F443303

General Info

Members Datasets Scaffolds Average Seq Length
435 229 870 79

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_102494622|Ga0075434_1024946221
Length 83
Sequence MDAPPPPLLSVEPKDGIWSVNERGPTRIAIAYFPSKWGALKHAVKVAKAKGRARVAVLELGGVVQLSRDYASPGSKSSSVEVP

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
136 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
137 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
138 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
139 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
140 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
143 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
144 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
145 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
147 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
154 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
155 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
162 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
163 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
164 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
165 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
166 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
208 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
209 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
210 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 1.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 18.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_102494622 3300006871 Unclassified 518
2 JGI24742J22300_10044262 3300002244 Unclassified 797
3 Ga0007429J51699_1056240 3300003579 Bacteria 594
4 Ga0065707_10147321 3300005295 Bacteria 1698
5 Ga0065707_10243531 3300005295 Bacteria 1148
6 Ga0070676_10106722 3300005328 Bacteria 1738
7 Ga0070690_100030072 3300005330 Bacteria 3373
8 Ga0070690_100061312 3300005330 Bacteria 2423
9 Ga0070690_100215238 3300005330 Bacteria 1343
10 Ga0070690_100943978 3300005330 Bacteria 677
11 Ga0068869_100000253 3300005334 Bacteria 28120
12 Ga0068869_101393722 3300005334 Bacteria 620
13 Ga0070680_100009979 3300005336 Bacteria 7314
14 Ga0070680_100193418 3300005336 Bacteria 1714
15 Ga0070680_100300450 3300005336 Unclassified 1361
16 Ga0070680_101380493 3300005336 Unclassified 610
17 Ga0070682_101315346 3300005337 Bacteria 615
18 Ga0068868_100000617 3300005338 Bacteria 23932
19 Ga0070689_100006922 3300005340 Bacteria 7894
20 Ga0070689_100068623 3300005340 Bacteria 2765
21 Ga0070691_10000525 3300005341 Bacteria 14449
22 Ga0070691_10285971 3300005341 Unclassified 896
23 Ga0070687_100000041 3300005343 Bacteria 40926
24 Ga0070687_100185238 3300005343 Unclassified 1250
25 Ga0070687_100268848 3300005343 Unclassified 1068
26 Ga0070687_100299227 3300005343 Bacteria 1020
27 Ga0070687_100464734 3300005343 Bacteria 845
28 Ga0070692_10000873 3300005345 Bacteria 10150
29 Ga0070692_10053716 3300005345 Bacteria 2102
30 Ga0070692_11340511 3300005345 Bacteria 515
31 Ga0070675_100320063 3300005354 Bacteria 1370
32 Ga0070675_100585021 3300005354 Bacteria 1012
33 Ga0070674_100469391 3300005356 Bacteria 1042
34 Ga0070673_100221284 3300005364 Bacteria 1638
35 Ga0070688_100137499 3300005365 Bacteria 1656
36 Ga0070688_100526517 3300005365 Bacteria 895
37 Ga0070659_101335969 3300005366 Unclassified 636
38 Ga0070703_10049051 3300005406 Bacteria 1343
39 Ga0070701_10002384 3300005438 Bacteria 7223
40 Ga0070701_10339615 3300005438 Bacteria 935
41 Ga0070701_10355961 3300005438 Bacteria 916
42 Ga0070701_10390333 3300005438 Bacteria 879
43 Ga0070705_100000248 3300005440 Bacteria 32002
44 Ga0070705_100001759 3300005440 Bacteria 11230
45 Ga0070705_100021170 3300005440 Bacteria 3455
46 Ga0070705_101689461 3300005440 Bacteria 535
47 Ga0070705_101843224 3300005440 Bacteria 514
48 Ga0070694_100002163 3300005444 Bacteria 11644
49 Ga0070694_100010791 3300005444 Bacteria 5649
50 Ga0070694_100036106 3300005444 Bacteria 3272
51 Ga0070694_100045893 3300005444 Bacteria 2930
52 Ga0070694_100048017 3300005444 Bacteria 2870
53 Ga0070694_100203829 3300005444 Bacteria 1476
54 Ga0070708_100157965 3300005445 Bacteria 2112
55 Ga0070678_101160681 3300005456 Bacteria 715
56 Ga0070678_102313960 3300005456 Unclassified 510
57 Ga0070662_101512866 3300005457 Bacteria 579
