F443463

General Info

Members Datasets Scaffolds Average Seq Length
436 195 872 293

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10168786|Ga0065714_101687861
Length 297
Sequence MELKIPTPRNFSFRRTVASHGWYQLPPFALDTAKWELSRVIDVGQKPPVTIFLTFMTGRKTHVGVNTARPLTKSEEAIVLRDARHILRLDDDLAPFYLNTSNDPEFSWIGEQGAGRLLRSPTVYEDLVKMICTTNCSWALTLKMVNGIVNNLGRPSNNVKDGRKSFPNAQTMATMPLKFFVDEVRAGYRAPYLKELADRVASGELNVEEWLSSELPTRDLLKQMKGVKGVGDYAAENLLKLLGRYDGLALDSWTRARFFELRNKGRKANDKKIERYYARFNEWRGLALWCDVTRDWL

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
159 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
175 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
176 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
177 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
178 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
179 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
180 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
181 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
182 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
183 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
184 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.92
Rhizosphere 99.08
Stem 0
Stem Tuber 0
Unclassified 17.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10168786 3300005288 Bacteria 1014
2 Ga0065714_10064422 3300005288 Bacteria 270668
3 Ga0065704_10001452 3300005289 Bacteria 11850
4 Ga0065704_10006709 3300005289 Bacteria 3462
5 Ga0065704_10097354 3300005289 Bacteria 2399
6 Ga0065712_10067728 3300005290 Bacteria 178215
7 Ga0065712_10076746 3300005290 Bacteria 3609
8 Ga0065712_10135248 3300005290 Unclassified 1501
9 Ga0065715_10105668 3300005293 Bacteria 2875
10 Ga0065715_10115695 3300005293 Unclassified 2406
11 Ga0065715_10143664 3300005293 Bacteria 1816
12 Ga0065715_10181052 3300005293 Unclassified 1476
13 Ga0065707_10000732 3300005295 Bacteria 12775
14 Ga0070690_100011075 3300005330 Bacteria 5266
15 Ga0070670_100000174 3300005331 Bacteria 58017
16 Ga0070670_100002134 3300005331 Bacteria 16236
17 Ga0070670_100078132 3300005331 Unclassified 2843
18 Ga0070677_10107969 3300005333 Bacteria 1238
19 Ga0068869_100013306 3300005334 Bacteria 5469
20 Ga0068869_100069661 3300005334 Bacteria 2601
21 Ga0068869_100403367 3300005334 Bacteria 1125
22 Ga0070666_10034186 3300005335 Bacteria 3369
23 Ga0070666_10171297 3300005335 Unclassified 1520
24 Ga0070666_10230118 3300005335 Bacteria 1309
25 Ga0070682_100002590 3300005337 Bacteria 9989
26 Ga0070682_100008830 3300005337 Bacteria 5689
27 Ga0068868_100218646 3300005338 Unclassified 1594
28 Ga0070689_100006522 3300005340 Bacteria 8090
29 Ga0070689_100054290 3300005340 Bacteria 3101
30 Ga0070689_100149994 3300005340 Bacteria 1880
31 Ga0070689_100177706 3300005340 Bacteria 1727
32 Ga0070691_10096595 3300005341 Bacteria 1463
33 Ga0070687_100101600 3300005343 Unclassified 1611
34 Ga0070661_100136243 3300005344 Bacteria 1848
35 Ga0070692_10003876 3300005345 Bacteria 6162
36 Ga0070692_10012346 3300005345 Bacteria 3951
37 Ga0070669_100015957 3300005353 Bacteria 5358
38 Ga0070669_100020006 3300005353 Unclassified 4780
39 Ga0070669_100033974 3300005353 Bacteria 3691
40 Ga0070669_100174374 3300005353 Bacteria 1678
41 Ga0070675_100306770 3300005354 Bacteria 1399
42 Ga0070671_100113318 3300005355 Bacteria 2279
43 Ga0070674_100017000 3300005356 Bacteria 4567
44 Ga0070673_100138681 3300005364 Bacteria 2050
45 Ga0070673_100172154 3300005364 Bacteria 1849
46 Ga0070673_100218107 3300005364 Bacteria 1650
47 Ga0070688_100045789 3300005365 Bacteria 2705
48 Ga0070703_10003277 3300005406 Bacteria 4615
49 Ga0070701_10053431 3300005438 Unclassified 2102
50 Ga0070705_100034975 3300005440 Bacteria 2813
51 Ga0070705_100052574 3300005440 Bacteria 2381
52 Ga0070705_100261912 3300005440 Bacteria 1220
53 Ga0070700_100049037 3300005441 Unclassified 2620
54 Ga0070700_100100282 3300005441 Bacteria 1906
55 Ga0070700_100198079 3300005441 Unclassified 1409
56 Ga0070694_100022044 3300005444 Bacteria 4079
57 Ga0070694_100134062 3300005444 Bacteria 1793
58 Ga0070694_100350681 3300005444 Unclassified 1143
59 Ga0070708_100368513 3300005445 Bacteria 1354
60 Ga0070662_100099615 3300005457 Bacteria 2197
61 Ga0070662_100165668 3300005457 Unclassified 1732
62 Ga0070681_10000128 3300005458 Bacteria 56982
63 Ga0070681_10041549 3300005458 Bacteria 4608
