F443389

General Info

Members Datasets Scaffolds Average Seq Length
435 242 870 402

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0017481|Ga0466959_0017481_603_1916
Length 437
Sequence VLAFALMSQSVHPGIAAPPPPIEFLVDHHPRRWRTLVLLASAELLGMSLWFAASAVSPQLAQRWHLSASAVGWLTAVVQLGFVLGTAISALLNLADILPSRLLFAASALIGAIANAAILTVPSYWGVLTCRLITGFALAGVYPPAMKMISTWFRARRGLAVGAIVGALTVGKAAPYLIHAVPGTGVSPVVLSASLGAAGAAVIVLTGYVDGPYPFPPRPFSWGLVGTVFRERRWRLATAGYLGHMFELYSAWTWIPTFVAMSAAAAGVAPGRLRDSLAAAIAFSAIAIGGIGCIWGGIVADRRGREWLVSAAMATSGTCAILIGFTFGRTLWLLIPVALAWGFFVIADSAQFSVLVTESVPPHAVGTALTIQTSLGFLLTMVSIQLVPPVAAAVGWQWAFAMLAFGPVAGIAAIRRLRRARHLTSAPASRDRLPRGP

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
144 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
145 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
146 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
147 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
148 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
155 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
163 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
192 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
193 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
194 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
195 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
238 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
241 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
242 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0
Isolates 0.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 0.92
Rhizosphere 97.7
Stem 0
Stem Tuber 0
Unclassified 9.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0017481 3300045049 Bacteria 5257
2 Ga0065712_10096447 3300005290 Bacteria 2183
3 Ga0070658_10004600 3300005327 Bacteria 11211
4 Ga0070658_10009445 3300005327 Bacteria 7840
5 Ga0070658_10013032 3300005327 Bacteria 6672
6 Ga0070658_10298290 3300005327 Bacteria 1374
7 Ga0070683_100000547 3300005329 Bacteria 26623
8 Ga0070683_100001913 3300005329 Bacteria 16290
9 Ga0070683_100002220 3300005329 Bacteria 15386
10 Ga0070683_100010472 3300005329 Bacteria 7974
11 Ga0070683_100016485 3300005329 Bacteria 6517
12 Ga0070683_100016834 3300005329 Bacteria 6450
13 Ga0070683_100025395 3300005329 Bacteria 5320
14 Ga0070683_100032987 3300005329 Unclassified 4719
15 Ga0070690_100026995 3300005330 Unclassified 3547
16 Ga0070670_100001370 3300005331 Bacteria 19526
17 Ga0068869_100000589 3300005334 Bacteria 20373
18 Ga0068869_100127077 3300005334 Bacteria 1956
19 Ga0070680_100000169 3300005336 Bacteria 41532
20 Ga0070680_100002372 3300005336 Bacteria 13924
21 Ga0070680_100010513 3300005336 Bacteria 7137
22 Ga0070680_100018546 3300005336 Bacteria 5500
23 Ga0070682_100000225 3300005337 Bacteria 40888
24 Ga0070660_100014156 3300005339 Bacteria 5743
25 Ga0070660_100039442 3300005339 Bacteria 3590
26 Ga0070660_100094476 3300005339 Bacteria 2362
27 Ga0070689_100002443 3300005340 Bacteria 12145
28 Ga0070689_100025083 3300005340 Bacteria 4478
29 Ga0070689_100074246 3300005340 Bacteria 2661
30 Ga0070691_10005094 3300005341 Bacteria 5971
31 Ga0070687_100120671 3300005343 Bacteria 1499
32 Ga0070661_100004124 3300005344 Bacteria 10016
33 Ga0070661_100065739 3300005344 Unclassified 2664
34 Ga0070692_10005342 3300005345 Bacteria 5466
35 Ga0070669_100235997 3300005353 Bacteria 1451
36 Ga0070675_100010371 3300005354 Bacteria 7278
37 Ga0070675_100161710 3300005354 Bacteria 1926
38 Ga0070671_100080820 3300005355 Bacteria 2718
39 Ga0070673_100223104 3300005364 Unclassified 1632
40 Ga0070688_100009287 3300005365 Bacteria 5370
41 Ga0070688_100024019 3300005365 Bacteria 3591
42 Ga0070688_100052112 3300005365 Bacteria 2555
43 Ga0070688_100118559 3300005365 Bacteria 1769
44 Ga0070659_100000342 3300005366 Bacteria 35947
45 Ga0070667_100223200 3300005367 Bacteria 1678
46 Ga0070709_10000052 3300005434 Bacteria 90029
47 Ga0070709_10003435 3300005434 Bacteria 8499
48 Ga0070709_10022467 3300005434 Bacteria 3690
49 Ga0070714_100005162 3300005435 Bacteria 9938
50 Ga0070714_100013965 3300005435 Bacteria 6444
51 Ga0070714_100016757 3300005435 Bacteria 5925
52 Ga0070713_100000284 3300005436 Bacteria 33417
53 Ga0070713_100143481 3300005436 Bacteria 2117
54 Ga0070710_10032148 3300005437 Bacteria 2840