58 Ga0070681_10007233 3300005458 Bacteria 10831
59 Ga0070681_10135249 3300005458 Bacteria 2396
60 Ga0070681_10347775 3300005458 Bacteria 1393
61 Ga0070681_10798550 3300005458 Unclassified 861
62 Ga0068867_100000340 3300005459 Bacteria 30861
63 Ga0070685_11030254 3300005466 Bacteria 619
64 Ga0070707_102124165 3300005468 Bacteria 529
65 Ga0074259_10818005 3300005507 Bacteria 620
66 Ga0070699_100007776 3300005518 Bacteria 9319
67 Ga0070699_100011633 3300005518 Bacteria 7596
68 Ga0070699_100447312 3300005518 Bacteria 1171
69 Ga0070699_100515261 3300005518 Bacteria 1087
70 Ga0070679_100007193 3300005530 Bacteria 10395
71 Ga0070679_100021346 3300005530 Bacteria 6321
72 Ga0070679_100944789 3300005530 Bacteria 806
73 Ga0070679_101526555 3300005530 Unclassified 615
74 Ga0070697_100002757 3300005536 Bacteria 13527
75 Ga0070697_100132989 3300005536 Bacteria 2087
76 Ga0070697_100983706 3300005536 Unclassified 750
77 Ga0068853_102247143 3300005539 Unclassified 529
78 Ga0070686_100000518 3300005544 Bacteria 23071
79 Ga0070686_100109911 3300005544 Bacteria 1876
80 Ga0070686_100165047 3300005544 Unclassified 1562
81 Ga0070686_100340674 3300005544 Bacteria 1123
82 Ga0070686_101834497 3300005544 Bacteria 517
83 Ga0070695_100000745 3300005545 Bacteria 17422
84 Ga0070695_100006615 3300005545 Bacteria 6850
85 Ga0070695_100081489 3300005545 Bacteria 2141
86 Ga0070695_100153873 3300005545 Bacteria 1608
87 Ga0070695_100222686 3300005545 Bacteria 1360
88 Ga0070695_101043438 3300005545 Bacteria 667
89 Ga0070696_100010525 3300005546 Bacteria 6199
90 Ga0070696_100018926 3300005546 Bacteria 4662
91 Ga0070696_100116770 3300005546 Bacteria 1927
92 Ga0070696_100147435 3300005546 Unclassified 1724
93 Ga0070696_100922199 3300005546 Bacteria 726
94 Ga0070693_100000232 3300005547 Bacteria 25991
95 Ga0070693_100117859 3300005547 Bacteria 1643
96 Ga0070693_100334930 3300005547 Bacteria 1031
97 Ga0070704_100000019 3300005549 Bacteria 53845
98 Ga0070704_100013648 3300005549 Bacteria 5051
99 Ga0070704_100213453 3300005549 Unclassified 1565
100 Ga0070704_100714409 3300005549 Bacteria 890
101 Ga0068855_100005533 3300005563 Bacteria 15416
102 Ga0068857_100683604 3300005577 Bacteria 974
103 Ga0068857_101979404 3300005577 Unclassified 571
104 Ga0068856_100040747 3300005614 Bacteria 4562
105 Ga0070702_100000402 3300005615 Bacteria 15381
106 Ga0070702_100499891 3300005615 Bacteria 893
107 Ga0070702_101627755 3300005615 Unclassified 535
108 Ga0068859_100000745 3300005617 Bacteria 32803
109 Ga0068859_100270749 3300005617 Bacteria 1791
110 Ga0068859_100468354 3300005617 Bacteria 1356
111 Ga0068864_100508193 3300005618 Bacteria 1160
112 Ga0068866_10000614 3300005718 Bacteria 16287
113 Ga0068866_10393849 3300005718 Bacteria 892
114 Ga0068861_100003672 3300005719 Bacteria 10240
115 Ga0068861_101414741 3300005719 Unclassified 680
116 Ga0068870_10031982 3300005840 Bacteria 2670
117 Ga0068863_100881305 3300005841 Bacteria 895
118 Ga0068858_100025705 3300005842 Bacteria 5477
119 Ga0068860_100031868 3300005843 Bacteria 5068
120 Ga0068860_100429625 3300005843 Bacteria 1310
121 Ga0068862_100012243 3300005844 Bacteria 7092
122 Ga0081538_10351913 3300005981 Bacteria 533
123 Ga0081539_10004540 3300005985 Bacteria 15228
124 Ga0070717_10955882 3300006028 Unclassified 780
125 Ga0070716_100085961 3300006173 Unclassified 1891
126 Ga0070716_100212705 3300006173 Bacteria 1293
127 Ga0070712_100195260 3300006175 Unclassified 1586
128 Ga0097621_100000406 3300006237 Bacteria 30028
129 Ga0068871_100000953 3300006358 Bacteria 19344
130 Ga0068871_101911123 3300006358 Unclassified 564
131 Ga0075428_100024560 3300006844 Bacteria 6669
132 Ga0075430_100169761 3300006846 Bacteria 1815
133 Ga0075433_10001929 3300006852 Bacteria 15609
134 Ga0075433_10717815 3300006852 Unclassified 875
135 Ga0075434_100000254 3300006871 Bacteria 37644
136 Ga0075434_100000818 3300006871 Bacteria 24717
137 Ga0075434_101491269 3300006871 Bacteria 686
138 Ga0075429_100008921 3300006880 Bacteria 8716
139 Ga0068865_100000228 3300006881 Bacteria 31253
140 Ga0068865_101324157 3300006881 Bacteria 641
141 Ga0075436_100000149 3300006914 Bacteria 43158
142 Ga0075436_100000243 3300006914 Bacteria 34017
143 Ga0075436_100027493 3300006914 Bacteria 3914
144 Ga0075436_100032490 3300006914 Bacteria 3597
145 Ga0075436_100194649 3300006914 Bacteria 1435