64 Ga0068867_100021564 3300005459 Bacteria 4597
65 Ga0068867_100141746 3300005459 Bacteria 1879
66 Ga0068867_100174341 3300005459 Bacteria 1705
67 Ga0070685_10152370 3300005466 Unclassified 1466
68 Ga0070685_10157983 3300005466 Bacteria 1443
69 Ga0070706_100002023 3300005467 Bacteria 20813
70 Ga0070706_100010229 3300005467 Bacteria 8721
71 Ga0070707_100025186 3300005468 Bacteria 5642
72 Ga0070707_100249958 3300005468 Unclassified 1726
73 Ga0070698_100004918 3300005471 Bacteria 14656
74 Ga0070698_100005868 3300005471 Bacteria 13418
75 Ga0070698_100073166 3300005471 Bacteria 3434
76 Ga0070699_100001091 3300005518 Bacteria 25262
77 Ga0070699_100001108 3300005518 Bacteria 25059
78 Ga0070699_100040362 3300005518 Bacteria 4041
79 Ga0070679_100000014 3300005530 Bacteria 150481
80 Ga0070679_100088064 3300005530 Unclassified 3092
81 Ga0070684_100335745 3300005535 Bacteria 1389
82 Ga0070697_100001279 3300005536 Bacteria 18982
83 Ga0070697_100016108 3300005536 Bacteria 5878
84 Ga0070697_100112687 3300005536 Bacteria 2269
85 Ga0070697_100200008 3300005536 Bacteria 1698
86 Ga0070697_100391068 3300005536 Bacteria 1206
87 Ga0070697_100610328 3300005536 Bacteria 959
88 Ga0068853_100093193 3300005539 Bacteria 2651
89 Ga0070672_100010653 3300005543 Bacteria 6385
90 Ga0070672_100488399 3300005543 Bacteria 1064
91 Ga0070686_100004332 3300005544 Bacteria 7817
92 Ga0070695_100035195 3300005545 Bacteria 3145
93 Ga0070695_100040438 3300005545 Unclassified 2952
94 Ga0070695_100097645 3300005545 Bacteria 1973
95 Ga0070696_100011002 3300005546 Bacteria 6058
96 Ga0070696_100154781 3300005546 Bacteria 1685
97 Ga0070696_100190628 3300005546 Bacteria 1526
98 Ga0070696_100245218 3300005546 Bacteria 1353
99 Ga0070696_100273753 3300005546 Bacteria 1285
100 Ga0070696_100283930 3300005546 Bacteria 1263
101 Ga0070696_100310534 3300005546 Unclassified 1210
102 Ga0070693_100002974 3300005547 Bacteria 7842
103 Ga0070693_100003335 3300005547 Bacteria 7463
104 Ga0070704_100037414 3300005549 Unclassified 3316
105 Ga0070704_100065404 3300005549 Bacteria 2617
106 Ga0070704_100235147 3300005549 Unclassified 1497
107 Ga0070704_100503957 3300005549 Bacteria 1051
108 Ga0070664_100161994 3300005564 Bacteria 1980
109 Ga0068854_100157700 3300005578 Bacteria 1755
110 Ga0070702_100002432 3300005615 Bacteria 8024
111 Ga0070702_100013830 3300005615 Bacteria 4084
112 Ga0070702_100021874 3300005615 Bacteria 3373
113 Ga0068859_100027179 3300005617 Bacteria 5741
114 Ga0068859_100045430 3300005617 Bacteria 4413
115 Ga0068859_100077795 3300005617 Bacteria 3358
116 Ga0068859_100094327 3300005617 Bacteria 3045
117 Ga0068859_100102367 3300005617 Unclassified 2921
118 Ga0068859_100104744 3300005617 Bacteria 2888
119 Ga0068859_100192120 3300005617 Bacteria 2126
120 Ga0068859_100206271 3300005617 Bacteria 2051
121 Ga0068859_100383242 3300005617 Unclassified 1501
122 Ga0068859_100440314 3300005617 Bacteria 1399
123 Ga0068859_100521366 3300005617 Bacteria 1283
124 Ga0068864_100008280 3300005618 Bacteria 8577
125 Ga0068864_100035370 3300005618 Unclassified 4252
126 Ga0068864_100048237 3300005618 Bacteria 3660
127 Ga0068864_100066743 3300005618 Bacteria 3123
128 Ga0068864_100215602 3300005618 Unclassified 1769
129 Ga0068866_10013312 3300005718 Bacteria 3606
130 Ga0068861_100045707 3300005719 Unclassified 3299
131 Ga0068861_100081731 3300005719 Bacteria 2530
132 Ga0068861_100140216 3300005719 Bacteria 1972
133 Ga0068851_10001396 3300005834 Bacteria 10552
134 Ga0068870_10036676 3300005840 Unclassified 2523
135 Ga0068870_10041384 3300005840 Bacteria 2394
136 Ga0068870_10080120 3300005840 Unclassified 1803
137 Ga0068870_10116524 3300005840 Unclassified 1533
138 Ga0068870_10193618 3300005840 Bacteria 1228
139 Ga0068863_100427037 3300005841 Unclassified 1299
140 Ga0068858_100057821 3300005842 Bacteria 3584
141 Ga0068858_100083496 3300005842 Unclassified 2970
142 Ga0068858_100093400 3300005842 Bacteria 2801
143 Ga0068858_100116158 3300005842 Bacteria 2501
144 Ga0068858_100216526 3300005842 Bacteria 1813
145 Ga0068858_100492614 3300005842 Bacteria 1184
146 Ga0068860_100071055 3300005843 Bacteria 3308
147 Ga0068860_100128113 3300005843 Unclassified 2434
148 Ga0068860_100351004 3300005843 Bacteria 1452
149 Ga0068862_100062995 3300005844 Bacteria 3190
150 Ga0068862_100246213 3300005844 Bacteria 1627
