_100064246
507 Ga0070694_100167665
508 Ga0070694_100179766
509 Ga0070694_100600948
510 Ga0070694_100844238
511 Ga0070708_100023240
512 Ga0070708_100116722
513 Ga0070708_100349011
514 Ga0070708_100424840
515 Ga0070708_100558670
516 Ga0070678_100128448
517 Ga0070678_100349112
518 Ga0070662_100054740
519 Ga0070662_100195465
520 Ga0070681_10021774
521 Ga0068867_100070588
522 Ga0068867_100723696
523 Ga0068867_100741698
524 Ga0070685_10458260
525 Ga0070706_100000050
526 Ga0070706_100116963
527 Ga0070706_100335677
528 Ga0070706_100736565
529 Ga0070706_100846559
530 Ga0070707_100020223
531 Ga0070707_100233145
532 Ga0070707_100287410
533 Ga0070707_101239271
534 Ga0070698_100014008
535 Ga0070698_100020225
536 Ga0070698_100967917
537 Ga0070699_100004694
538 Ga0070699_100083744
539 Ga0070699_100086182
540 Ga0070699_100094353
541 Ga0070699_100829090
542 Ga0070699_101213731
543 Ga0070679_100566033
544 Ga0070697_100051558
545 Ga0070697_100099919
546 Ga0070697_100136471
547 Ga0070697_100225152
548 Ga0070697_100389934
549 Ga0070697_100670492
550 Ga0068853_100110691
551 Ga0070672_100196312
552 Ga0070672_100270172
553 Ga0070672_100795839
554 Ga0070686_100257943
555 Ga0070695_100181164
556 Ga0070695_100202891
557 Ga0070695_100252845
558 Ga0070695_100401887
559 Ga0070695_100713766
560 Ga0070695_101290823
561 Ga0070696_100094012
562 Ga0070696_100257708
563 Ga0070696_100386254
564 Ga0070696_100697616
565 Ga0070693_100000271
566 Ga0070693_100021457
567 Ga0070693_100037660
568 Ga0070693_100090901
569 Ga0070693_100171225
570 Ga0070704_100201340
571 Ga0070704_100323679
572 Ga0070704_100990538
573 Ga0070704_101045379
574 Ga0070664_100261879
575 Ga0070664_100383324
576 Ga0070664_100565171
577 Ga0070664_101424216
578 Ga0068857_100135356
579 Ga0068857_100227746
580 Ga0068854_100092065
581 Ga0068854_100590034
582 Ga0068854_100612662
583 Ga0070702_100012880
584 Ga0070702_100671283
585 Ga0070702_100775915
586 Ga0068852_100093909
587 Ga0068859_100019034
588 Ga0068859_100022765
589 Ga0068859_100064927
590 Ga0068859_100066068
591 Ga0068859_100208909
592 Ga0068859_100318003
593 Ga0068859_100567891
594 Ga0068859_100574822
595 Ga0068859_100701317
596 Ga0068859_101028763
597 Ga0068859_101042877
598 Ga0068859_101835381
599 Ga0068859_102634226
600 Ga0068859_102997113
601 Ga0068864_100001404
602 Ga0068864_100026696
603 Ga0068864_100334166
604 Ga0068864_100335617
605 Ga0068864_100698879
606 Ga0068864_100700394
607 Ga0068864_100841654
608 Ga0068864_101478662
609 Ga0068866_10129546
610 Ga0068870_10005743
611 Ga0068870_10177139
612 Ga0068870_10255722
613 Ga0068863_100104342
614 Ga0068863_100289247
615 Ga0068863_100439128
616 Ga0068863_100517116
617 Ga0068863_100669015
618 Ga0068863_101040432
619 Ga0068858_100162721
620 Ga0068858_100356958
621 Ga0068858_100438360
622 Ga0068858_100999756
623 Ga0068860_100143442
624 Ga0068860_100362229
625 Ga0068860_100520412
626 Ga0068860_100947753
627 Ga0068860_101101516
628 Ga0068860_101827992
629 Ga0068862_100121753
630 Ga0068862_100134150
631 Ga0068862_100189307
632 Ga0068862_100589113
633 Ga0068862_101154304
634 Ga0081455_10003869
635 Ga0081539_10000043
636 Ga0081539_10002984
637 Ga0081539_10055025
638 Ga0075432_10122131
639 Ga0070716_100038760
640 Ga0097621_100020584
641 Ga0097621_100097352
642 Ga0097621_100529531
643 Ga0097621_100591232
644 Ga0068871_100021066
645 Ga0068871_100095363
646 Ga0068871_100176450
647 Ga0075428_100140239
648 Ga0075428_100484617
649 Ga0075430_100050038
650 Ga0075431_100064624
651 Ga0075433_10089795
652 Ga0075433_10105665
653 Ga0075433_10263714
654 Ga0075433_10339026
655 Ga0075433_10823274
656 Ga0075433_11664219
657 Ga0075434_100015110
658 Ga0075434_100207914
659 Ga0075434_100216046
660 Ga0075434_100262111
661 Ga0075429_100304646
662 Ga0068865_100393299
663 Ga0068865_100592931
664 Ga0068865_101586055
665 Ga0097620_100019034
666 Ga0097620_100022766
667 Ga0097620_100064927
668 Ga0097620_100066068
669 Ga0097620_100208902
670 Ga0097620_100318029
671 Ga0097620_100567849
672 Ga0097620_100574821
673 Ga0097620_100701243
674 Ga0097620_101028892
675 Ga0097620_101042871
676 Ga0097620_101835387
677 Ga0097620_102634003
678 Ga0097620_102995861
679 Ga0075435_100931921
680 Ga0099794_10221587
681 Ga0105244_10272249
682 Ga0105240_11765308
683 Ga0111539_10004522
684 Ga0111539_10008733
685 Ga0111539_10529683
686 Ga0111539_10664852
