F443273

General Info

Members Datasets Scaffolds Average Seq Length
435 212 435 98

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100799971|Ga0070713_1007999712
Length 103
Sequence VSRILVQESGGSVRVSEAALTEIVRRAVSSVDGARLRKGRRRLGVELEDGRARAELQLAVAYGRVLPEVSAAVQERVADALTRMCDVEVEAVHVTVEELDRAR

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
58 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
87 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
90 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
93 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
94 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
96 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
97 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
98 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
99 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
101 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
114 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
120 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
139 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
146 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
147 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
148 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
164 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
168 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
208 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0.92
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.38
Nodule 0
Rhizoplane 13.1
Rhizosphere 84.83
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100248005 3300005329 Bacteria 1693
2 Ga0070683_101046930 3300005329 Bacteria 784
3 Ga0070680_100147041 3300005336 Bacteria 1977
4 Ga0070680_100588776 3300005336 Bacteria 954
5 Ga0070682_100805140 3300005337 Bacteria 764
6 Ga0070682_100855342 3300005337 Unclassified 743
7 Ga0070660_100405640 3300005339 Bacteria 1127
8 Ga0070691_10105068 3300005341 Bacteria 1406
9 Ga0070692_10217356 3300005345 Bacteria 1128
10 Ga0070674_101013666 3300005356 Bacteria 729
11 Ga0070659_100088397 3300005366 Bacteria 2481
12 Ga0070709_10464575 3300005434 Bacteria 956
13 Ga0070714_100145677 3300005435 Bacteria 2130
14 Ga0070714_100217655 3300005435 Bacteria 1754
15 Ga0070714_100942152 3300005435 Bacteria 839
16 Ga0070714_101829563 3300005435 Bacteria 593
17 Ga0070713_100373319 3300005436 Bacteria 1327
18 Ga0070713_100799971 3300005436 Bacteria 904
19 Ga0070713_101673803 3300005436 Bacteria 618
20 Ga0070711_100102404 3300005439 Bacteria 2085
21 Ga0070711_100449600 3300005439 Bacteria 1054
22 Ga0070705_100321186 3300005440 Bacteria 1118
23 Ga0070663_100835037 3300005455 Bacteria 792
24 Ga0070662_101366518 3300005457 Bacteria 610
25 Ga0070681_10099857 3300005458 Bacteria 2848
26 Ga0070681_10165708 3300005458 Bacteria 2132
27 Ga0070707_100637895 3300005468 Bacteria 1028
28 Ga0070698_100267157 3300005471 Bacteria 1642
29 Ga0070699_101278382 3300005518 Bacteria 673
30 Ga0070679_100051690 3300005530 Bacteria 4093