151 Ga0081539_10000612 3300005985 Bacteria 72310
152 Ga0081539_10004410 3300005985 Bacteria 15585
153 Ga0070716_100032085 3300006173 Bacteria 2862
154 Ga0097621_100018057 3300006237 Bacteria 5377
155 Ga0097621_100048512 3300006237 Bacteria 3445
156 Ga0068871_100038171 3300006358 Bacteria 3834
157 Ga0068871_100042965 3300006358 Bacteria 3630
158 Ga0075428_100071467 3300006844 Unclassified 3793
159 Ga0075428_100397660 3300006844 Unclassified 1477
160 Ga0075430_100067018 3300006846 Unclassified 3014
161 Ga0075431_100421554 3300006847 Bacteria 1334
162 Ga0075433_10005928 3300006852 Bacteria 9620
163 Ga0075433_10030579 3300006852 Bacteria 4596
164 Ga0075433_10059429 3300006852 Unclassified 3345
165 Ga0075433_10162702 3300006852 Unclassified 1986
166 Ga0075433_10163410 3300006852 Bacteria 1982
167 Ga0075434_100208616 3300006871 Bacteria 1974
168 Ga0075429_100245310 3300006880 Bacteria 1568
169 Ga0075436_100013402 3300006914 Bacteria 5613
170 Ga0097620_100027178 3300006931 Bacteria 5741
171 Ga0097620_100045430 3300006931 Bacteria 4413
172 Ga0097620_100077795 3300006931 Bacteria 3358
173 Ga0097620_100094325 3300006931 Bacteria 3045
174 Ga0097620_100102363 3300006931 Unclassified 2921
175 Ga0097620_100104739 3300006931 Bacteria 2888
176 Ga0097620_100192120 3300006931 Bacteria 2126
177 Ga0097620_100206287 3300006931 Bacteria 2051
178 Ga0097620_100383205 3300006931 Unclassified 1501
179 Ga0097620_100440326 3300006931 Bacteria 1399
180 Ga0097620_100469888 3300006931 Bacteria 1353
181 Ga0097620_100521336 3300006931 Bacteria 1283
182 Ga0075435_100023642 3300007076 Unclassified 4756
183 Ga0075435_100393362 3300007076 Bacteria 1191
184 Ga0105251_10110391 3300009011 Bacteria 1253
185 Ga0111539_10009194 3300009094 Bacteria 12491
186 Ga0111539_10286261 3300009094 Bacteria 1918
187 Ga0111539_10336946 3300009094 Bacteria 1756
188 Ga0111539_10672986 3300009094 Bacteria 1205
189 Ga0111539_10761117 3300009094 Unclassified 1127
190 Ga0105247_10013734 3300009101 Unclassified 4857
191 Ga0105247_10085953 3300009101 Bacteria 1990
192 Ga0114129_10003934 3300009147 Bacteria 20979
193 Ga0114129_10028456 3300009147 Bacteria 7919
194 Ga0114129_10080296 3300009147 Unclassified 4533
195 Ga0114129_10219971 3300009147 Bacteria 2562
196 Ga0114129_10226692 3300009147 Bacteria 2518
197 Ga0114129_10245035 3300009147 Bacteria 2408
198 Ga0105243_10016570 3300009148 Bacteria 5572
199 Ga0105243_10102850 3300009148 Bacteria 2375
200 Ga0105243_10175646 3300009148 Bacteria 1859
201 Ga0105243_10277691 3300009148 Bacteria 1507
202 Ga0105241_10012406 3300009174 Bacteria 6245
203 Ga0105241_10056859 3300009174 Bacteria 3000
204 Ga0105241_10119058 3300009174 Bacteria 2124
205 Ga0105241_10120124 3300009174 Bacteria 2115
206 Ga0105241_10266636 3300009174 Bacteria 1457
207 Ga0105241_10387779 3300009174 Bacteria 1222
208 Ga0105241_10465518 3300009174 Bacteria 1121
209 Ga0105241_10534388 3300009174 Unclassified 1050
210 Ga0105242_10022778 3300009176 Bacteria 4931
211 Ga0105242_10247192 3300009176 Bacteria 1606
212 Ga0105248_10006028 3300009177 Bacteria 13307
213 Ga0105248_10011382 3300009177 Bacteria 9804
214 Ga0105248_10038308 3300009177 Bacteria 5365
215 Ga0105248_10048930 3300009177 Bacteria 4742
216 Ga0105248_10209158 3300009177 Bacteria 2198
217 Ga0105248_10246769 3300009177 Bacteria 2010
218 Ga0105248_10339914 3300009177 Bacteria 1690
219 Ga0105237_10009837 3300009545 Bacteria 10224
220 Ga0105237_10066273 3300009545 Bacteria 3606
221 Ga0105238_10053535 3300009551 Bacteria 4055
222 Ga0105249_10020914 3300009553 Bacteria 5852
223 Ga0105249_10082493 3300009553 Bacteria 2991
224 Ga0105249_10254688 3300009553 Bacteria 1742
225 Ga0105239_10049942 3300010375 Bacteria 4587
226 Ga0105239_10100219 3300010375 Bacteria 3204
227 Ga0105239_10686747 3300010375 Bacteria 1170
228 Ga0105246_10094387 3300011119 Bacteria 2164
229 Ga0105246_10193990 3300011119 Unclassified 1574
230 Ga0105246_10339797 3300011119 Bacteria 1227
231 Ga0157373_10262139 3300013100 Bacteria 1223
232 Ga0157371_10321290 3300013102 Unclassified 1123
233 Ga0157374_10002801 3300013296 Bacteria 14643
234 Ga0157374_10223647 3300013296 Bacteria 1848
235 Ga0157378_10001527 3300013297 Bacteria 20930
236 Ga0157378_10004532 3300013297 Bacteria 12187
237 Ga0157378_10065877 3300013297 Unclassified 3243
238 Ga0157378_10273351 3300013297 Bacteria 1626