55 Ga0070711_100030017 3300005439 Bacteria 3595
56 Ga0070711_100159643 3300005439 Unclassified 1708
57 Ga0070708_100000116 3300005445 Bacteria 52885
58 Ga0070708_100093762 3300005445 Bacteria 2738
59 Ga0070708_100203484 3300005445 Bacteria 1854
60 Ga0070663_100105502 3300005455 Bacteria 2109
61 Ga0070662_100008341 3300005457 Bacteria 6751
62 Ga0070662_100037182 3300005457 Bacteria 3450
63 Ga0070681_10000161 3300005458 Bacteria 50572
64 Ga0070681_10000358 3300005458 Bacteria 36857
65 Ga0070681_10001602 3300005458 Bacteria 20122
66 Ga0070681_10025564 3300005458 Bacteria 5940
67 Ga0070681_10076646 3300005458 Bacteria 3302
68 Ga0070681_10133840 3300005458 Bacteria 2410
69 Ga0070685_10000679 3300005466 Bacteria 18486
70 Ga0070685_10005958 3300005466 Bacteria 6204
71 Ga0070685_10038477 3300005466 Bacteria 2713
72 Ga0070706_100070384 3300005467 Bacteria 3235
73 Ga0070706_100110665 3300005467 Bacteria 2556
74 Ga0070707_100053015 3300005468 Bacteria 3888
75 Ga0070707_100243518 3300005468 Bacteria 1750
76 Ga0070698_100042228 3300005471 Bacteria 4677
77 Ga0070698_100051972 3300005471 Bacteria 4171
78 Ga0070699_100006030 3300005518 Bacteria 10596
79 Ga0070679_100000080 3300005530 Bacteria 72275
80 Ga0070679_100000232 3300005530 Bacteria 45998
81 Ga0070679_100003238 3300005530 Bacteria 14876
82 Ga0070679_100007955 3300005530 Bacteria 9950
83 Ga0070679_100045576 3300005530 Unclassified 4370
84 Ga0070679_100054258 3300005530 Bacteria 3990
85 Ga0070684_100008557 3300005535 Bacteria 8010
86 Ga0070684_100012236 3300005535 Bacteria 6868
87 Ga0070684_100054124 3300005535 Bacteria 3496
88 Ga0070684_100099047 3300005535 Bacteria 2601
89 Ga0070684_100146926 3300005535 Bacteria 2134
90 Ga0070672_100022326 3300005543 Bacteria 4648
91 Ga0070686_100000092 3300005544 Bacteria 62767
92 Ga0070696_100058379 3300005546 Bacteria 2694
93 Ga0070693_100005827 3300005547 Bacteria 5951
94 Ga0070693_100062100 3300005547 Unclassified 2174
95 Ga0068855_100001632 3300005563 Bacteria 28143
96 Ga0068855_100003737 3300005563 Bacteria 18602
97 Ga0068855_100029263 3300005563 Bacteria 6587
98 Ga0068855_100097946 3300005563 Bacteria 3378
99 Ga0070664_100001051 3300005564 Bacteria 21704
100 Ga0070664_100010539 3300005564 Bacteria 7492
101 Ga0070664_100026050 3300005564 Bacteria 4849
102 Ga0068857_100087080 3300005577 Bacteria 2794
103 Ga0068857_100130413 3300005577 Bacteria 2267
104 Ga0068856_100008346 3300005614 Bacteria 10091
105 Ga0068856_100020680 3300005614 Bacteria 6394
106 Ga0068856_100021047 3300005614 Bacteria 6339
107 Ga0068856_100072118 3300005614 Bacteria 3419
108 Ga0070702_100006866 3300005615 Bacteria 5418
109 Ga0068852_100003009 3300005616 Bacteria 11722
110 Ga0068852_100006451 3300005616 Bacteria 8476
111 Ga0068852_100012291 3300005616 Bacteria 6493
112 Ga0068859_100018042 3300005617 Bacteria 7091
113 Ga0068859_100057521 3300005617 Bacteria 3917
114 Ga0068864_100011802 3300005618 Bacteria 7215
115 Ga0068864_100131804 3300005618 Bacteria 2246
116 Ga0068864_100208844 3300005618 Unclassified 1797
117 Ga0068861_100047859 3300005719 Bacteria 3230
118 Ga0068870_10057968 3300005840 Bacteria 2072
119 Ga0068863_100002940 3300005841 Bacteria 16839
120 Ga0068863_100093830 3300005841 Unclassified 2848
121 Ga0068858_100016282 3300005842 Bacteria 6985
122 Ga0081455_10190099 3300005937 Bacteria 1547
123 Ga0070717_10007465 3300006028 Bacteria 8116
124 Ga0070717_10027321 3300006028 Bacteria 4561
125 Ga0070716_100016413 3300006173 Bacteria 3821
126 Ga0070712_100002702 3300006175 Bacteria 10954
127 Ga0097621_100126371 3300006237 Bacteria 2172
128 Ga0068871_100022087 3300006358 Bacteria 4903
129 Ga0075430_100160723 3300006846 Unclassified 1870
130 Ga0075431_100000893 3300006847 Bacteria 26334
131 Ga0075429_100012458 3300006880 Bacteria 7378
132 Ga0097620_100018040 3300006931 Bacteria 7091
133 Ga0097620_100057520 3300006931 Bacteria 3917
134 Ga0075435_100128262 3300007076 Bacteria 2121
135 Ga0105240_10079129 3300009093 Bacteria 4046
136 Ga0105240_10238549 3300009093 Unclassified 2109
137 Ga0111539_10353122 3300009094 Bacteria 1711
138 Ga0105245_10001263 3300009098 Bacteria 22843
139 Ga0105245_10008420 3300009098 Bacteria 9007
140 Ga0105245_10032465 3300009098 Bacteria 4623
141 Ga0105242_10000244 3300009176 Bacteria 42844
142 Ga0105242_10040279 3300009176 Bacteria 3765