31 Ga0070684_100155028 3300005535 Bacteria 2077
32 Ga0070684_100198642 3300005535 Bacteria 1826
33 Ga0070684_100441134 3300005535 Bacteria 1203
34 Ga0070684_100552548 3300005535 Bacteria 1069
35 Ga0070697_101530548 3300005536 Bacteria 596
36 Ga0070695_100000023 3300005545 Bacteria 60293
37 Ga0070696_100250873 3300005546 Bacteria 1338
38 Ga0070665_102218777 3300005548 Bacteria 553
39 Ga0068855_100294419 3300005563 Bacteria 1799
40 Ga0068855_100866959 3300005563 Bacteria 956
41 Ga0068855_101165779 3300005563 Bacteria 803
42 Ga0070664_100602915 3300005564 Bacteria 1018
43 Ga0070664_100716754 3300005564 Bacteria 933
44 Ga0068856_100046139 3300005614 Bacteria 4292
45 Ga0068856_100313034 3300005614 Bacteria 1588
46 Ga0068856_101168941 3300005614 Bacteria 786
47 Ga0068856_101759699 3300005614 Bacteria 632
48 Ga0068852_101066079 3300005616 Bacteria 828
49 Ga0068864_100462591 3300005618 Bacteria 1215
50 Ga0081455_10078963 3300005937 Bacteria 2703
51 Ga0070717_10036844 3300006028 Bacteria 3969
52 Ga0070717_10215703 3300006028 Bacteria 1685
53 Ga0070717_11826818 3300006028 Bacteria 549
54 Ga0075365_10009701 3300006038 Bacteria 5556
55 Ga0075364_10420709 3300006051 Unclassified 912
56 Ga0070715_10020309 3300006163 Bacteria 2560
57 Ga0070716_100237694 3300006173 Bacteria 1233
58 Ga0070712_100489564 3300006175 Bacteria 1029
59 Ga0097621_100079697 3300006237 Bacteria 2723
60 Ga0068871_101280957 3300006358 Bacteria 689
61 Ga0075434_100416277 3300006871 Bacteria 1365
62 Ga0068865_100163296 3300006881 Bacteria 1701
63 Ga0075436_100153381 3300006914 Bacteria 1622
64 Ga0105240_10072593 3300009093 Bacteria 4253
65 Ga0105240_10297307 3300009093 Bacteria 1848
66 Ga0105240_11254813 3300009093 Bacteria 783
67 Ga0105245_10074335 3300009098 Bacteria 3092
68 Ga0105242_10154230 3300009176 Bacteria 2005
69 Ga0105238_10223556 3300009551 Bacteria 1859
70 Ga0105238_11206712 3300009551 Bacteria 781
71 Ga0105238_13025239 3300009551 Bacteria 505
72 Ga0105239_10289690 3300010375 Bacteria 1844
73 Ga0105239_11146577 3300010375 Bacteria 895
74 Ga0157369_10045666 3300013105 Bacteria 4762
75 Ga0157369_10058990 3300013105 Bacteria 4139
76 Ga0157369_10507135 3300013105 Bacteria 1248
77 Ga0157374_10543857 3300013296 Bacteria 1169
78 Ga0157372_10359490 3300013307 Bacteria 1696
79 Ga0157372_10565894 3300013307 Bacteria 1325
80 Ga0157372_11460960 3300013307 Bacteria 788
81 Ga0157375_10614496 3300013308 Bacteria 1245
82 Ga0182008_10117637 3300014497 Bacteria 1319
83 Ga0157379_10465459 3300014968 Bacteria 1169
84 Ga0157376_10014354 3300014969 Bacteria 5943
85 Ga0206356_10242922 3300020070 Bacteria 1060
86 Ga0206356_11688088 3300020070 Bacteria 1532
87 Ga0206353_10246071 3300020082 Bacteria 1701
88 Ga0213874_10124900 3300021377 Bacteria 878
89 Ga0224712_10535334 3300022467 Unclassified 568
90 Ga0207692_10696099 3300025898 Bacteria 659
91 Ga0207699_10311634 3300025906 Bacteria 1101
92 Ga0207705_10259272 3300025909 Bacteria 1327
93 Ga0207707_10437695 3300025912 Bacteria 1119