239 Ga0163162_10000002 3300013306 Bacteria 717331
240 Ga0163162_10002133 3300013306 Bacteria 18561
241 Ga0163162_10164823 3300013306 Bacteria 2340
242 Ga0163162_10440016 3300013306 Bacteria 1436
243 Ga0163162_10508989 3300013306 Bacteria 1334
244 Ga0157372_10003354 3300013307 Bacteria 17291
245 Ga0157375_10005416 3300013308 Bacteria 11095
246 Ga0157375_10029447 3300013308 Bacteria 5164
247 Ga0157375_10169120 3300013308 Unclassified 2332
248 Ga0157375_10242395 3300013308 Bacteria 1962
249 Ga0157375_10243189 3300013308 Bacteria 1959
250 Ga0157375_10836782 3300013308 Bacteria 1067
251 Ga0163163_10000208 3300014325 Bacteria 60820
252 Ga0163163_10003565 3300014325 Bacteria 13215
253 Ga0163163_10005597 3300014325 Bacteria 10884
254 Ga0163163_10335423 3300014325 Bacteria 1567
255 Ga0163163_10338255 3300014325 Bacteria 1560
256 Ga0157380_10002605 3300014326 Bacteria 12199
257 Ga0157380_10030794 3300014326 Bacteria 4112
258 Ga0157380_10207386 3300014326 Bacteria 1744
259 Ga0157377_10022056 3300014745 Unclassified 3358
260 Ga0157379_10026581 3300014968 Bacteria 5151
261 Ga0157379_10095502 3300014968 Bacteria 2667
262 Ga0157379_10425371 3300014968 Bacteria 1223
263 Ga0157376_10061791 3300014969 Bacteria 3150
264 Ga0157376_10086513 3300014969 Bacteria 2703
265 Ga0163161_10021131 3300017792 Bacteria 4575
266 Ga0207656_10004635 3300025321 Bacteria 4817
267 Ga0207653_10006434 3300025885 Bacteria 3663
268 Ga0207710_10000506 3300025900 Bacteria 24282
269 Ga0207680_10195121 3300025903 Unclassified 1377
270 Ga0207647_10007659 3300025904 Bacteria 7782
271 Ga0207645_10094946 3300025907 Unclassified 1920
272 Ga0207643_10000377 3300025908 Bacteria 29969
273 Ga0207643_10018259 3300025908 Bacteria 3841
274 Ga0207643_10086534 3300025908 Bacteria 1821
275 Ga0207684_10000150 3300025910 Bacteria 121849
276 Ga0207684_10134615 3300025910 Bacteria 2121
277 Ga0207654_10023539 3300025911 Bacteria 3301
278 Ga0207654_10103035 3300025911 Bacteria 1761
279 Ga0207654_10267943 3300025911 Bacteria 1151
280 Ga0207707_10000016 3300025912 Bacteria 256002
281 Ga0207707_10048910 3300025912 Bacteria 3684
282 Ga0207707_10050772 3300025912 Bacteria 3612
283 Ga0207707_10154900 3300025912 Bacteria 2004
284 Ga0207671_10003702 3300025914 Bacteria 15072
285 Ga0207660_10000079 3300025917 Bacteria 51036
286 Ga0207660_10012105 3300025917 Bacteria 5639
287 Ga0207660_10286398 3300025917 Bacteria 1309
288 Ga0207662_10008951 3300025918 Bacteria 5494
289 Ga0207662_10040732 3300025918 Bacteria 2732
290 Ga0207662_10218114 3300025918 Bacteria 1241
291 Ga0207652_10000372 3300025921 Bacteria 46683
292 Ga0207652_10042975 3300025921 Bacteria 3848
293 Ga0207646_10182599 3300025922 Bacteria 1895
294 Ga0207681_10021193 3300025923 Bacteria 4128
295 Ga0207681_10049279 3300025923 Bacteria 2846
296 Ga0207694_10032634 3300025924 Bacteria 3987
297 Ga0207650_10000011 3300025925 Bacteria 450115
298 Ga0207650_10003764 3300025925 Bacteria 10376
299 Ga0207650_10136001 3300025925 Bacteria 1928
300 Ga0207687_10159628 3300025927 Bacteria 1729
301 Ga0207644_10024777 3300025931 Bacteria 4121
302 Ga0207706_10153794 3300025933 Bacteria 2023
303 Ga0207706_10182474 3300025933 Bacteria 1843
304 Ga0207706_10238462 3300025933 Bacteria 1590
305 Ga0207686_10038989 3300025934 Unclassified 2879
306 Ga0207686_10175375 3300025934 Bacteria 1515
307 Ga0207686_10314166 3300025934 Unclassified 1168
308 Ga0207709_10026338 3300025935 Unclassified 3339
309 Ga0207709_10027377 3300025935 Bacteria 3283
310 Ga0207709_10036638 3300025935 Bacteria 2908
311 Ga0207709_10097031 3300025935 Bacteria 1940
312 Ga0207709_10208755 3300025935 Unclassified 1400
313 Ga0207670_10000587 3300025936 Bacteria 20022
314 Ga0207670_10042899 3300025936 Bacteria 2984
315 Ga0207670_10087688 3300025936 Bacteria 2193
316 Ga0207670_10178528 3300025936 Unclassified 1598
317 Ga0207669_10421390 3300025937 Bacteria 1051
318 Ga0207704_10027815 3300025938 Bacteria 3127
319 Ga0207691_10009066 3300025940 Bacteria 9547
320 Ga0207691_10333812 3300025940 Bacteria 1299
321 Ga0207691_10463759 3300025940 Unclassified 1077
322 Ga0207711_10018600 3300025941 Bacteria 5776
323 Ga0207711_10020283 3300025941 Bacteria 5540
324 Ga0207711_10102516 3300025941 Bacteria 2533
325 Ga0207711_10166605 3300025941 Unclassified 1997
326 Ga0207711_10188992 3300025941 Bacteria 1876