143 Ga0105248_10003744 3300009177 Bacteria 16866
144 Ga0105248_10008649 3300009177 Bacteria 11183
145 Ga0105248_10033317 3300009177 Bacteria 5754
146 Ga0105248_10083346 3300009177 Unclassified 3597
147 Ga0105237_10123504 3300009545 Bacteria 2583
148 Ga0105237_10282233 3300009545 Unclassified 1663
149 Ga0105238_10000230 3300009551 Bacteria 62396
150 Ga0105238_10020729 3300009551 Bacteria 6694
151 Ga0105238_10047540 3300009551 Bacteria 4325
152 Ga0105249_10244280 3300009553 Bacteria 1776
153 Ga0105239_10005422 3300010375 Bacteria 14966
154 Ga0105246_10000460 3300011119 Bacteria 21843
155 Ga0157373_10140337 3300013100 Unclassified 1699
156 Ga0157371_10003766 3300013102 Bacteria 13573
157 Ga0157371_10058401 3300013102 Bacteria 2736
158 Ga0157370_10014583 3300013104 Bacteria 8030
159 Ga0157370_10031546 3300013104 Bacteria 5181
160 Ga0157370_10167384 3300013104 Bacteria 2043
161 Ga0157369_10024886 3300013105 Bacteria 6652
162 Ga0157369_10033262 3300013105 Bacteria 5667
163 Ga0157369_10041294 3300013105 Bacteria 5036
164 Ga0157369_10050278 3300013105 Unclassified 4515
165 Ga0157369_10115417 3300013105 Bacteria 2851
166 Ga0157374_10002584 3300013296 Bacteria 15259
167 Ga0163162_10088761 3300013306 Unclassified 3171
168 Ga0157372_10000924 3300013307 Bacteria 32003
169 Ga0157372_10001367 3300013307 Bacteria 26391
170 Ga0157372_10001441 3300013307 Bacteria 25726
171 Ga0157372_10001750 3300013307 Bacteria 23536
172 Ga0157372_10004806 3300013307 Bacteria 14356
173 Ga0157372_10006014 3300013307 Bacteria 12890
174 Ga0157372_10011749 3300013307 Bacteria 9325
175 Ga0157372_10020962 3300013307 Bacteria 7055
176 Ga0157375_10006752 3300013308 Bacteria 9993
177 Ga0157375_10145575 3300013308 Unclassified 2500
178 Ga0163163_10014687 3300014325 Bacteria 7201
179 Ga0157377_10000711 3300014745 Bacteria 13744
180 Ga0157376_10002554 3300014969 Bacteria 12355
181 Ga0207699_10000060 3300025906 Bacteria 90017
182 Ga0207699_10001658 3300025906 Bacteria 10555
183 Ga0207699_10057276 3300025906 Bacteria 2326
184 Ga0207645_10042072 3300025907 Unclassified 2923
185 Ga0207643_10032866 3300025908 Bacteria 2900
186 Ga0207705_10000624 3300025909 Bacteria 29577
187 Ga0207705_10001819 3300025909 Bacteria 16800
188 Ga0207705_10003387 3300025909 Bacteria 12125
189 Ga0207684_10100713 3300025910 Bacteria 2469
190 Ga0207654_10022137 3300025911 Unclassified 3387
191 Ga0207707_10002086 3300025912 Bacteria 18092
192 Ga0207707_10023917 3300025912 Bacteria 5341
193 Ga0207707_10074233 3300025912 Bacteria 2966
194 Ga0207707_10080722 3300025912 Bacteria 2840
195 Ga0207695_10001133 3300025913 Bacteria 46228
196 Ga0207695_10053988 3300025913 Bacteria 4199
197 Ga0207693_10002676 3300025915 Bacteria 15470
198 Ga0207660_10000921 3300025917 Bacteria 19413
199 Ga0207660_10013775 3300025917 Bacteria 5307
200 Ga0207660_10022849 3300025917 Bacteria 4217
201 Ga0207662_10018035 3300025918 Bacteria 3998
202 Ga0207662_10048575 3300025918 Unclassified 2514
203 Ga0207657_10000851 3300025919 Bacteria 32255
204 Ga0207657_10059729 3300025919 Bacteria 3274
205 Ga0207649_10003777 3300025920 Bacteria 8260
206 Ga0207649_10068657 3300025920 Unclassified 2254
207 Ga0207652_10000424 3300025921 Bacteria 43863
208 Ga0207652_10011063 3300025921 Bacteria 7273
209 Ga0207652_10032360 3300025921 Bacteria 4395
210 Ga0207652_10114092 3300025921 Bacteria 2399
211 Ga0207652_10171805 3300025921 Bacteria 1945
212 Ga0207646_10011208 3300025922 Bacteria 8703
213 Ga0207646_10204451 3300025922 Bacteria 1784
214 Ga0207694_10000087 3300025924 Bacteria 107288
215 Ga0207687_10007134 3300025927 Bacteria 7369
216 Ga0207687_10075690 3300025927 Bacteria 2416
217 Ga0207700_10002455 3300025928 Bacteria 10640
218 Ga0207700_10056978 3300025928 Bacteria 2944
219 Ga0207700_10064105 3300025928 Bacteria 2798
220 Ga0207664_10020990 3300025929 Bacteria 4848
221 Ga0207664_10087719 3300025929 Bacteria 2544
222 Ga0207664_10121969 3300025929 Bacteria 2183
223 Ga0207644_10129826 3300025931 Bacteria 1928
224 Ga0207690_10003326 3300025932 Bacteria 9621
225 Ga0207706_10002263 3300025933 Bacteria 18796
226 Ga0207706_10007563 3300025933 Bacteria 10051
227 Ga0207706_10055235 3300025933 Bacteria 3503
228 Ga0207665_10009819 3300025939 Bacteria 6285
229 Ga0207691_10014099 3300025940 Bacteria 7626
230 Ga0207711_10088852 3300025941 Bacteria 2714