687 Ga0105245_10263765
688 Ga0105247_10061780
689 Ga0105247_10180433
690 Ga0105247_10207043
691 Ga0105247_10397464
692 Ga0105247_10456738
693 Ga0114129_10134023
694 Ga0114129_10264566
695 Ga0114129_12596147
696 Ga0105243_10011052
697 Ga0105243_10246452
698 Ga0105243_10287685
699 Ga0105243_10550054
700 Ga0105243_10684532
701 Ga0105243_11091095
702 Ga0105243_11501029
703 Ga0105241_10075314
704 Ga0105241_10230340
705 Ga0105241_11489112
706 Ga0105242_10027321
707 Ga0105242_10322854
708 Ga0105242_10976481
709 Ga0105242_12450355
710 Ga0105248_10012449
711 Ga0105248_10066951
712 Ga0105248_10810878
713 Ga0105237_10086237
714 Ga0105237_10756530
715 Ga0105238_10217397
716 Ga0105238_10741619
717 Ga0105249_10038351
718 Ga0105249_10279789
719 Ga0105249_10801481
720 Ga0105249_11249132
721 Ga0105239_10537123
722 Ga0105239_11801023
723 Ga0105246_10048547
724 Ga0105246_10150741
725 Ga0105246_12242920
726 Ga0157373_10018468
727 Ga0157373_10176331
728 Ga0157373_10765673
729 Ga0157374_10005677
730 Ga0157378_10000878
731 Ga0157378_10080849
732 Ga0157378_10475503
733 Ga0163162_10000838
734 Ga0163162_10325566
735 Ga0163162_11285695
736 Ga0163162_12125435
737 Ga0157375_10004678
738 Ga0157375_10019783
739 Ga0157375_10145348
740 Ga0157375_10509252
741 Ga0157375_11844909
742 Ga0163163_10004068
743 Ga0163163_10036476
744 Ga0163163_10058369
745 Ga0163163_10709154
746 Ga0163163_10804357
747 Ga0157380_10024482
748 Ga0157380_10063475
749 Ga0157380_11689217
750 Ga0157380_12787563
751 Ga0157377_10086571
752 Ga0157377_10107205
753 Ga0157377_10230528
754 Ga0157377_10308607
755 Ga0157377_10419478
756 Ga0157379_10512316
757 Ga0157379_11341544
758 Ga0157376_10287830
759 Ga0163161_10312170
760 Ga0207697_10078854
761 Ga0207642_10096704
762 Ga0207688_10159596
763 Ga0207680_10218846
764 Ga0207680_10497124
765 Ga0207647_10037335
766 Ga0207645_10253871
767 Ga0207643_10391349
768 Ga0207643_10827707
769 Ga0207684_10017089
770 Ga0207684_10085572
771 Ga0207684_10221580
772 Ga0207684_10605444
773 Ga0207684_11086932
774 Ga0207654_10169472
775 Ga0207693_10889483
776 Ga0207660_10037294
777 Ga0207662_10011380
778 Ga0207646_10089669
779 Ga0207646_10194688
780 Ga0207646_10595444
781 Ga0207646_10642650
782 Ga0207681_10384377
783 Ga0207659_11435378
784 Ga0207687_10696793
785 Ga0207644_10348986
786 Ga0207644_11065394
787 Ga0207706_10444557
788 Ga0207686_10499572
789 Ga0207709_10435921
790 Ga0207670_10305330
791 Ga0207670_10463880
792 Ga0207669_10778105
793 Ga0207704_10582574
794 Ga0207704_10851334
795 Ga0207665_10013301
796 Ga0207665_10053506
797 Ga0207691_10029882
798 Ga0207689_10024503
799 Ga0207689_10205292
800 Ga0207689_10258644
801 Ga0207679_10157145
802 Ga0207679_10261808
803 Ga0207679_11728633
804 Ga0207651_10266615
805 Ga0207651_10890084
806 Ga0207651_10971889
807 Ga0207651_11617547
808 Ga0207712_10491472
809 Ga0207658_10195207
810 Ga0207703_10340562
811 Ga0207703_10997653
812 Ga0207639_10508527
813 Ga0207708_10062296
814 Ga0207641_10074478
815 Ga0207641_10242737
816 Ga0207641_10989728
817 Ga0207648_10107248
818 Ga0207676_10006622
819 Ga0207676_10161287
820 Ga0207676_10441298
821 Ga0207676_12085998
822 Ga0207674_10096456
823 Ga0207674_10962917
824 Ga0207675_100014959
825 Ga0207675_100183534
826 Ga0207683_10112756
827 Ga0207683_10193558
828 Ga0209588_1088654
829 Ga0207428_10028723
830 Ga0268266_10362074
831 Ga0268265_10519690
832 Ga0268265_12017006
833 Ga0268264_10284446
834 Ga0268264_10876755
835 Ga0268264_11310212
836 Ga0265762_1074120
837 Ga0307405_11481402
838 Ga0307409_101499312
839 Ga0373949_0108608
840 Ga0373951_0142009
841 Ga0373937_0089457
842 Ga0242420_026779
843 Ga0439433_0067143
844 Ga0439449_0229999
845 Ga0451577_0615352
846 Ga0453683_0248216
847 Ga0453684_0053588
848 Ga0453684_1611861
849 Ga0495580_0415382
850 Ga0495582_0043120
851 Ga0495672_0007622
852 Ga0496104_0068486
853 Ga0496106_0037646
854 Ga0496108_0063553
855 Ga0496108_0439240
856 Ga0496110_1320545
857 Ga0496113_0332278
858 nmdc:mga05p37_520316_c1
859 nmdc:mga05p37_73139_c1
860 nmdc:mga05p37_83474_c1
861 nmdc:mga06r32_1043542_c1
862 nmdc:mga08y16_174734_c1
863 nmdc:mga08y16_2775_c1
864 nmdc:mga0n895_206679_c1
865 nmdc:mga0n895_589561_c1
866 nmdc:mga08x19_442382_c1
867 nmdc:mga0a205_164069_c1
868 nmdc:mga0a205_312356_c1
869 nmdc:mga0a205_446545_c1
870 nmdc:mga0a205_59660_c1
871 Ga0530510_0081708
872 Ga0530510_0268886