327 Ga0207711_10263502 3300025941 Bacteria 1585
328 Ga0207711_10300869 3300025941 Bacteria 1479
329 Ga0207689_10002946 3300025942 Bacteria 15722
330 Ga0207689_10028515 3300025942 Bacteria 4671
331 Ga0207689_10076522 3300025942 Bacteria 2751
332 Ga0207689_10224197 3300025942 Unclassified 1553
333 Ga0207679_10365005 3300025945 Bacteria 1262
334 Ga0207667_10231940 3300025949 Unclassified 1890
335 Ga0207651_10083078 3300025960 Unclassified 2315
336 Ga0207651_10141712 3300025960 Bacteria 1858
337 Ga0207651_10263185 3300025960 Bacteria 1417
338 Ga0207651_10349504 3300025960 Bacteria 1245
339 Ga0207712_10000041 3300025961 Bacteria 180000
340 Ga0207712_10040686 3300025961 Bacteria 3192
341 Ga0207640_10126395 3300025981 Bacteria 1841
342 Ga0207677_10244509 3300026023 Unclassified 1454
343 Ga0207703_10131578 3300026035 Unclassified 2161
344 Ga0207703_10233198 3300026035 Bacteria 1651
345 Ga0207703_10333355 3300026035 Bacteria 1392
346 Ga0207639_10019950 3300026041 Bacteria 4791
347 Ga0207708_10000646 3300026075 Bacteria 26763
348 Ga0207708_10069110 3300026075 Bacteria 2704
349 Ga0207641_10215546 3300026088 Bacteria 1777
350 Ga0207641_10370049 3300026088 Bacteria 1370
351 Ga0207648_10088101 3300026089 Bacteria 2710
352 Ga0207648_10128478 3300026089 Bacteria 2230
353 Ga0207676_10008628 3300026095 Bacteria 7244
354 Ga0207676_10009172 3300026095 Bacteria 7043
355 Ga0207676_10113482 3300026095 Bacteria 2272
356 Ga0207676_10194691 3300026095 Viruses 1787
357 Ga0207674_10304100 3300026116 Bacteria 1544
358 Ga0207674_10383131 3300026116 Bacteria 1359
359 Ga0207674_10461149 3300026116 Bacteria 1228
360 Ga0207675_100001831 3300026118 Bacteria 21313
361 Ga0207675_100013067 3300026118 Bacteria 7749
362 Ga0207675_100016917 3300026118 Bacteria 6815
363 Ga0207675_100301866 3300026118 Bacteria 1560
364 Ga0207675_100499225 3300026118 Bacteria 1211
365 Ga0207698_10498938 3300026142 Bacteria 1184
366 Ga0207428_10007270 3300027907 Bacteria 10125
367 Ga0268264_10163342 3300028381 Unclassified 2008
368 Ga0268264_10355010 3300028381 Bacteria 1396
369 Ga0307408_100007420 3300031548 Bacteria 7252
370 Ga0307408_100185710 3300031548 Bacteria 1671
371 Ga0307408_100429658 3300031548 Bacteria 1141
372 Ga0307405_10008831 3300031731 Bacteria 5134
373 Ga0307413_10008999 3300031824 Unclassified 4752
374 Ga0307410_10014883 3300031852 Bacteria 4595
375 Ga0307406_10005576 3300031901 Bacteria 6886
376 Ga0307406_10122285 3300031901 Bacteria 1812
377 Ga0307406_10129027 3300031901 Bacteria 1772
378 Ga0307407_10349286 3300031903 Unclassified 1047
379 Ga0307412_10024153 3300031911 Bacteria 3749
380 Ga0307412_10160920 3300031911 Unclassified 1668
381 Ga0307409_100108007 3300031995 Bacteria 2326
382 Ga0307416_100415007 3300032002 Unclassified 1388
383 Ga0307414_10010306 3300032004 Bacteria 5415
384 Ga0307414_10039481 3300032004 Unclassified 3180
385 Ga0307414_10227101 3300032004 Bacteria 1537
386 Ga0307411_10124811 3300032005 Bacteria 1870
387 Ga0307415_100005141 3300032126 Bacteria 6901
388 Ga0373951_0001837 3300035091 Bacteria 5503
389 Ga0373942_0004306 3300035207 Bacteria 3313
390 Ga0373937_0366718 3300036401 Archaea 1365
391 Ga0395899_0164460 3300037312 Bacteria 1566
392 Ga0395900_0099897 3300037418 Bacteria 2981
393 Ga0395900_0322536 3300037418 Bacteria 1525
394 Ga0395898_0439571 3300037466 Unclassified 1243
395 Ga0395905_0202665 3300037471 Bacteria 1860
396 Ga0395901_0740731 3300038443 Bacteria 977
397 Ga0451576_0255848 3300045051 Bacteria 1830
398 Ga0495621_0002638 3300046539 Unclassified 4850
399 Ga0496107_0031805 3300048910 Bacteria 3768
400 Ga0496108_0075088 3300048911 Bacteria 2855
401 Ga0496110_0269913 3300048913 Bacteria 1549
402 Ga0496112_0201176 3300048915 Bacteria 1951
403 Ga0501296_002035 3300049519 Bacteria 2076
404 Ga0501075_0164958 3300049591 Bacteria 1690
405 Ga0501198_012477 3300049649 Bacteria 1278
406 Ga0501207_010154 3300049654 Bacteria 1385
407 Ga0501209_001449 3300049656 Unclassified 3361
408 Ga0501217_003272 3300049661 Bacteria 3263
409 Ga0501217_037840 3300049661 Bacteria 1216
410 Ga0501233_000204 3300049668 Bacteria 8777
411 Ga0501233_007084 3300049668 Bacteria 2128
412 Ga0501236_002178 3300049670 Bacteria 2240
413 Ga0501240_020050 3300049673 Unclassified 997
414 Ga0501243_006466 3300049675 Bacteria 1775
415 Ga0501225_0003125 3300049705 Bacteria 5062