231 Ga0207711_10206091 3300025941 Bacteria 1796
232 Ga0207689_10001074 3300025942 Bacteria 26358
233 Ga0207689_10034819 3300025942 Bacteria 4182
234 Ga0207689_10107374 3300025942 Bacteria 2294
235 Ga0207661_10000269 3300025944 Bacteria 33542
236 Ga0207661_10005360 3300025944 Bacteria 9034
237 Ga0207661_10100206 3300025944 Bacteria 2431
238 Ga0207661_10319800 3300025944 Bacteria 1395
239 Ga0207679_10001469 3300025945 Bacteria 14776
240 Ga0207679_10023858 3300025945 Bacteria 4188
241 Ga0207679_10078460 3300025945 Bacteria 2515
242 Ga0207679_10102478 3300025945 Bacteria 2241
243 Ga0207667_10027535 3300025949 Bacteria 6184
244 Ga0207667_10033636 3300025949 Bacteria 5511
245 Ga0207667_10068496 3300025949 Bacteria 3695
246 Ga0207651_10150673 3300025960 Unclassified 1810
247 Ga0207668_10248677 3300025972 Unclassified 1443
248 Ga0207658_10099174 3300025986 Bacteria 2278
249 Ga0207677_10041265 3300026023 Bacteria 3050
250 Ga0207702_10015534 3300026078 Bacteria 6302
251 Ga0207702_10015988 3300026078 Bacteria 6213
252 Ga0207702_10016506 3300026078 Bacteria 6111
253 Ga0207702_10120665 3300026078 Bacteria 2346
254 Ga0207641_10012088 3300026088 Bacteria 7080
255 Ga0207676_10025039 3300026095 Unclassified 4425
256 Ga0207676_10027574 3300026095 Bacteria 4231
257 Ga0207676_10087974 3300026095 Bacteria 2542
258 Ga0207674_10000033 3300026116 Bacteria 142149
259 Ga0207674_10024816 3300026116 Bacteria 6400
260 Ga0207674_10109364 3300026116 Bacteria 2740
261 Ga0207674_10269901 3300026116 Bacteria 1649
262 Ga0207675_100020316 3300026118 Bacteria 6193
263 Ga0207675_100142557 3300026118 Bacteria 2277
264 Ga0207683_10147372 3300026121 Unclassified 2123
265 Ga0207698_10003476 3300026142 Bacteria 9494
266 Ga0207698_10085631 3300026142 Bacteria 2560
267 Ga0207698_10095430 3300026142 Bacteria 2448
268 Ga0268264_10112564 3300028381 Bacteria 2386
269 Ga0265327_10010953 3300031251 Bacteria 6309
270 Ga0307408_100003571 3300031548 Bacteria 10601
271 Ga0307408_100107810 3300031548 Bacteria 2134
272 Ga0307408_100151667 3300031548 Bacteria 1830
273 Ga0265314_10017500 3300031711 Bacteria 5625
274 Ga0316576_10124268 3300031727 Bacteria 1938
275 Ga0307405_10001426 3300031731 Bacteria 10056
276 Ga0307405_10006847 3300031731 Bacteria 5650
277 Ga0307413_10002174 3300031824 Bacteria 7877
278 Ga0307413_10006193 3300031824 Bacteria 5435
279 Ga0307413_10011413 3300031824 Bacteria 4367
280 Ga0307413_10013478 3300031824 Bacteria 4112
281 Ga0307410_10020248 3300031852 Bacteria 4065
282 Ga0307410_10053113 3300031852 Bacteria 2740
283 Ga0307406_10070218 3300031901 Bacteria 2293
284 Ga0307406_10084475 3300031901 Unclassified 2120
285 Ga0307407_10010602 3300031903 Bacteria 4354
286 Ga0307412_10020358 3300031911 Bacteria 4037
287 Ga0307412_10148920 3300031911 Bacteria 1724
288 Ga0307409_100011318 3300031995 Bacteria 5615
289 Ga0307416_100035799 3300032002 Bacteria 3797
290 Ga0307414_10042444 3300032004 Bacteria 3090
291 Ga0307414_10066616 3300032004 Bacteria 2575
292 Ga0307411_10008033 3300032005 Bacteria 5434
293 Ga0307411_10010755 3300032005 Bacteria 4896
294 Ga0307411_10076787 3300032005 Bacteria 2284
295 Ga0307415_100005654 3300032126 Bacteria 6658
296 Ga0307415_100096327 3300032126 Bacteria 2156
297 Ga0316583_10000023 3300032133 Bacteria 28562
298 Ga0316583_10003325 3300032133 Bacteria 5661
299 Ga0316583_10011821 3300032133 Bacteria 3149
300 Ga0373930_0008243 3300034816 Bacteria 1820
301 Ga0373959_0004299 3300034820 Bacteria 2291
302 Ga0373934_0001179 3300035086 Bacteria 9515
303 Ga0373939_0025674 3300035114 Bacteria 1654
304 Ga0373945_0047923 3300035116 Bacteria 1564
305 Ga0373956_0000447 3300035119 Bacteria 16832
306 Ga0373957_0005385 3300035120 Bacteria 3965
307 Ga0373957_0013268 3300035120 Bacteria 2792
308 Ga0373943_0001051 3300035170 Bacteria 12258
309 Ga0373946_0003191 3300035171 Bacteria 5813
310 Ga0373955_0000833 3300035172 Bacteria 13224
311 Ga0373955_0005353 3300035172 Bacteria 5763
312 Ga0316574_0007302 3300035398 Bacteria 6048
313 Ga0373924_0003030 3300035410 Bacteria 5727
314 Ga0373931_0115279 3300035691 Bacteria 1529
315 Ga0373935_0040499 3300035692 Bacteria 2924
316 Ga0373927_0003581 3300035695 Bacteria 11081
317 Ga0373933_0000091 3300035724 Bacteria 56608
318 Ga0373947_0037438 3300035725 Bacteria 2879
319 Ga0373947_0040782 3300035725 Bacteria 2766