146 Ga0097620_100000745 3300006931 Bacteria 32803
147 Ga0097620_100270762 3300006931 Bacteria 1791
148 Ga0097620_100468363 3300006931 Bacteria 1356
149 Ga0075435_100001280 3300007076 Bacteria 16160
150 Ga0075435_100001299 3300007076 Bacteria 16064
151 Ga0075435_100164836 3300007076 Bacteria 1868
152 Ga0075435_100174669 3300007076 Bacteria 1814
153 Ga0075435_100888991 3300007076 Unclassified 777
154 Ga0075435_101186784 3300007076 Bacteria 668
155 Ga0111539_10008534 3300009094 Bacteria 13017
156 Ga0111539_10103378 3300009094 Bacteria 3344
157 Ga0111539_10111897 3300009094 Bacteria 3203
158 Ga0111539_10149274 3300009094 Bacteria 2736
159 Ga0111539_10824314 3300009094 Bacteria 1079
160 Ga0111539_11503616 3300009094 Bacteria 781
161 Ga0105247_11058144 3300009101 Bacteria 637
162 Ga0114129_10003508 3300009147 Bacteria 22059
163 Ga0114129_10415530 3300009147 Bacteria 1770
164 Ga0114129_10509240 3300009147 Bacteria 1571
165 Ga0105246_10694058 3300011119 Bacteria 891
166 Ga0157315_1045668 3300012508 Bacteria 571
167 Ga0157374_10810335 3300013296 Bacteria 952
168 Ga0157372_10924717 3300013307 Unclassified 1011
169 Ga0157380_11962614 3300014326 Unclassified 647
170 Ga0157377_10068778 3300014745 Unclassified 2041
171 Ga0157377_11518833 3300014745 Bacteria 533
172 Ga0206356_10997736 3300020070 Unclassified 717
173 Ga0206356_11813329 3300020070 Bacteria 1362
174 Ga0206352_10411606 3300020078 Bacteria 877
175 Ga0206350_11081564 3300020080 Unclassified 968
176 Ga0207653_10083083 3300025885 Bacteria 1111
177 Ga0207653_10428782 3300025885 Unclassified 519
178 Ga0207642_10008122 3300025899 Bacteria 3584
179 Ga0207688_10168986 3300025901 Bacteria 1299
180 Ga0207688_10459680 3300025901 Bacteria 794
181 Ga0207680_10239391 3300025903 Bacteria 1250
182 Ga0207645_10221769 3300025907 Bacteria 1247
183 Ga0207643_10102268 3300025908 Bacteria 1681
184 Ga0207707_10003685 3300025912 Bacteria 13585
185 Ga0207707_10075236 3300025912 Bacteria 2946
186 Ga0207707_10339728 3300025912 Bacteria 1295
187 Ga0207707_11438154 3300025912 Unclassified 549
188 Ga0207693_10799020 3300025915 Bacteria 727
189 Ga0207660_10003316 3300025917 Bacteria 10515
190 Ga0207660_10263001 3300025917 Unclassified 1365
191 Ga0207660_10414179 3300025917 Bacteria 1086
192 Ga0207660_11558580 3300025917 Bacteria 533
193 Ga0207662_10000194 3300025918 Bacteria 28333
194 Ga0207662_10101728 3300025918 Bacteria 1781
195 Ga0207662_10405491 3300025918 Bacteria 925
196 Ga0207662_10562662 3300025918 Unclassified 790
197 Ga0207649_11684354 3300025920 Bacteria 502
198 Ga0207652_10009358 3300025921 Bacteria 7877
199 Ga0207652_10120849 3300025921 Bacteria 2330
200 Ga0207646_11036399 3300025922 Unclassified 724
201 Ga0207659_10806462 3300025926 Bacteria 806
202 Ga0207687_10002764 3300025927 Bacteria 11901
203 Ga0207706_11282474 3300025933 Bacteria 606
204 Ga0207686_10007546 3300025934 Bacteria 5856
205 Ga0207709_10000564 3300025935 Bacteria 31398
206 Ga0207670_10021108 3300025936 Bacteria 4013
207 Ga0207670_10322850 3300025936 Unclassified 1215
208 Ga0207670_10326724 3300025936 Bacteria 1208
209 Ga0207704_10001005 3300025938 Bacteria 12510
210 Ga0207665_10027573 3300025939 Bacteria 3752
211 Ga0207689_10000566 3300025942 Bacteria 35376
212 Ga0207689_10400112 3300025942 Bacteria 1145
213 Ga0207689_11521355 3300025942 Bacteria 558
214 Ga0207667_10058286 3300025949 Bacteria 4051
215 Ga0207651_10395518 3300025960 Bacteria 1174
216 Ga0207712_10025562 3300025961 Bacteria 3925
217 Ga0207677_10001402 3300026023 Bacteria 12850
218 Ga0207677_10876792 3300026023 Unclassified 808
219 Ga0207677_12270921 3300026023 Unclassified 505
220 Ga0207703_10017543 3300026035 Bacteria 5588
221 Ga0207639_11634224 3300026041 Unclassified 604
222 Ga0207708_10001472 3300026075 Bacteria 17611
223 Ga0207708_10488574 3300026075 Bacteria 1030
224 Ga0207702_10022978 3300026078 Bacteria 5173
225 Ga0207702_11921079 3300026078 Unclassified 583
226 Ga0207641_10684124 3300026088 Bacteria 1009
227 Ga0207648_10000281 3300026089 Bacteria 55309
228 Ga0207676_10108969 3300026095 Bacteria 2313
229 Ga0207676_10583648 3300026095 Bacteria 1072
230 Ga0207674_11395589 3300026116 Bacteria 670
231 Ga0207675_100000574 3300026118 Bacteria 35888
232 Ga0207675_100344846 3300026118 Bacteria 1458
233 Ga0207675_101605941 3300026118 Bacteria 671