416 Ga0501229_000235 3300049706 Bacteria 6178
417 Ga0501234_000584 3300049707 Bacteria 5594
418 Ga0501045_0295091 3300049824 Bacteria 1206
419 Ga0501226_000561 3300049853 Bacteria 5115
420 nmdc:mga05p37_111451_c1 3300050507 Bacteria 3365
421 nmdc:mga05p37_150727_c1 3300050507 Bacteria 2844
422 nmdc:mga05p37_236474_c1 3300050507 Bacteria 2199
423 nmdc:mga05p37_308226_c1 3300050507 Bacteria 1878
424 nmdc:mga09592_295653_c1 3300050508 Bacteria 1404
425 nmdc:mga09592_367090_c1 3300050508 Bacteria 1245
426 nmdc:mga0qj67_29950_c1 3300050509 Unclassified 4232
427 nmdc:mga06r32_303840_c1 3300050510 Bacteria 1581
428 nmdc:mga08y16_333193_c1 3300050511 Bacteria 1561
429 nmdc:mga08y16_674_c1 3300050511 Bacteria 32251
430 nmdc:mga0n895_119204_c1 3300050512 Bacteria 2660
431 nmdc:mga0rr50_199248_c1 3300050513 Bacteria 1644
432 nmdc:mga0rr50_32873_c1 3300050513 Bacteria 3701
433 nmdc:mga0a205_254046_c1 3300050515 Unclassified 1637
434 nmdc:mga0a205_311066_c1 3300050515 Unclassified 1447
435 nmdc:mga0a205_367926_c1 3300050515 Unclassified 1304
436 Ga0501084_0624381 3300054114 Unclassified 910
437 Ga0065714_10168786
438 Ga0065714_10064422
439 Ga0065704_10001452
440 Ga0065704_10006709
441 Ga0065704_10097354
442 Ga0065712_10067728
443 Ga0065712_10076746
444 Ga0065712_10135248
445 Ga0065715_10105668
446 Ga0065715_10115695
447 Ga0065715_10143664
448 Ga0065715_10181052
449 Ga0065707_10000732
450 Ga0070690_100011075
451 Ga0070670_100000174
452 Ga0070670_100002134
453 Ga0070670_100078132
454 Ga0070677_10107969
455 Ga0068869_100013306
456 Ga0068869_100069661
457 Ga0068869_100403367
458 Ga0070666_10034186
459 Ga0070666_10171297
460 Ga0070666_10230118
461 Ga0070682_100002590
462 Ga0070682_100008830
463 Ga0068868_100218646
464 Ga0070689_100006522
465 Ga0070689_100054290
466 Ga0070689_100149994
467 Ga0070689_100177706
468 Ga0070691_10096595
469 Ga0070687_100101600
470 Ga0070661_100136243
471 Ga0070692_10003876
472 Ga0070692_10012346
473 Ga0070669_100015957
474 Ga0070669_100020006
475 Ga0070669_100033974
476 Ga0070669_100174374
477 Ga0070675_100306770
478 Ga0070671_100113318
479 Ga0070674_100017000
480 Ga0070673_100138681
481 Ga0070673_100172154
482 Ga0070673_100218107
483 Ga0070688_100045789
484 Ga0070703_10003277
485 Ga0070701_10053431
486 Ga0070705_100034975
487 Ga0070705_100052574
488 Ga0070705_100261912
489 Ga0070700_100049037
490 Ga0070700_100100282
491 Ga0070700_100198079
492 Ga0070694_100022044
493 Ga0070694_100134062
494 Ga0070694_100350681
495 Ga0070708_100368513
496 Ga0070662_100099615
497 Ga0070662_100165668
498 Ga0070681_10000128
499 Ga0070681_10041549
500 Ga0068867_100021564
501 Ga0068867_100141746
502 Ga0068867_100174341
503 Ga0070685_10152370
504 Ga0070685_10157983
505 Ga0070706_100002023
506 Ga0070706_100010229
507 Ga0070707_100025186
508 Ga0070707_100249958
509 Ga0070698_100004918
510 Ga0070698_100005868
511 Ga0070698_100073166
512 Ga0070699_100001091
513 Ga0070699_100001108
514 Ga0070699_100040362
515 Ga0070679_100000014
516 Ga0070679_100088064
517 Ga0070684_100335745
518 Ga0070697_100001279
519 Ga0070697_100016108
520 Ga0070697_100112687
521 Ga0070697_100200008
522 Ga0070697_100391068
523 Ga0070697_100610328
524 Ga0068853_100093193
525 Ga0070672_100010653
526 Ga0070672_100488399
527 Ga0070686_100004332
528 Ga0070695_100035195
529 Ga0070695_100040438
530 Ga0070695_100097645
531 Ga0070696_100011002
532 Ga0070696_100154781
533 Ga0070696_100190628
534 Ga0070696_100245218
535 Ga0070696_100273753
536 Ga0070696_100283930
537 Ga0070696_100310534
538 Ga0070693_100002974
539 Ga0070693_100003335
540 Ga0070704_100037414
541 Ga0070704_100065404
542 Ga0070704_100235147
543 Ga0070704_100503957
544 Ga0070664_100161994
545 Ga0068854_100157700
546 Ga0070702_100002432
547 Ga0070702_100013830
548 Ga0070702_100021874
549 Ga0068859_100027179
550 Ga0068859_100045430
551 Ga0068859_100077795
552 Ga0068859_100094327
553 Ga0068859_100102367
554 Ga0068859_100104744
555 Ga0068859_100192120
556 Ga0068859_100206271
557 Ga0068859_100383242
558 Ga0068859_100440314
559 Ga0068859_100521366
560 Ga0068864_100008280
561 Ga0068864_100035370
562 Ga0068864_100048237
563 Ga0068864_100066743
564 Ga0068864_100215602
565 Ga0068866_10013312
566 Ga0068861_100045707
567 Ga0068861_100081731
568 Ga0068861_100140216
569 Ga0068851_10001396
570 Ga0068870_10036676
571 Ga0068870_10041384