320 Ga0373937_0000100 3300036401 Bacteria 81162
321 Ga0373937_0000104 3300036401 Bacteria 80334
322 Ga0316582_0040334 3300036647 Bacteria 2913
323 Ga0316584_0012753 3300036712 Bacteria 5932
324 Ga0316584_0170233 3300036712 Bacteria 1616
325 Ga0373925_0002770 3300037068 Bacteria 13848
326 Ga0395899_0009388 3300037312 Bacteria 7512
327 Ga0395905_0001459 3300037471 Bacteria 28357
328 Ga0436364_1232901 3300037853 Bacteria 2909
329 Ga0395901_0075255 3300038443 Bacteria 3522
330 Ga0436365_0484769 3300039437 Bacteria 1415
331 Ga0436365_1779466 3300039437 Bacteria 5328
332 Ga0451800_1014632 3300041459 Bacteria 1704
333 Ga0451577_0002940 3300042876 Bacteria 19523
334 Ga0451577_0018319 3300042876 Bacteria 6452
335 Ga0451577_0068193 3300042876 Unclassified 3173
336 Ga0451577_0125630 3300042876 Bacteria 2298
337 Ga0451577_0266849 3300042876 Unclassified 1550
338 Ga0466969_0038629 3300044656 Bacteria 2401
339 Ga0466966_0117203 3300044684 Bacteria 1638
340 Ga0453684_0000455 3300044712 Bacteria 165080
341 Ga0453684_0145642 3300044712 Bacteria 2822
342 Ga0466959_0040722 3300045049 Bacteria 3432
343 Ga0451576_0014340 3300045051 Bacteria 8827
344 Ga0466967_0027317 3300045976 Unclassified 4746
345 Ga0495592_0000577 3300046454 Bacteria 25994
346 Ga0495603_0003025 3300046455 Bacteria 9961
347 Ga0495629_0009119 3300046459 Bacteria 7267
348 Ga0495629_0021997 3300046459 Unclassified 4549
349 Ga0495651_0000145 3300046462 Bacteria 51784
350 Ga0495651_0103928 3300046462 Unclassified 2110
351 Ga0495653_0000064 3300046463 Bacteria 92950
352 Ga0495580_0015877 3300046472 Bacteria 5667
353 Ga0495582_0015797 3300046473 Bacteria 4139
354 Ga0495582_0015907 3300046473 Unclassified 4124
355 Ga0495639_0008264 3300046475 Bacteria 4468
356 Ga0495639_0061131 3300046475 Bacteria 1727
357 Ga0495594_0006081 3300046499 Bacteria 6203
358 Ga0495594_0027443 3300046499 Bacteria 3068
359 Ga0495594_0088139 3300046499 Unclassified 1737
360 Ga0495608_0058921 3300046511 Bacteria 2530
361 Ga0495628_0150822 3300046516 Unclassified 1771
362 Ga0495630_0004107 3300046517 Bacteria 10190
363 Ga0495630_0006324 3300046517 Bacteria 8414
364 Ga0495643_0000252 3300046522 Bacteria 78817
365 Ga0495652_0005445 3300046529 Bacteria 11993
366 Ga0495652_0130427 3300046529 Unclassified 1991
367 Ga0495665_0011955 3300046531 Bacteria 4699
368 Ga0495665_0029014 3300046531 Unclassified 2965
369 Ga0495665_0058251 3300046531 Archaea 2040
370 Ga0495586_0025341 3300046535 Bacteria 3173
371 Ga0495587_0000530 3300046536 Bacteria 26408
372 Ga0495587_0000771 3300046536 Bacteria 21343
373 Ga0495645_0000468 3300046543 Bacteria 27917
374 Ga0495645_0006256 3300046543 Bacteria 8249
375 Ga0495645_0086502 3300046543 Bacteria 2243
376 Ga0495645_0191112 3300046543 Bacteria 1395
377 Ga0495667_0039398 3300046559 Unclassified 3142
378 Ga0495635_0000027 3300046663 Bacteria 123782
379 Ga0495588_0026279 3300046674 Bacteria 2905
380 Ga0495657_0000129 3300046675 Bacteria 67136
381 Ga0495599_0008102 3300046678 Bacteria 6381
382 Ga0495599_0024719 3300046678 Bacteria 3756
383 Ga0495623_0002266 3300046679 Bacteria 12803
384 Ga0495623_0014607 3300046679 Bacteria 5079
385 Ga0495646_0002441 3300046680 Bacteria 11411
386 Ga0495658_0000078 3300046683 Bacteria 48561
387 Ga0495658_0095739 3300046683 Bacteria 1765
388 Ga0495613_0005754 3300046689 Bacteria 9284
389 Ga0495600_0000038 3300046809 Bacteria 77979
390 Ga0495581_0001347 3300047315 Bacteria 13576
391 Ga0495581_0011155 3300047315 Bacteria 5193
392 Ga0495581_0018663 3300047315 Bacteria 4027
393 Ga0495604_0000214 3300047317 Bacteria 53111
394 Ga0495674_0001571 3300047319 Bacteria 22378
395 Ga0495674_0038675 3300047319 Bacteria 4281
396 Ga0495680_0007722 3300047322 Bacteria 9825
397 Ga0495675_0000482 3300047444 Bacteria 26042
398 Ga0495675_0004601 3300047444 Bacteria 8372
399 Ga0495684_0001431 3300047471 Bacteria 19134
400 Ga0495684_0006971 3300047471 Bacteria 8776
401 Ga0495593_0074310 3300047673 Bacteria 1763
402 Ga0495602_0006927 3300048088 Bacteria 11905
403 Ga0496108_0025647 3300048911 Bacteria 4860
404 Ga0496112_0000317 3300048915 Bacteria 31017
405 Ga0496113_0047830 3300048916 Bacteria 3180
406 Ga0501033_0007793 3300049570 Bacteria 8296
407 Ga0501034_0308376 3300049571 Bacteria 1518
408 Ga0501036_0014332 3300049572 Bacteria 6599