234 Ga0207683_10176447 3300026121 Bacteria 1937
235 Ga0209969_1049330 3300027360 Bacteria 659
236 Ga0209967_1027951 3300027364 Bacteria 840
237 Ga0209981_1022751 3300027378 Bacteria 899
238 Ga0210000_1010940 3300027462 Bacteria 1344
239 Ga0209995_1014617 3300027471 Bacteria 1287
240 Ga0209966_1001528 3300027695 Bacteria 4025
241 Ga0207428_10001277 3300027907 Bacteria 26936
242 Ga0207428_10043316 3300027907 Bacteria 3636
243 Ga0207428_11120625 3300027907 Unclassified 549
244 Ga0268265_10001516 3300028380 Bacteria 19359
245 Ga0268265_10592227 3300028380 Bacteria 1058
246 Ga0268264_10001111 3300028381 Bacteria 26579
247 Ga0268264_10062093 3300028381 Bacteria 3136
248 Ga0307408_100473203 3300031548 Bacteria 1091
249 Ga0307408_101792563 3300031548 Unclassified 586
250 Ga0307405_10256418 3300031731 Bacteria 1304
251 Ga0307405_10562169 3300031731 Bacteria 925
252 Ga0307410_10694740 3300031852 Bacteria 857
253 Ga0307406_10389916 3300031901 Bacteria 1101
254 Ga0307407_10393255 3300031903 Bacteria 993
255 Ga0307412_10147783 3300031911 Bacteria 1730
256 Ga0307412_11253615 3300031911 Unclassified 666
257 Ga0307416_100114152 3300032002 Bacteria 2389
258 Ga0307416_100570694 3300032002 Unclassified 1207
259 Ga0307416_101643346 3300032002 Bacteria 747
260 Ga0307416_102770119 3300032002 Unclassified 586
261 Ga0307411_11192341 3300032005 Unclassified 690
262 Ga0307415_100818121 3300032126 Bacteria 852
263 Ga0373930_0021050 3300034816 Unclassified 1277
264 Ga0373930_0063279 3300034816 Unclassified 829
265 Ga0373958_0000295 3300034819 Bacteria 5964
266 Ga0373959_0018933 3300034820 Bacteria 1299
267 Ga0373959_0182234 3300034820 Unclassified 546
268 Ga0373959_0210296 3300034820 Unclassified 517
269 Ga0373928_0071121 3300035084 Unclassified 860
270 Ga0373928_0072382 3300035084 Bacteria 855
271 Ga0373934_0127119 3300035086 Unclassified 1038
272 Ga0373940_0015252 3300035088 Bacteria 1887
273 Ga0373940_0227420 3300035088 Bacteria 622
274 Ga0373949_0003086 3300035090 Bacteria 4070
275 Ga0373949_0013097 3300035090 Bacteria 1837
276 Ga0373949_0048577 3300035090 Bacteria 1063
277 Ga0373951_0011524 3300035091 Bacteria 1986
278 Ga0373952_0021143 3300035092 Bacteria 1371
279 Ga0373932_0003892 3300035112 Bacteria 3560
280 Ga0373932_0011028 3300035112 Bacteria 2200
281 Ga0373936_0264036 3300035113 Bacteria 771
282 Ga0373939_0005516 3300035114 Bacteria 3016
283 Ga0373941_0012135 3300035115 Bacteria 2245
284 Ga0373941_0036793 3300035115 Unclassified 1491
285 Ga0373953_0021728 3300035117 Bacteria 2412
286 Ga0373954_0000411 3300035118 Bacteria 16004
287 Ga0373956_0097614 3300035119 Bacteria 1360
288 Ga0373960_0008414 3300035121 Bacteria 2472
289 Ga0373960_0077284 3300035121 Bacteria 1041
290 Ga0373955_0348644 3300035172 Unclassified 896
291 Ga0373942_0001913 3300035207 Bacteria 5225
292 Ga0373961_0019455 3300035241 Unclassified 1784
293 Ga0373962_0027033 3300035242 Unclassified 1550
294 Ga0373962_0034488 3300035242 Unclassified 1402
295 Ga0373962_0320073 3300035242 Unclassified 554
296 Ga0373924_0227821 3300035410 Unclassified 824
297 Ga0373931_0000638 3300035691 Bacteria 14545
298 Ga0373931_0007069 3300035691 Bacteria 5277
299 Ga0373931_0017491 3300035691 Bacteria 3548
300 Ga0373931_1021479 3300035691 Bacteria 560
301 Ga0373933_0016978 3300035724 Bacteria 4080
302 Ga0373947_0220827 3300035725 Unclassified 1246
303 Ga0373937_0000884 3300036401 Bacteria 25679
304 Ga0439441_000483 3300042001 Bacteria 4317
305 Ga0439443_007569 3300042003 Bacteria 1514
306 Ga0439435_0000518 3300042436 Bacteria 6169
307 Ga0439444_0000252 3300042437 Bacteria 5314
308 Ga0439460_0001503 3300042461 Bacteria 5495
309 Ga0466960_0325330 3300044901 Bacteria 872
310 Ga0451576_0065543 3300045051 Bacteria 3781
311 Ga0451576_0201366 3300045051 Bacteria 2079
312 Ga0451576_0262774 3300045051 Bacteria 1804
313 Ga0451576_0686870 3300045051 Bacteria 1075
314 Ga0451576_0934492 3300045051 Bacteria 910
315 Ga0451576_1463643 3300045051 Unclassified 710
316 Ga0495584_0171932 3300046491 Bacteria 1101
317 Ga0495630_0492269 3300046517 Unclassified 940
318 Ga0495640_0046088 3300046533 Bacteria 3023
319 Ga0495586_0014645 3300046535 Bacteria 4168
320 Ga0495587_0483680 3300046536 Bacteria 685
321 Ga0495621_0311319 3300046539 Bacteria 654
322 Ga0495667_0416755 3300046559 Unclassified 845