572 Ga0068870_10080120
573 Ga0068870_10116524
574 Ga0068870_10193618
575 Ga0068863_100427037
576 Ga0068858_100057821
577 Ga0068858_100083496
578 Ga0068858_100093400
579 Ga0068858_100116158
580 Ga0068858_100216526
581 Ga0068858_100492614
582 Ga0068860_100071055
583 Ga0068860_100128113
584 Ga0068860_100351004
585 Ga0068862_100062995
586 Ga0068862_100246213
587 Ga0081539_10000612
588 Ga0081539_10004410
589 Ga0070716_100032085
590 Ga0097621_100018057
591 Ga0097621_100048512
592 Ga0068871_100038171
593 Ga0068871_100042965
594 Ga0075428_100071467
595 Ga0075428_100397660
596 Ga0075430_100067018
597 Ga0075431_100421554
598 Ga0075433_10005928
599 Ga0075433_10030579
600 Ga0075433_10059429
601 Ga0075433_10162702
602 Ga0075433_10163410
603 Ga0075434_100208616
604 Ga0075429_100245310
605 Ga0075436_100013402
606 Ga0097620_100027178
607 Ga0097620_100045430
608 Ga0097620_100077795
609 Ga0097620_100094325
610 Ga0097620_100102363
611 Ga0097620_100104739
612 Ga0097620_100192120
613 Ga0097620_100206287
614 Ga0097620_100383205
615 Ga0097620_100440326
616 Ga0097620_100469888
617 Ga0097620_100521336
618 Ga0075435_100023642
619 Ga0075435_100393362
620 Ga0105251_10110391
621 Ga0111539_10009194
622 Ga0111539_10286261
623 Ga0111539_10336946
624 Ga0111539_10672986
625 Ga0111539_10761117
626 Ga0105247_10013734
627 Ga0105247_10085953
628 Ga0114129_10003934
629 Ga0114129_10028456
630 Ga0114129_10080296
631 Ga0114129_10219971
632 Ga0114129_10226692
633 Ga0114129_10245035
634 Ga0105243_10016570
635 Ga0105243_10102850
636 Ga0105243_10175646
637 Ga0105243_10277691
638 Ga0105241_10012406
639 Ga0105241_10056859
640 Ga0105241_10119058
641 Ga0105241_10120124
642 Ga0105241_10266636
643 Ga0105241_10387779
644 Ga0105241_10465518
645 Ga0105241_10534388
646 Ga0105242_10022778
647 Ga0105242_10247192
648 Ga0105248_10006028
649 Ga0105248_10011382
650 Ga0105248_10038308
651 Ga0105248_10048930
652 Ga0105248_10209158
653 Ga0105248_10246769
654 Ga0105248_10339914
655 Ga0105237_10009837
656 Ga0105237_10066273
657 Ga0105238_10053535
658 Ga0105249_10020914
659 Ga0105249_10082493
660 Ga0105249_10254688
661 Ga0105239_10049942
662 Ga0105239_10100219
663 Ga0105239_10686747
664 Ga0105246_10094387
665 Ga0105246_10193990
666 Ga0105246_10339797
667 Ga0157373_10262139
668 Ga0157371_10321290
669 Ga0157374_10002801
670 Ga0157374_10223647
671 Ga0157378_10001527
672 Ga0157378_10004532
673 Ga0157378_10065877
674 Ga0157378_10273351
675 Ga0163162_10000002
676 Ga0163162_10002133
677 Ga0163162_10164823
678 Ga0163162_10440016
679 Ga0163162_10508989
680 Ga0157372_10003354
681 Ga0157375_10005416
682 Ga0157375_10029447
683 Ga0157375_10169120
684 Ga0157375_10242395
685 Ga0157375_10243189
686 Ga0157375_10836782
687 Ga0163163_10000208
688 Ga0163163_10003565
689 Ga0163163_10005597
690 Ga0163163_10335423
691 Ga0163163_10338255
692 Ga0157380_10002605
693 Ga0157380_10030794
694 Ga0157380_10207386
695 Ga0157377_10022056
696 Ga0157379_10026581
697 Ga0157379_10095502
698 Ga0157379_10425371
699 Ga0157376_10061791
700 Ga0157376_10086513
701 Ga0163161_10021131
702 Ga0207656_10004635
703 Ga0207653_10006434
704 Ga0207710_10000506
705 Ga0207680_10195121
706 Ga0207647_10007659
707 Ga0207645_10094946
708 Ga0207643_10000377
709 Ga0207643_10018259
710 Ga0207643_10086534
711 Ga0207684_10000150
712 Ga0207684_10134615
713 Ga0207654_10023539
714 Ga0207654_10103035
715 Ga0207654_10267943
716 Ga0207707_10000016
717 Ga0207707_10048910
718 Ga0207707_10050772
719 Ga0207707_10154900
720 Ga0207671_10003702
721 Ga0207660_10000079
722 Ga0207660_10012105
723 Ga0207660_10286398
724 Ga0207662_10008951
725 Ga0207662_10040732
726 Ga0207662_10218114
727 Ga0207652_10000372
728 Ga0207652_10042975
729 Ga0207646_10182599
730 Ga0207681_10021193
731 Ga0207681_10049279
732 Ga0207694_10032634
733 Ga0207650_10000011
734 Ga0207650_10003764
735 Ga0207650_10136001
736 Ga0207687_10159628
737 Ga0207644_10024777
738 Ga0207706_10153794
739 Ga0207706_10182474
740 Ga0207706_10238462
741 Ga0207686_10038989
742 Ga0207686_10175375
743 Ga0207686_10314166
744 Ga0207709_10026338
745 Ga0207709_10027377
746 Ga0207709_10036638
747 Ga0207709_10097031
748 Ga0207709_10208755
749 Ga0207670_10000587
750 Ga0207670_10042899
751 Ga0207670_10087688
752 Ga0207670_10178528
753 Ga0207669_10421390
754 Ga0207704_10027815
755 Ga0207691_10009066
756 Ga0207691_10333812
757 Ga0207691_10463759