409 Ga0501036_0169560 3300049572 Bacteria 1839
410 Ga0501047_0120927 3300049581 Unclassified 2501
411 Ga0501048_0055675 3300049582 Bacteria 2807
412 Ga0501070_0080736 3300049586 Bacteria 2691
413 Ga0501070_0083346 3300049586 Bacteria 2647
414 Ga0501071_0130937 3300049587 Bacteria 1863
415 Ga0501072_0006874 3300049588 Bacteria 8636
416 Ga0501073_0161308 3300049589 Bacteria 1553
417 Ga0501075_0058385 3300049591 Bacteria 2906
418 Ga0501075_0168004 3300049591 Bacteria 1673
419 Ga0501076_0071920 3300049592 Bacteria 2767
420 Ga0501077_0006127 3300049593 Bacteria 7344
421 Ga0501080_0214319 3300049742 Bacteria 1764
422 Ga0501081_0176921 3300049743 Bacteria 1542
423 Ga0501035_0073572 3300049822 Bacteria 3024
424 Ga0501044_0020287 3300049823 Bacteria 7093
425 Ga0501045_0022929 3300049824 Bacteria 4473
426 nmdc:mga09592_5078_c1 3300050508 Bacteria 10679
427 nmdc:mga0qj67_141175_c1 3300050509 Unclassified 1953
428 nmdc:mga06r32_2224_c1 3300050510 Bacteria 17373
429 nmdc:mga0n895_222661_c1 3300050512 Bacteria 1915
430 Ga0495595_0026543 3300053084 Unclassified 2574
431 Ga0500628_000322 3300053129 Bacteria 9183
432 Ga0501084_0024220 3300054114 Bacteria 5063
433 2883577618 2883577096 Bacteria 4709178
434 2929201578 2929199973 Bacteria 7260745
435 8055913270 8055909800 Bacteria 7278581
436 Ga0466959_0017481
437 Ga0065712_10096447
438 Ga0070658_10004600
439 Ga0070658_10009445
440 Ga0070658_10013032
441 Ga0070658_10298290
442 Ga0070683_100000547
443 Ga0070683_100001913
444 Ga0070683_100002220
445 Ga0070683_100010472
446 Ga0070683_100016485
447 Ga0070683_100016834
448 Ga0070683_100025395
449 Ga0070683_100032987
450 Ga0070690_100026995
451 Ga0070670_100001370
452 Ga0068869_100000589
453 Ga0068869_100127077
454 Ga0070680_100000169
455 Ga0070680_100002372
456 Ga0070680_100010513
457 Ga0070680_100018546
458 Ga0070682_100000225
459 Ga0070660_100014156
460 Ga0070660_100039442
461 Ga0070660_100094476
462 Ga0070689_100002443
463 Ga0070689_100025083
464 Ga0070689_100074246
465 Ga0070691_10005094
466 Ga0070687_100120671
467 Ga0070661_100004124
468 Ga0070661_100065739
469 Ga0070692_10005342
470 Ga0070669_100235997
471 Ga0070675_100010371
472 Ga0070675_100161710
473 Ga0070671_100080820
474 Ga0070673_100223104
475 Ga0070688_100009287
476 Ga0070688_100024019
477 Ga0070688_100052112
478 Ga0070688_100118559
479 Ga0070659_100000342
480 Ga0070667_100223200
481 Ga0070709_10000052
482 Ga0070709_10003435
483 Ga0070709_10022467
484 Ga0070714_100005162
485 Ga0070714_100013965
486 Ga0070714_100016757
487 Ga0070713_100000284
488 Ga0070713_100143481
489 Ga0070710_10032148
490 Ga0070711_100030017
491 Ga0070711_100159643
492 Ga0070708_100000116
493 Ga0070708_100093762
494 Ga0070708_100203484
495 Ga0070663_100105502
496 Ga0070662_100008341
497 Ga0070662_100037182
498 Ga0070681_10000161
499 Ga0070681_10000358
500 Ga0070681_10001602
501 Ga0070681_10025564
502 Ga0070681_10076646
503 Ga0070681_10133840
504 Ga0070685_10000679
505 Ga0070685_10005958
506 Ga0070685_10038477
507 Ga0070706_100070384
508 Ga0070706_100110665
509 Ga0070707_100053015
510 Ga0070707_100243518
511 Ga0070698_100042228
512 Ga0070698_100051972
513 Ga0070699_100006030
514 Ga0070679_100000080
515 Ga0070679_100000232
516 Ga0070679_100003238
517 Ga0070679_100007955
518 Ga0070679_100045576
519 Ga0070679_100054258
520 Ga0070684_100008557
521 Ga0070684_100012236
522 Ga0070684_100054124
523 Ga0070684_100099047
524 Ga0070684_100146926
525 Ga0070672_100022326
526 Ga0070686_100000092
527 Ga0070696_100058379
528 Ga0070693_100005827
529 Ga0070693_100062100
530 Ga0068855_100001632
531 Ga0068855_100003737
532 Ga0068855_100029263
533 Ga0068855_100097946
534 Ga0070664_100001051
535 Ga0070664_100010539
536 Ga0070664_100026050
537 Ga0068857_100087080
538 Ga0068857_100130413
539 Ga0068856_100008346
540 Ga0068856_100020680
541 Ga0068856_100021047
542 Ga0068856_100072118
543 Ga0070702_100006866
544 Ga0068852_100003009
545 Ga0068852_100006451
546 Ga0068852_100012291
547 Ga0068859_100018042
548 Ga0068859_100057521
549 Ga0068864_100011802
550 Ga0068864_100131804
551 Ga0068864_100208844
552 Ga0068861_100047859
553 Ga0068870_10057968
554 Ga0068863_100002940
555 Ga0068863_100093830
556 Ga0068858_100016282
557 Ga0081455_10190099
558 Ga0070717_10007465
559 Ga0070717_10027321
560 Ga0070716_100016413
561 Ga0070712_100002702