323 Ga0495635_0173583 3300046663 Bacteria 1466
324 Ga0495659_0035723 3300046664 Bacteria 1753
325 Ga0495659_0078544 3300046664 Bacteria 1249
326 Ga0495657_0501982 3300046675 Bacteria 707
327 Ga0495647_0187526 3300046681 Unclassified 902
328 Ga0495669_0018012 3300046684 Bacteria 3033
329 Ga0495669_0447787 3300046684 Bacteria 627
330 Ga0495624_0093942 3300046690 Bacteria 1849
331 Ga0495636_0069419 3300047318 Unclassified 1502
332 Ga0495593_0552968 3300047673 Bacteria 577
333 Ga0501031_0014934 3300049568 Bacteria 5046
334 Ga0501032_0020609 3300049569 Bacteria 4590
335 Ga0501033_0000969 3300049570 Bacteria 26048
336 Ga0501033_0337246 3300049570 Bacteria 1057
337 Ga0501034_0287883 3300049571 Bacteria 1582
338 Ga0501036_0000528 3300049572 Bacteria 27463
339 Ga0501036_0572844 3300049572 Unclassified 938
340 Ga0501037_0027371 3300049573 Bacteria 4212
341 Ga0501037_0786111 3300049573 Unclassified 629
342 Ga0501038_0004135 3300049574 Bacteria 13511
343 Ga0501038_0066738 3300049574 Bacteria 3063
344 Ga0501039_0000053 3300049575 Bacteria 94861
345 Ga0501039_0009161 3300049575 Bacteria 7541
346 Ga0501040_0002928 3300049576 Bacteria 11043
347 Ga0501040_1402036 3300049576 Unclassified 507
348 Ga0501041_0000066 3300049577 Bacteria 39606
349 Ga0501041_0586667 3300049577 Bacteria 711
350 Ga0501042_0020800 3300049578 Bacteria 4568
351 Ga0501042_0303031 3300049578 Unclassified 1154
352 Ga0501042_0788499 3300049578 Bacteria 691
353 Ga0501043_0016878 3300049579 Bacteria 5723
354 Ga0501043_0205574 3300049579 Unclassified 1527
355 Ga0501046_0000927 3300049580 Bacteria 28785
356 Ga0501046_0061209 3300049580 Bacteria 2944
357 Ga0501048_0000221 3300049582 Bacteria 37331
358 Ga0501048_0019469 3300049582 Bacteria 4979
359 Ga0501048_0687447 3300049582 Bacteria 735
360 Ga0501048_0994605 3300049582 Bacteria 603
361 Ga0501067_0260826 3300049583 Bacteria 965
362 Ga0501068_0014880 3300049584 Bacteria 4456
363 Ga0501069_0281047 3300049585 Unclassified 974
364 Ga0501069_0628884 3300049585 Unclassified 645
365 Ga0501070_0063766 3300049586 Bacteria 3052
366 Ga0501071_0001262 3300049587 Bacteria 14342
367 Ga0501071_0019430 3300049587 Bacteria 4714
368 Ga0501071_0625851 3300049587 Bacteria 828
369 Ga0501072_0000105 3300049588 Bacteria 62421
370 Ga0501072_0015939 3300049588 Bacteria 5762
371 Ga0501072_0570369 3300049588 Bacteria 893
372 Ga0501072_0577136 3300049588 Bacteria 887
373 Ga0501072_1289233 3300049588 Unclassified 566
374 Ga0501074_0063870 3300049590 Bacteria 2651
375 Ga0501075_0001570 3300049591 Bacteria 14931
376 Ga0501075_0004043 3300049591 Bacteria 9896
377 Ga0501076_0000833 3300049592 Bacteria 20027
378 Ga0501076_0001101 3300049592 Bacteria 17802
379 Ga0501077_0000154 3300049593 Bacteria 38428
380 Ga0501077_0021236 3300049593 Bacteria 4109
381 Ga0501235_128027 3300049669 Bacteria 641
382 Ga0501243_125345 3300049675 Unclassified 534
383 Ga0501249_157740 3300049679 Bacteria 575
384 Ga0501257_145792 3300049686 Bacteria 650
385 Ga0501079_0001492 3300049741 Bacteria 16563
386 Ga0501079_0037362 3300049741 Bacteria 3743
387 Ga0501080_0072031 3300049742 Bacteria 3215
388 Ga0501080_0094899 3300049742 Bacteria 2770
389 Ga0501081_0000630 3300049743 Bacteria 20114
390 Ga0501081_0034605 3300049743 Bacteria 3437
391 Ga0501083_0155379 3300049744 Bacteria 1498
392 Ga0501083_0879381 3300049744 Unclassified 583
393 Ga0501266_048764 3300049763 Bacteria 649
394 Ga0501035_0005945 3300049822 Bacteria 11490
395 Ga0501035_0365662 3300049822 Unclassified 1205
396 Ga0501044_0020949 3300049823 Bacteria 6981
397 Ga0501045_0000451 3300049824 Bacteria 25372
398 Ga0501045_0031879 3300049824 Bacteria 3818
399 nmdc:mga05p37_1543_c1 3300050507 Bacteria 26771
400 nmdc:mga05p37_272764_c1 3300050507 Bacteria 2020
401 nmdc:mga05p37_899800_c1 3300050507 Bacteria 954
402 nmdc:mga09592_1333624_c1 3300050508 Bacteria 589
403 nmdc:mga09592_302446_c1 3300050508 Unclassified 1387
404 nmdc:mga09592_631209_c1 3300050508 Bacteria 916
405 nmdc:mga09592_801_c1 3300050508 Bacteria 24351
406 nmdc:mga0qj67_853655_c1 3300050509 Bacteria 719
407 nmdc:mga08y16_2099535_c1 3300050511 Unclassified 513
408 nmdc:mga08y16_29332_c1 3300050511 Bacteria 5797
409 nmdc:mga08y16_303884_c1 3300050511 Bacteria 1644
410 nmdc:mga08y16_57178_c1 3300050511 Bacteria 4077
411 nmdc:mga08y16_70213_c1 3300050511 Bacteria 3651