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF15956

DUF4760

Domain of unknown function (DUF4760)

43

161

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xjp-assembly1.cif.gz_A cryo-em structure of eds1 and sag101 with atp-apdr 0.4381 8 134
6s2v-assembly3.cif.gz_C structure of the n-terminal catalytic region of t. thermophilus rel 0.4174 24 149
4exj-assembly1.cif.gz_A crystal structure of glutathione s-transferase like protein lelg_03239 (target efi-501752) from lodderomyces elongisporus 0.3741 24 72
7xjp-assembly1.cif.gz_A cryo-em structure of eds1 and sag101 with atp-apdr 0.346 8 134
6z0c-assembly4.cif.gz_D structure of in silico modelled artificial maquette-3 protein 0.3341 9 135
ID Description Score Start End Superfamily
af_P0ACA1_79_188_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.4663 14 121 1.20.1050.10
af_P0ACA1_79_188_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.4293 14 121 1.20.1050.10
af_Q9SR36_91_224_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.4141 27 72 1.20.1050.10
af_P91119_385_715_1.10.1300.10 Mainly Alpha;Orthogonal Bundle;Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b;3'5'-cyclic nucleotide phosphodiesterase, catalytic domain 0.3875 43 129 1.10.1300.10
af_Q17392_368_472_1.20.1310.10 Mainly Alpha;Up-down Bundle;5 helical Cullin repeat like;Cullin Repeats 0.3843 28 123 1.20.1310.10
ID Description Score Start End GO Terms
AF-A0A2V8CS65-F1-model_v4 Uncharacterized protein 0.9823 9 138
AF-A0A2V9YYY0-F1-model_v4 Uncharacterized protein 0.9805 1 141
AF-A0A2V9H6H3-F1-model_v4 Uncharacterized protein 0.98 28 150
AF-A0A3D1AYT2-F1-model_v4 Uncharacterized protein 0.9793 3 120
AF-A0A2V9FNL1-F1-model_v4 Uncharacterized protein 0.9729 2 148

Map