758 Ga0207711_10018600
759 Ga0207711_10020283
760 Ga0207711_10102516
761 Ga0207711_10166605
762 Ga0207711_10188992
763 Ga0207711_10263502
764 Ga0207711_10300869
765 Ga0207689_10002946
766 Ga0207689_10028515
767 Ga0207689_10076522
768 Ga0207689_10224197
769 Ga0207679_10365005
770 Ga0207667_10231940
771 Ga0207651_10083078
772 Ga0207651_10141712
773 Ga0207651_10263185
774 Ga0207651_10349504
775 Ga0207712_10000041
776 Ga0207712_10040686
777 Ga0207640_10126395
778 Ga0207677_10244509
779 Ga0207703_10131578
780 Ga0207703_10233198
781 Ga0207703_10333355
782 Ga0207639_10019950
783 Ga0207708_10000646
784 Ga0207708_10069110
785 Ga0207641_10215546
786 Ga0207641_10370049
787 Ga0207648_10088101
788 Ga0207648_10128478
789 Ga0207676_10008628
790 Ga0207676_10009172
791 Ga0207676_10113482
792 Ga0207676_10194691
793 Ga0207674_10304100
794 Ga0207674_10383131
795 Ga0207674_10461149
796 Ga0207675_100001831
797 Ga0207675_100013067
798 Ga0207675_100016917
799 Ga0207675_100301866
800 Ga0207675_100499225
801 Ga0207698_10498938
802 Ga0207428_10007270
803 Ga0268264_10163342
804 Ga0268264_10355010
805 Ga0307408_100007420
806 Ga0307408_100185710
807 Ga0307408_100429658
808 Ga0307405_10008831
809 Ga0307413_10008999
810 Ga0307410_10014883
811 Ga0307406_10005576
812 Ga0307406_10122285
813 Ga0307406_10129027
814 Ga0307407_10349286
815 Ga0307412_10024153
816 Ga0307412_10160920
817 Ga0307409_100108007
818 Ga0307416_100415007
819 Ga0307414_10010306
820 Ga0307414_10039481
821 Ga0307414_10227101
822 Ga0307411_10124811
823 Ga0307415_100005141
824 Ga0373951_0001837
825 Ga0373942_0004306
826 Ga0373937_0366718
827 Ga0395899_0164460
828 Ga0395900_0099897
829 Ga0395900_0322536
830 Ga0395898_0439571
831 Ga0395905_0202665
832 Ga0395901_0740731
833 Ga0451576_0255848
834 Ga0495621_0002638
835 Ga0496107_0031805
836 Ga0496108_0075088
837 Ga0496110_0269913
838 Ga0496112_0201176
839 Ga0501296_002035
840 Ga0501075_0164958
841 Ga0501198_012477
842 Ga0501207_010154
843 Ga0501209_001449
844 Ga0501217_003272
845 Ga0501217_037840
846 Ga0501233_000204
847 Ga0501233_007084
848 Ga0501236_002178
849 Ga0501240_020050
850 Ga0501243_006466
851 Ga0501225_0003125
852 Ga0501229_000235
853 Ga0501234_000584
854 Ga0501045_0295091
855 Ga0501226_000561
856 nmdc:mga05p37_111451_c1
857 nmdc:mga05p37_150727_c1
858 nmdc:mga05p37_236474_c1
859 nmdc:mga05p37_308226_c1
860 nmdc:mga09592_295653_c1
861 nmdc:mga09592_367090_c1
862 nmdc:mga0qj67_29950_c1
863 nmdc:mga06r32_303840_c1
864 nmdc:mga08y16_333193_c1
865 nmdc:mga08y16_674_c1
866 nmdc:mga0n895_119204_c1
867 nmdc:mga0rr50_199248_c1
868 nmdc:mga0rr50_32873_c1
869 nmdc:mga0a205_254046_c1
870 nmdc:mga0a205_311066_c1
871 nmdc:mga0a205_367926_c1
872 Ga0501084_0624381

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oh6-assembly1.cif.gz_A alka undamaged dna complex: interrogation of a c:g base pair 0.8115 58 343
3ogd-assembly1.cif.gz_A alka undamaged dna complex: interrogation of a g*:c base pair 0.8044 58 339
4ejz-assembly2.cif.gz_B structure of mbogg1 in complex with low affinity dna ligand 0.8012 59 345
3cvs-assembly1.cif.gz_D crystal structure of an alka host/guest complex 8oxoguanine:adenine base pair 0.7992 60 346
2jhn-assembly2.cif.gz_B 3-methyladenine dna-glycosylase from archaeoglobus fulgidus 0.7775 60 348
ID Description Score Start End Superfamily
3i0xA02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9008 177 290 1.10.340.30
3f0zA02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8948 177 290 1.10.340.30
af_A0A0P0X9V3_269_360_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8905 217 294 1.10.340.30
4ejzB02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8884 177 295 1.10.340.30
af_I1L092_253_346_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8735 216 290 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A7W1G8H1-F1-model_v4 Fe-S cluster assembly protein HesB 0.9943 58 288 GO:0006285
GO:0034039
AF-A0A1Q7Y809-F1-model_v4 DNA-(apurinic or apyrimidinic site) lyase (EC 4.2.99.18) 0.9923 57 347 GO:0006284
GO:0016787
AF-A0A2V8QNK3-F1-model_v4 3-methyladenine DNA glycosylase 0.9913 122 348 GO:0006285
GO:0034039
AF-A0A7Y2D2K5-F1-model_v4 DNA-(apurinic or apyrimidinic site) lyase (EC 4.2.99.18) 0.9877 177 345 GO:0006285
GO:0034039
AF-A0A7W1G8H1-F1-model_v4 Fe-S cluster assembly protein HesB 0.9857 58 288 GO:0006285
GO:0034039

Map