412 nmdc:mga08y16_869343_c1 3300050511 Bacteria 890
413 nmdc:mga0n895_22557_c1 3300050512 Bacteria 5904
414 nmdc:mga0n895_452_c1 3300050512 Bacteria 27503
415 nmdc:mga0n895_981092_c1 3300050512 Bacteria 827
416 nmdc:mga0rr50_11142_c1 3300050513 Bacteria 5738
417 nmdc:mga0rr50_1220_c1 3300050513 Bacteria 13973
418 nmdc:mga0rr50_243544_c1 3300050513 Unclassified 1491
419 nmdc:mga0rr50_243898_c1 3300050513 Bacteria 1490
420 nmdc:mga0rr50_263110_c1 3300050513 Bacteria 1435
421 nmdc:mga08x19_1886_c1 3300050514 Bacteria 12832
422 nmdc:mga08x19_21562_c1 3300050514 Bacteria 3980
423 nmdc:mga08x19_31917_c1 3300050514 Bacteria 3317
424 nmdc:mga08x19_33783_c1 3300050514 Bacteria 3229
425 nmdc:mga08x19_4184_c1 3300050514 Bacteria 8551
426 nmdc:mga08x19_727747_c1 3300050514 Bacteria 704
427 nmdc:mga0a205_1012827_c1 3300050515 Unclassified 678
428 nmdc:mga0a205_3271_c1 3300050515 Bacteria 14414
429 Ga0501084_0000671 3300054114 Bacteria 26137
430 Ga0501084_0015206 3300054114 Bacteria 6382
431 Ga0501082_0000804 3300060353 Bacteria 27651
432 Ga0501082_0049606 3300060353 Bacteria 3620
433 Ga0501082_0595209 3300060353 Unclassified 968
434 Ga0530510_0000714 3300061734 Bacteria 21552
435 Ga0530510_0001614 3300061734 Bacteria 15223
436 Ga0075434_102494622
437 JGI24742J22300_10044262
438 Ga0007429J51699_1056240
439 Ga0065707_10147321
440 Ga0065707_10243531
441 Ga0070676_10106722
442 Ga0070690_100030072
443 Ga0070690_100061312
444 Ga0070690_100215238
445 Ga0070690_100943978
446 Ga0068869_100000253
447 Ga0068869_101393722
448 Ga0070680_100009979
449 Ga0070680_100193418
450 Ga0070680_100300450
451 Ga0070680_101380493
452 Ga0070682_101315346
453 Ga0068868_100000617
454 Ga0070689_100006922
455 Ga0070689_100068623
456 Ga0070691_10000525
457 Ga0070691_10285971
458 Ga0070687_100000041
459 Ga0070687_100185238
460 Ga0070687_100268848
461 Ga0070687_100299227
462 Ga0070687_100464734
463 Ga0070692_10000873
464 Ga0070692_10053716
465 Ga0070692_11340511
466 Ga0070675_100320063
467 Ga0070675_100585021
468 Ga0070674_100469391
469 Ga0070673_100221284
470 Ga0070688_100137499
471 Ga0070688_100526517
472 Ga0070659_101335969
473 Ga0070703_10049051
474 Ga0070701_10002384
475 Ga0070701_10339615
476 Ga0070701_10355961
477 Ga0070701_10390333
478 Ga0070705_100000248
479 Ga0070705_100001759
480 Ga0070705_100021170
481 Ga0070705_101689461
482 Ga0070705_101843224
483 Ga0070694_100002163
484 Ga0070694_100010791
485 Ga0070694_100036106
486 Ga0070694_100045893
487 Ga0070694_100048017
488 Ga0070694_100203829
489 Ga0070708_100157965
490 Ga0070678_101160681
491 Ga0070678_102313960
492 Ga0070662_101512866
493 Ga0070681_10007233
494 Ga0070681_10135249
495 Ga0070681_10347775
496 Ga0070681_10798550
497 Ga0068867_100000340
498 Ga0070685_11030254
499 Ga0070707_102124165
500 Ga0074259_10818005
501 Ga0070699_100007776
502 Ga0070699_100011633
503 Ga0070699_100447312
504 Ga0070699_100515261
505 Ga0070679_100007193
506 Ga0070679_100021346
507 Ga0070679_100944789
508 Ga0070679_101526555
509 Ga0070697_100002757
510 Ga0070697_100132989
511 Ga0070697_100983706
512 Ga0068853_102247143
513 Ga0070686_100000518
514 Ga0070686_100109911
515 Ga0070686_100165047
516 Ga0070686_100340674
517 Ga0070686_101834497
518 Ga0070695_100000745
519 Ga0070695_100006615
520 Ga0070695_100081489
521 Ga0070695_100153873
522 Ga0070695_100222686
523 Ga0070695_101043438
524 Ga0070696_100010525
525 Ga0070696_100018926
526 Ga0070696_100116770
527 Ga0070696_100147435
528 Ga0070696_100922199
529 Ga0070693_100000232
530 Ga0070693_100117859
531 Ga0070693_100334930
532 Ga0070704_100000019
533 Ga0070704_100013648
534 Ga0070704_100213453
535 Ga0070704_100714409
536 Ga0068855_100005533
537 Ga0068857_100683604
538 Ga0068857_101979404
539 Ga0068856_100040747
540 Ga0070702_100000402
541 Ga0070702_100499891
542 Ga0070702_101627755
543 Ga0068859_100000745
544 Ga0068859_100270749
545 Ga0068859_100468354
546 Ga0068864_100508193
547 Ga0068866_10000614
548 Ga0068866_10393849
549 Ga0068861_100003672
550 Ga0068861_101414741
551 Ga0068870_10031982
552 Ga0068863_100881305
553 Ga0068858_100025705
554 Ga0068860_100031868
555 Ga0068860_100429625
556 Ga0068862_100012243
557 Ga0081538_10351913
558 Ga0081539_10004540
559 Ga0070717_10955882
560 Ga0070716_100085961
561 Ga0070716_100212705
562 Ga0070712_100195260
563 Ga0097621_100000406
564 Ga0068871_100000953