94 Ga0207695_10457838 3300025913 Bacteria 1159
95 Ga0207695_10595537 3300025913 Unclassified 987
96 Ga0207693_10821911 3300025915 Bacteria 715
97 Ga0207660_10135876 3300025917 Bacteria 1876
98 Ga0207660_10229986 3300025917 Bacteria 1458
99 Ga0207657_10015732 3300025919 Bacteria 7316
100 Ga0207649_10748520 3300025920 Bacteria 760
101 Ga0207652_10152074 3300025921 Bacteria 2073
102 Ga0207646_10002421 3300025922 Bacteria 22033
103 Ga0207646_10645084 3300025922 Bacteria 949
104 Ga0207694_10431560 3300025924 Bacteria 1098
105 Ga0207694_11339382 3300025924 Bacteria 605
106 Ga0207700_10669788 3300025928 Bacteria 925
107 Ga0207664_10168682 3300025929 Bacteria 1872
108 Ga0207664_10373849 3300025929 Bacteria 1264
109 Ga0207690_10041781 3300025932 Bacteria 3007
110 Ga0207706_10550194 3300025933 Bacteria 993
111 Ga0207686_10096539 3300025934 Bacteria 1964
112 Ga0207686_11473342 3300025934 Bacteria 561
113 Ga0207669_10830475 3300025937 Bacteria 768
114 Ga0207665_10000197 3300025939 Bacteria 40246
115 Ga0207665_10552734 3300025939 Bacteria 895
116 Ga0207711_11176696 3300025941 Bacteria 708
117 Ga0207661_10384586 3300025944 Bacteria 1270
118 Ga0207679_10252419 3300025945 Bacteria 1500
119 Ga0207702_10979621 3300026078 Bacteria 839
120 Ga0207702_11213928 3300026078 Bacteria 748
121 Ga0207702_11784637 3300026078 Bacteria 607
122 Ga0207676_10463861 3300026095 Bacteria 1197
123 Ga0207674_11105960 3300026116 Bacteria 762
124 Ga0207683_10370162 3300026121 Bacteria 1316
125 Ga0207683_11061875 3300026121 Bacteria 751
126 Ga0207698_10562509 3300026142 Bacteria 1119
127 Ga0265319_1033239 3300028563 Bacteria 1783
128 Ga0265336_10055948 3300028666 Bacteria 1186
129 Ga0265338_10129352 3300028800 Bacteria 1997
130 Ga0265320_10229505 3300031240 Bacteria 826
131 Ga0265327_10295451 3300031251 Bacteria 714
132 Ga0265316_10384193 3300031344 Bacteria 1013
133 Ga0373930_0073744 3300034816 Unclassified 780
134 Ga0373959_0138743 3300034820 Bacteria 607
135 Ga0373923_0472149 3300035111 Unclassified 610
136 Ga0373945_0005244 3300035116 Bacteria 4144
137 Ga0373956_0304114 3300035119 Bacteria 760
138 Ga0373943_0004575 3300035170 Bacteria 6250
139 Ga0373942_0076644 3300035207 Bacteria 986
140 Ga0373924_0483357 3300035410 Bacteria 556
141 Ga0373931_0653730 3300035691 Bacteria 691
142 Ga0373935_0129384 3300035692 Bacteria 1695
143 Ga0373927_0026313 3300035695 Bacteria 3802
144 Ga0373933_0779618 3300035724 Bacteria 629
145 Ga0373947_0005033 3300035725 Bacteria 7738
146 Ga0373937_0000548 3300036401 Bacteria 33475
147 Ga0373937_0775331 3300036401 Bacteria 906
148 Ga0373937_0896800 3300036401 Bacteria 835
149 Ga0373925_0001456 3300037068 Bacteria 20442
150 Ga0395899_0097791 3300037312 Bacteria 2121
151 Ga0395900_0050079 3300037418 Bacteria 4303
152 Ga0395900_0307310 3300037418 Bacteria 1570
153 Ga0395900_1722293 3300037418 Bacteria 537
154 Ga0395898_0059286 3300037466 Bacteria 3724
155 Ga0395898_0123193 3300037466 Bacteria 2484
156 Ga0395898_0778058 3300037466 Bacteria 898
157 Ga0395898_1220958 3300037466 Unclassified 683