562 Ga0097621_100126371
563 Ga0068871_100022087
564 Ga0075430_100160723
565 Ga0075431_100000893
566 Ga0075429_100012458
567 Ga0097620_100018040
568 Ga0097620_100057520
569 Ga0075435_100128262
570 Ga0105240_10079129
571 Ga0105240_10238549
572 Ga0111539_10353122
573 Ga0105245_10001263
574 Ga0105245_10008420
575 Ga0105245_10032465
576 Ga0105242_10000244
577 Ga0105242_10040279
578 Ga0105248_10003744
579 Ga0105248_10008649
580 Ga0105248_10033317
581 Ga0105248_10083346
582 Ga0105237_10123504
583 Ga0105237_10282233
584 Ga0105238_10000230
585 Ga0105238_10020729
586 Ga0105238_10047540
587 Ga0105249_10244280
588 Ga0105239_10005422
589 Ga0105246_10000460
590 Ga0157373_10140337
591 Ga0157371_10003766
592 Ga0157371_10058401
593 Ga0157370_10014583
594 Ga0157370_10031546
595 Ga0157370_10167384
596 Ga0157369_10024886
597 Ga0157369_10033262
598 Ga0157369_10041294
599 Ga0157369_10050278
600 Ga0157369_10115417
601 Ga0157374_10002584
602 Ga0163162_10088761
603 Ga0157372_10000924
604 Ga0157372_10001367
605 Ga0157372_10001441
606 Ga0157372_10001750
607 Ga0157372_10004806
608 Ga0157372_10006014
609 Ga0157372_10011749
610 Ga0157372_10020962
611 Ga0157375_10006752
612 Ga0157375_10145575
613 Ga0163163_10014687
614 Ga0157377_10000711
615 Ga0157376_10002554
616 Ga0207699_10000060
617 Ga0207699_10001658
618 Ga0207699_10057276
619 Ga0207645_10042072
620 Ga0207643_10032866
621 Ga0207705_10000624
622 Ga0207705_10001819
623 Ga0207705_10003387
624 Ga0207684_10100713
625 Ga0207654_10022137
626 Ga0207707_10002086
627 Ga0207707_10023917
628 Ga0207707_10074233
629 Ga0207707_10080722
630 Ga0207695_10001133
631 Ga0207695_10053988
632 Ga0207693_10002676
633 Ga0207660_10000921
634 Ga0207660_10013775
635 Ga0207660_10022849
636 Ga0207662_10018035
637 Ga0207662_10048575
638 Ga0207657_10000851
639 Ga0207657_10059729
640 Ga0207649_10003777
641 Ga0207649_10068657
642 Ga0207652_10000424
643 Ga0207652_10011063
644 Ga0207652_10032360
645 Ga0207652_10114092
646 Ga0207652_10171805
647 Ga0207646_10011208
648 Ga0207646_10204451
649 Ga0207694_10000087
650 Ga0207687_10007134
651 Ga0207687_10075690
652 Ga0207700_10002455
653 Ga0207700_10056978
654 Ga0207700_10064105
655 Ga0207664_10020990
656 Ga0207664_10087719
657 Ga0207664_10121969
658 Ga0207644_10129826
659 Ga0207690_10003326
660 Ga0207706_10002263
661 Ga0207706_10007563
662 Ga0207706_10055235
663 Ga0207665_10009819
664 Ga0207691_10014099
665 Ga0207711_10088852
666 Ga0207711_10206091
667 Ga0207689_10001074
668 Ga0207689_10034819
669 Ga0207689_10107374
670 Ga0207661_10000269
671 Ga0207661_10005360
672 Ga0207661_10100206
673 Ga0207661_10319800
674 Ga0207679_10001469
675 Ga0207679_10023858
676 Ga0207679_10078460
677 Ga0207679_10102478
678 Ga0207667_10027535
679 Ga0207667_10033636
680 Ga0207667_10068496
681 Ga0207651_10150673
682 Ga0207668_10248677
683 Ga0207658_10099174
684 Ga0207677_10041265
685 Ga0207702_10015534
686 Ga0207702_10015988
687 Ga0207702_10016506
688 Ga0207702_10120665
689 Ga0207641_10012088
690 Ga0207676_10025039
691 Ga0207676_10027574
692 Ga0207676_10087974
693 Ga0207674_10000033
694 Ga0207674_10024816
695 Ga0207674_10109364
696 Ga0207674_10269901
697 Ga0207675_100020316
698 Ga0207675_100142557
699 Ga0207683_10147372
700 Ga0207698_10003476
701 Ga0207698_10085631
702 Ga0207698_10095430
703 Ga0268264_10112564
704 Ga0265327_10010953
705 Ga0307408_100003571
706 Ga0307408_100107810
707 Ga0307408_100151667
708 Ga0265314_10017500
709 Ga0316576_10124268
710 Ga0307405_10001426
711 Ga0307405_10006847
712 Ga0307413_10002174
713 Ga0307413_10006193
714 Ga0307413_10011413
715 Ga0307413_10013478
716 Ga0307410_10020248
717 Ga0307410_10053113
718 Ga0307406_10070218
719 Ga0307406_10084475
720 Ga0307407_10010602
721 Ga0307412_10020358
722 Ga0307412_10148920
723 Ga0307409_100011318
724 Ga0307416_100035799
725 Ga0307414_10042444
726 Ga0307414_10066616
727 Ga0307411_10008033
728 Ga0307411_10010755
729 Ga0307411_10076787
730 Ga0307415_100005654
731 Ga0307415_100096327
732 Ga0316583_10000023
733 Ga0316583_10003325
734 Ga0316583_10011821
735 Ga0373930_0008243
736 Ga0373959_0004299
737 Ga0373934_0001179
738 Ga0373939_0025674
739 Ga0373945_0047923
740 Ga0373956_0000447
741 Ga0373957_0005385
742 Ga0373957_0013268
743 Ga0373943_0001051
744 Ga0373946_0003191
745 Ga0373955_0000833
746 Ga0373955_0005353
747 Ga0316574_0007302