565 Ga0068871_101911123
566 Ga0075428_100024560
567 Ga0075430_100169761
568 Ga0075433_10001929
569 Ga0075433_10717815
570 Ga0075434_100000254
571 Ga0075434_100000818
572 Ga0075434_101491269
573 Ga0075429_100008921
574 Ga0068865_100000228
575 Ga0068865_101324157
576 Ga0075436_100000149
577 Ga0075436_100000243
578 Ga0075436_100027493
579 Ga0075436_100032490
580 Ga0075436_100194649
581 Ga0097620_100000745
582 Ga0097620_100270762
583 Ga0097620_100468363
584 Ga0075435_100001280
585 Ga0075435_100001299
586 Ga0075435_100164836
587 Ga0075435_100174669
588 Ga0075435_100888991
589 Ga0075435_101186784
590 Ga0111539_10008534
591 Ga0111539_10103378
592 Ga0111539_10111897
593 Ga0111539_10149274
594 Ga0111539_10824314
595 Ga0111539_11503616
596 Ga0105247_11058144
597 Ga0114129_10003508
598 Ga0114129_10415530
599 Ga0114129_10509240
600 Ga0105246_10694058
601 Ga0157315_1045668
602 Ga0157374_10810335
603 Ga0157372_10924717
604 Ga0157380_11962614
605 Ga0157377_10068778
606 Ga0157377_11518833
607 Ga0206356_10997736
608 Ga0206356_11813329
609 Ga0206352_10411606
610 Ga0206350_11081564
611 Ga0207653_10083083
612 Ga0207653_10428782
613 Ga0207642_10008122
614 Ga0207688_10168986
615 Ga0207688_10459680
616 Ga0207680_10239391
617 Ga0207645_10221769
618 Ga0207643_10102268
619 Ga0207707_10003685
620 Ga0207707_10075236
621 Ga0207707_10339728
622 Ga0207707_11438154
623 Ga0207693_10799020
624 Ga0207660_10003316
625 Ga0207660_10263001
626 Ga0207660_10414179
627 Ga0207660_11558580
628 Ga0207662_10000194
629 Ga0207662_10101728
630 Ga0207662_10405491
631 Ga0207662_10562662
632 Ga0207649_11684354
633 Ga0207652_10009358
634 Ga0207652_10120849
635 Ga0207646_11036399
636 Ga0207659_10806462
637 Ga0207687_10002764
638 Ga0207706_11282474
639 Ga0207686_10007546
640 Ga0207709_10000564
641 Ga0207670_10021108
642 Ga0207670_10322850
643 Ga0207670_10326724
644 Ga0207704_10001005
645 Ga0207665_10027573
646 Ga0207689_10000566
647 Ga0207689_10400112
648 Ga0207689_11521355
649 Ga0207667_10058286
650 Ga0207651_10395518
651 Ga0207712_10025562
652 Ga0207677_10001402
653 Ga0207677_10876792
654 Ga0207677_12270921
655 Ga0207703_10017543
656 Ga0207639_11634224
657 Ga0207708_10001472
658 Ga0207708_10488574
659 Ga0207702_10022978
660 Ga0207702_11921079
661 Ga0207641_10684124
662 Ga0207648_10000281
663 Ga0207676_10108969
664 Ga0207676_10583648
665 Ga0207674_11395589
666 Ga0207675_100000574
667 Ga0207675_100344846
668 Ga0207675_101605941
669 Ga0207683_10176447
670 Ga0209969_1049330
671 Ga0209967_1027951
672 Ga0209981_1022751
673 Ga0210000_1010940
674 Ga0209995_1014617
675 Ga0209966_1001528
676 Ga0207428_10001277
677 Ga0207428_10043316
678 Ga0207428_11120625
679 Ga0268265_10001516
680 Ga0268265_10592227
681 Ga0268264_10001111
682 Ga0268264_10062093
683 Ga0307408_100473203
684 Ga0307408_101792563
685 Ga0307405_10256418
686 Ga0307405_10562169
687 Ga0307410_10694740
688 Ga0307406_10389916
689 Ga0307407_10393255
690 Ga0307412_10147783
691 Ga0307412_11253615
692 Ga0307416_100114152
693 Ga0307416_100570694
694 Ga0307416_101643346
695 Ga0307416_102770119
696 Ga0307411_11192341
697 Ga0307415_100818121
698 Ga0373930_0021050
699 Ga0373930_0063279
700 Ga0373958_0000295
701 Ga0373959_0018933
702 Ga0373959_0182234
703 Ga0373959_0210296
704 Ga0373928_0071121
705 Ga0373928_0072382
706 Ga0373934_0127119
707 Ga0373940_0015252
708 Ga0373940_0227420
709 Ga0373949_0003086
710 Ga0373949_0013097
711 Ga0373949_0048577
712 Ga0373951_0011524
713 Ga0373952_0021143
714 Ga0373932_0003892
715 Ga0373932_0011028
716 Ga0373936_0264036
717 Ga0373939_0005516
718 Ga0373941_0012135
719 Ga0373941_0036793
720 Ga0373953_0021728
721 Ga0373954_0000411
722 Ga0373956_0097614
723 Ga0373960_0008414
724 Ga0373960_0077284
725 Ga0373955_0348644
726 Ga0373942_0001913
727 Ga0373961_0019455
728 Ga0373962_0027033
729 Ga0373962_0034488
730 Ga0373962_0320073
731 Ga0373924_0227821
732 Ga0373931_0000638
733 Ga0373931_0007069
734 Ga0373931_0017491
735 Ga0373931_1021479
736 Ga0373933_0016978
737 Ga0373947_0220827
738 Ga0373937_0000884
739 Ga0439441_000483
740 Ga0439443_007569
741 Ga0439435_0000518
742 Ga0439444_0000252
743 Ga0439460_0001503
744 Ga0466960_0325330
745 Ga0451576_0065543
746 Ga0451576_0201366
747 Ga0451576_0262774
748 Ga0451576_0686870
749 Ga0451576_0934492
750 Ga0451576_1463643
751 Ga0495584_0171932