158 Ga0395905_0040216 3300037471 Bacteria 4385
159 Ga0395905_0221235 3300037471 Bacteria 1772
160 Ga0395901_0344226 3300038443 Bacteria 1540
161 Ga0395901_1081196 3300038443 Bacteria 773
162 Ga0395901_1676844 3300038443 Bacteria 587
163 Ga0436363_1653846 3300039450 Bacteria 1377
164 Ga0451800_1373213 3300041459 Bacteria 618
165 Ga0451802_1136725 3300041460 Unclassified 561
166 Ga0451853_0240863 3300041512 Bacteria 791
167 Ga0466961_0097270 3300044693 Bacteria 1856
168 Ga0466961_0425940 3300044693 Bacteria 804
169 Ga0466961_0430255 3300044693 Unclassified 799
170 Ga0466963_0000261 3300044694 Bacteria 23150
171 Ga0466963_0003462 3300044694 Bacteria 9043
172 Ga0466963_0005668 3300044694 Bacteria 7334
173 Ga0466963_0009427 3300044694 Bacteria 5879
174 Ga0466963_0023530 3300044694 Bacteria 3913
175 Ga0466963_0034912 3300044694 Bacteria 3274
176 Ga0466963_0195336 3300044694 Bacteria 1414
177 Ga0466963_0265506 3300044694 Bacteria 1205
178 Ga0466963_0433169 3300044694 Bacteria 927
179 Ga0466963_0955581 3300044694 Bacteria 603
180 Ga0466963_1268534 3300044694 Bacteria 517
181 Ga0466964_0012292 3300044706 Bacteria 3239
182 Ga0466964_0047594 3300044706 Bacteria 1751
183 Ga0466964_0087423 3300044706 Bacteria 1350
184 Ga0466964_0111389 3300044706 Bacteria 1221
185 Ga0466964_0161508 3300044706 Bacteria 1048
186 Ga0466971_0118918 3300044719 Bacteria 1222
187 Ga0466968_0000642 3300044735 Bacteria 11965
188 Ga0466968_0007872 3300044735 Bacteria 4067
189 Ga0466968_0023087 3300044735 Bacteria 2532
190 Ga0466968_0079345 3300044735 Bacteria 1440
191 Ga0466968_0080658 3300044735 Bacteria 1429
192 Ga0466968_0321484 3300044735 Unclassified 747
193 Ga0466970_0100954 3300044765 Bacteria 1571
194 Ga0466970_0291658 3300044765 Bacteria 919
195 Ga0466957_0022317 3300044842 Bacteria 3734
196 Ga0466957_0022370 3300044842 Bacteria 3730
197 Ga0466957_0036234 3300044842 Bacteria 2965
198 Ga0466957_0135813 3300044842 Bacteria 1580
199 Ga0466957_1023351 3300044842 Bacteria 594
200 Ga0466960_0004515 3300044901 Bacteria 5453
201 Ga0466960_0342398 3300044901 Bacteria 851
202 Ga0466960_0512753 3300044901 Unclassified 704
203 Ga0466959_0170173 3300045049 Bacteria 1528
204 Ga0466959_0270940 3300045049 Bacteria 1167
205 Ga0466959_0362497 3300045049 Unclassified 987
206 Ga0466958_0014327 3300045836 Bacteria 4527
207 Ga0466958_0030553 3300045836 Bacteria 3200
208 Ga0466958_0063249 3300045836 Bacteria 2256
209 Ga0466958_0977018 3300045836 Bacteria 552
210 Ga0466958_1041047 3300045836 Bacteria 534
211 Ga0466967_0000470 3300045976 Bacteria 19500
212 Ga0466967_0006755 3300045976 Bacteria 8168
213 Ga0466967_0009734 3300045976 Bacteria 7159
214 Ga0466967_0010413 3300045976 Bacteria 6976
215 Ga0466967_0030006 3300045976 Bacteria 4558
216 Ga0466967_0040677 3300045976 Bacteria 4003
217 Ga0466967_0078344 3300045976 Bacteria 2977
218 Ga0466967_0081931 3300045976 Bacteria 2915
219 Ga0466967_0415253 3300045976 Bacteria 1311
220 Ga0466967_0445837 3300045976 Bacteria 1264