748 Ga0373924_0003030
749 Ga0373931_0115279
750 Ga0373935_0040499
751 Ga0373927_0003581
752 Ga0373933_0000091
753 Ga0373947_0037438
754 Ga0373947_0040782
755 Ga0373937_0000100
756 Ga0373937_0000104
757 Ga0316582_0040334
758 Ga0316584_0012753
759 Ga0316584_0170233
760 Ga0373925_0002770
761 Ga0395899_0009388
762 Ga0395905_0001459
763 Ga0436364_1232901
764 Ga0395901_0075255
765 Ga0436365_0484769
766 Ga0436365_1779466
767 Ga0451800_1014632
768 Ga0451577_0002940
769 Ga0451577_0018319
770 Ga0451577_0068193
771 Ga0451577_0125630
772 Ga0451577_0266849
773 Ga0466969_0038629
774 Ga0466966_0117203
775 Ga0453684_0000455
776 Ga0453684_0145642
777 Ga0466959_0040722
778 Ga0451576_0014340
779 Ga0466967_0027317
780 Ga0495592_0000577
781 Ga0495603_0003025
782 Ga0495629_0009119
783 Ga0495629_0021997
784 Ga0495651_0000145
785 Ga0495651_0103928
786 Ga0495653_0000064
787 Ga0495580_0015877
788 Ga0495582_0015797
789 Ga0495582_0015907
790 Ga0495639_0008264
791 Ga0495639_0061131
792 Ga0495594_0006081
793 Ga0495594_0027443
794 Ga0495594_0088139
795 Ga0495608_0058921
796 Ga0495628_0150822
797 Ga0495630_0004107
798 Ga0495630_0006324
799 Ga0495643_0000252
800 Ga0495652_0005445
801 Ga0495652_0130427
802 Ga0495665_0011955
803 Ga0495665_0029014
804 Ga0495665_0058251
805 Ga0495586_0025341
806 Ga0495587_0000530
807 Ga0495587_0000771
808 Ga0495645_0000468
809 Ga0495645_0006256
810 Ga0495645_0086502
811 Ga0495645_0191112
812 Ga0495667_0039398
813 Ga0495635_0000027
814 Ga0495588_0026279
815 Ga0495657_0000129
816 Ga0495599_0008102
817 Ga0495599_0024719
818 Ga0495623_0002266
819 Ga0495623_0014607
820 Ga0495646_0002441
821 Ga0495658_0000078
822 Ga0495658_0095739
823 Ga0495613_0005754
824 Ga0495600_0000038
825 Ga0495581_0001347
826 Ga0495581_0011155
827 Ga0495581_0018663
828 Ga0495604_0000214
829 Ga0495674_0001571
830 Ga0495674_0038675
831 Ga0495680_0007722
832 Ga0495675_0000482
833 Ga0495675_0004601
834 Ga0495684_0001431
835 Ga0495684_0006971
836 Ga0495593_0074310
837 Ga0495602_0006927
838 Ga0496108_0025647
839 Ga0496112_0000317
840 Ga0496113_0047830
841 Ga0501033_0007793
842 Ga0501034_0308376
843 Ga0501036_0014332
844 Ga0501036_0169560
845 Ga0501047_0120927
846 Ga0501048_0055675
847 Ga0501070_0080736
848 Ga0501070_0083346
849 Ga0501071_0130937
850 Ga0501072_0006874
851 Ga0501073_0161308
852 Ga0501075_0058385
853 Ga0501075_0168004
854 Ga0501076_0071920
855 Ga0501077_0006127
856 Ga0501080_0214319
857 Ga0501081_0176921
858 Ga0501035_0073572
859 Ga0501044_0020287
860 Ga0501045_0022929
861 nmdc:mga09592_5078_c1
862 nmdc:mga0qj67_141175_c1
863 nmdc:mga06r32_2224_c1
864 nmdc:mga0n895_222661_c1
865 Ga0495595_0026543
866 Ga0500628_000322
867 Ga0501084_0024220
868 2883577618
869 2929201578
870 8055913270

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

37

384

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hcl-assembly2.cif.gz_B crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution 0.8665 16 397
7ckr-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate bay-8002 in the outward-open conformation. 0.8653 16 410
6zgu-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution 0.8625 19 397
6g9x-assembly2.cif.gz_B crystal structure of a mfs transporter at 2.54 angstroem resolution 0.8597 16 397
7ckr-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate bay-8002 in the outward-open conformation. 0.859 16 410
ID Description Score Start End Superfamily
af_P77589_11_202_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9105 14 195 1.20.1250.20
af_A0A1D6L8U4_23_213_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9055 18 193 1.20.1250.20
af_P0AA76_9_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8989 12 193 1.20.1250.20
af_Q23514_31_242_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8945 11 195 1.20.1250.20
af_Q9P2U7_60_265_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8916 13 195 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A538U115-F1-model_v4 MFS transporter 0.9797 14 196 GO:0016020
GO:0022857
AF-A0A2V7W8G6-F1-model_v4 MFS transporter 0.9704 15 400 GO:0005886
GO:0022857
AF-A0A7W1KCH6-F1-model_v4 MFS transporter 0.9663 111 400 GO:0005886
GO:0022857
AF-A0A2V7XX11-F1-model_v4 MFS transporter 0.9662 31 400 GO:0005886
GO:0022857
AF-A0A2V7YID7-F1-model_v4 MFS transporter 0.9647 31 400 GO:0005886
GO:0022857

Map