752 Ga0495630_0492269
753 Ga0495640_0046088
754 Ga0495586_0014645
755 Ga0495587_0483680
756 Ga0495621_0311319
757 Ga0495667_0416755
758 Ga0495635_0173583
759 Ga0495659_0035723
760 Ga0495659_0078544
761 Ga0495657_0501982
762 Ga0495647_0187526
763 Ga0495669_0018012
764 Ga0495669_0447787
765 Ga0495624_0093942
766 Ga0495636_0069419
767 Ga0495593_0552968
768 Ga0501031_0014934
769 Ga0501032_0020609
770 Ga0501033_0000969
771 Ga0501033_0337246
772 Ga0501034_0287883
773 Ga0501036_0000528
774 Ga0501036_0572844
775 Ga0501037_0027371
776 Ga0501037_0786111
777 Ga0501038_0004135
778 Ga0501038_0066738
779 Ga0501039_0000053
780 Ga0501039_0009161
781 Ga0501040_0002928
782 Ga0501040_1402036
783 Ga0501041_0000066
784 Ga0501041_0586667
785 Ga0501042_0020800
786 Ga0501042_0303031
787 Ga0501042_0788499
788 Ga0501043_0016878
789 Ga0501043_0205574
790 Ga0501046_0000927
791 Ga0501046_0061209
792 Ga0501048_0000221
793 Ga0501048_0019469
794 Ga0501048_0687447
795 Ga0501048_0994605
796 Ga0501067_0260826
797 Ga0501068_0014880
798 Ga0501069_0281047
799 Ga0501069_0628884
800 Ga0501070_0063766
801 Ga0501071_0001262
802 Ga0501071_0019430
803 Ga0501071_0625851
804 Ga0501072_0000105
805 Ga0501072_0015939
806 Ga0501072_0570369
807 Ga0501072_0577136
808 Ga0501072_1289233
809 Ga0501074_0063870
810 Ga0501075_0001570
811 Ga0501075_0004043
812 Ga0501076_0000833
813 Ga0501076_0001101
814 Ga0501077_0000154
815 Ga0501077_0021236
816 Ga0501235_128027
817 Ga0501243_125345
818 Ga0501249_157740
819 Ga0501257_145792
820 Ga0501079_0001492
821 Ga0501079_0037362
822 Ga0501080_0072031
823 Ga0501080_0094899
824 Ga0501081_0000630
825 Ga0501081_0034605
826 Ga0501083_0155379
827 Ga0501083_0879381
828 Ga0501266_048764
829 Ga0501035_0005945
830 Ga0501035_0365662
831 Ga0501044_0020949
832 Ga0501045_0000451
833 Ga0501045_0031879
834 nmdc:mga05p37_1543_c1
835 nmdc:mga05p37_272764_c1
836 nmdc:mga05p37_899800_c1
837 nmdc:mga09592_1333624_c1
838 nmdc:mga09592_302446_c1
839 nmdc:mga09592_631209_c1
840 nmdc:mga09592_801_c1
841 nmdc:mga0qj67_853655_c1
842 nmdc:mga08y16_2099535_c1
843 nmdc:mga08y16_29332_c1
844 nmdc:mga08y16_303884_c1
845 nmdc:mga08y16_57178_c1
846 nmdc:mga08y16_70213_c1
847 nmdc:mga08y16_869343_c1
848 nmdc:mga0n895_22557_c1
849 nmdc:mga0n895_452_c1
850 nmdc:mga0n895_981092_c1
851 nmdc:mga0rr50_11142_c1
852 nmdc:mga0rr50_1220_c1
853 nmdc:mga0rr50_243544_c1
854 nmdc:mga0rr50_243898_c1
855 nmdc:mga0rr50_263110_c1
856 nmdc:mga08x19_1886_c1
857 nmdc:mga08x19_21562_c1
858 nmdc:mga08x19_31917_c1
859 nmdc:mga08x19_33783_c1
860 nmdc:mga08x19_4184_c1
861 nmdc:mga08x19_727747_c1
862 nmdc:mga0a205_1012827_c1
863 nmdc:mga0a205_3271_c1
864 Ga0501084_0000671
865 Ga0501084_0015206
866 Ga0501082_0000804
867 Ga0501082_0049606
868 Ga0501082_0595209
869 Ga0530510_0000714
870 Ga0530510_0001614

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v9x-assembly1.cif.gz_A structure of mycobacterium smegmatis helicase lhr bound to ssdna and amp-pnp 0.8377 6 26
6ldy-assembly2.cif.gz_L structure antibody d6 in complex with methylated peptide 0.7893 18 34
7nrh-assembly1.cif.gz_L hantaan virus glycoprotein (gn) in complex with fab fragment htn-gn1. 0.7781 18 34
3vhj-assembly1.cif.gz_A crystal structure of the cytoplasmic domain of bfpc 0.7651 1 46
6qzh-assembly1.cif.gz_A structure of the human cc chemokine receptor 7 in complex with the intracellular allosteric antagonist cmp2105 and the insertion protein sialidase nana 0.7629 9 37
ID Description Score Start End Superfamily
af_Q9LRZ5_221_341_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8635 18 51 2.30.29.30
af_A1ZAB1_928_1030_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8482 17 33 2.60.40.10
af_A0A0R4IY99_1_270_2.60.40.60 Mainly Beta;Sandwich;Immunoglobulin-like;Cadherins 0.8458 18 34 2.60.40.60
af_Q9BZZ2_141_241_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8414 18 34 2.60.40.10
af_Q58EM0_138_241_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8352 17 33 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A356D156-F1-model_v4 deleted 0.9362 6 49
AF-H1KGB2-F1-model_v4 Integrase family protein 0.936 9 47 GO:0003677
GO:0006310
GO:0015074
AF-A0A536ZPD6-F1-model_v4 DUF2188 domain-containing protein 0.9055 2 81
AF-A0A2A3A517-F1-model_v4 deleted 0.9022 6 71
AF-K2G9Z9-F1-model_v4 DUF2188 domain-containing protein 0.8985 6 71

Map