221 Ga0466967_0449336 3300045976 Bacteria 1259
222 Ga0466967_0489145 3300045976 Bacteria 1206
223 Ga0466967_0523323 3300045976 Bacteria 1165
224 Ga0466967_0548658 3300045976 Bacteria 1137
225 Ga0466967_0692134 3300045976 Bacteria 1009
226 Ga0466967_0943495 3300045976 Bacteria 858
227 Ga0466967_1025853 3300045976 Unclassified 821
228 Ga0466967_1141238 3300045976 Bacteria 776
229 Ga0466967_1227445 3300045976 Bacteria 747
230 Ga0466967_2569438 3300045976 Bacteria 504
231 Ga0495617_274068 3300046452 Bacteria 517
232 Ga0495592_0000597 3300046454 Bacteria 25448
233 Ga0495592_0309567 3300046454 Bacteria 1024
234 Ga0495592_0566731 3300046454 Bacteria 696
235 Ga0495603_0306467 3300046455 Bacteria 912
236 Ga0495603_0355146 3300046455 Bacteria 841
237 Ga0495629_0001473 3300046459 Bacteria 18571
238 Ga0495629_0021747 3300046459 Bacteria 4576
239 Ga0495629_0191938 3300046459 Bacteria 1414
240 Ga0495629_0490547 3300046459 Bacteria 829
241 Ga0495641_0001513 3300046461 Bacteria 19794
242 Ga0495641_0029286 3300046461 Bacteria 2654
243 Ga0495641_0277989 3300046461 Bacteria 754
244 Ga0495651_0000008 3300046462 Bacteria 156989
245 Ga0495651_0043470 3300046462 Bacteria 3486
246 Ga0495651_0841869 3300046462 Bacteria 564
247 Ga0495653_0000725 3300046463 Bacteria 25130
248 Ga0495653_0070765 3300046463 Bacteria 2610
249 Ga0495653_0078918 3300046463 Bacteria 2440
250 Ga0495653_0479656 3300046463 Unclassified 778
251 Ga0495653_0921963 3300046463 Bacteria 519
252 Ga0495580_0986315 3300046472 Bacteria 538
253 Ga0495582_0079126 3300046473 Bacteria 1824
254 Ga0495582_0113177 3300046473 Bacteria 1525
255 Ga0495582_0163418 3300046473 Bacteria 1267
256 Ga0495582_0374239 3300046473 Bacteria 821
257 Ga0495582_0513857 3300046473 Bacteria 692
258 Ga0495605_0053872 3300046474 Bacteria 1950
259 Ga0495639_0059589 3300046475 Bacteria 1747
260 Ga0495639_0453702 3300046475 Bacteria 651
261 Ga0495662_0002877 3300046476 Bacteria 8708
262 Ga0495662_0044459 3300046476 Bacteria 2144
263 Ga0495664_0008288 3300046477 Bacteria 5794
264 Ga0495664_0315229 3300046477 Bacteria 943
265 Ga0495664_0394243 3300046477 Bacteria 831
266 Ga0495594_0060684 3300046499 Bacteria 2092
267 Ga0495594_0081605 3300046499 Bacteria 1806
268 Ga0495608_0070774 3300046511 Bacteria 2276
269 Ga0495618_0002855 3300046514 Bacteria 10942
270 Ga0495618_0014448 3300046514 Bacteria 4811
271 Ga0495618_0092061 3300046514 Bacteria 1938
272 Ga0495628_0000105 3300046516 Bacteria 68159
273 Ga0495628_0381372 3300046516 Bacteria 1032
274 Ga0495630_0005583 3300046517 Bacteria 8884
275 Ga0495630_0107922 3300046517 Bacteria 2108
276 Ga0495630_0861832 3300046517 Bacteria 690
277 Ga0495630_1415786 3300046517 Bacteria 522
278 Ga0495631_0108108 3300046518 Bacteria 1196
279 Ga0495644_0006079 3300046523 Bacteria 4696
280 Ga0495663_0213175 3300046525 Unclassified 677
281 Ga0495642_0064331 3300046528 Bacteria 1526
282 Ga0495652_0001221 3300046529 Bacteria 28813
283 Ga0495652_0266879 3300046529 Bacteria 1260
284 Ga0495665_0005405 3300046531 Bacteria 6884
285 Ga0495640_0014828 3300046533 Bacteria 5882
286 Ga0495640_0225090 3300046533 Bacteria 1181
287 Ga0495586_0191438 3300046535 Bacteria 1158
288 Ga0495587_0000048 3300046536 Bacteria 105358
289 Ga0495621_0079966 3300046539 Bacteria 1218
290 Ga0495645_0000029 3300046543 Bacteria 113119
291 Ga0495645_0164836 3300046543 Bacteria 1529
292 Ga0495633_0232466 3300046558 Bacteria 843
293 Ga0495667_0070901 3300046559 Bacteria 2273
294 Ga0495667_0090250 3300046559 Bacteria 1986
295 Ga0495667_0151025 3300046559 Bacteria 1496
296 Ga0495667_0346351 3300046559 Bacteria 939
297 Ga0495667_0459311 3300046559 Bacteria 800
298 Ga0495656_0091712 3300046615 Bacteria 1390
299 Ga0495668_0449674 3300046616 Bacteria 709
300 Ga0495634_0021598 3300046642 Bacteria 4547
301 Ga0495634_0141173 3300046642 Bacteria 1529
302 Ga0495634_0443251 3300046642 Bacteria 767
303 Ga0495611_0060976 3300046648 Bacteria 1714
304 Ga0495635_0031336 3300046663 Bacteria 3692
305 Ga0495635_0443678 3300046663 Bacteria 859
306 Ga0495659_0067487 3300046664 Bacteria 1334
307 Ga0495657_0016661 3300046675 Bacteria 5349
308 Ga0495657_0026870 3300046675 Bacteria 4070
309 Ga0495599_0000110 3300046678 Bacteria 55240
310 Ga0495623_0000379 3300046679 Bacteria 29118
311 Ga0495646_0007711 3300046680 Bacteria 6840
312 Ga0495646_0447601 3300046680 Bacteria 667
313 Ga0495647_0000245 3300046681 Bacteria 14888
314 Ga0495647_0050385 3300046681 Bacteria 1615
315 Ga0495647_0334383 3300046681 Bacteria 687
316 Ga0495658_0000675 3300046683 Bacteria 18488
317 Ga0495658_0133286 3300046683 Bacteria 1514
318 Ga0495658_0412696 3300046683 Unclassified 861
319 Ga0495658_0877489 3300046683 Bacteria 574
320 Ga0495613_0002533 3300046689 Bacteria 13755
321 Ga0495613_0026598 3300046689 Bacteria 4309
322 Ga0495613_0206382 3300046689 Bacteria 1383
323 Ga0495613_0256748 3300046689 Unclassified 1218
324 Ga0495613_0954927 3300046689 Bacteria 552
325 Ga0495624_0008425 3300046690 Bacteria 7188
326 Ga0495624_0076897 3300046690 Bacteria 2070
327 Ga0495670_0221907 3300046691 Bacteria 1004
328 Ga0495600_0038666 3300046809 Bacteria 3105
329 Ga0495600_0688918 3300046809 Bacteria 615
330 Ga0495581_0007732 3300047315 Bacteria 6219
331 Ga0495581_0157929 3300047315 Bacteria 1325
332 Ga0495581_0681302 3300047315 Bacteria 593
333 Ga0495604_0000687 3300047317 Bacteria 28670
334 Ga0495604_0268506 3300047317 Bacteria 1157
335 Ga0495604_0373000 3300047317 Bacteria 944
336 Ga0495674_0051905 3300047319 Bacteria 3612
337 Ga0495674_0076182 3300047319 Bacteria 2885
338 Ga0495674_0172243 3300047319 Bacteria 1805
339 Ga0495674_0899019 3300047319 Bacteria 683
340 Ga0495676_0014258 3300047321 Bacteria 7113
341 Ga0495676_0049195 3300047321 Bacteria 3392
342 Ga0495676_0409703 3300047321 Bacteria 898
343 Ga0495676_1111601 3300047321 Bacteria 502
344 Ga0495680_0013363 3300047322 Bacteria 7165
345 Ga0495680_0043442 3300047322 Bacteria 3558
346 Ga0495675_0000419 3300047444 Bacteria 28791
347 Ga0495677_0091271 3300047445 Bacteria 1148
348 Ga0495684_0015084 3300047471 Bacteria 5950
349 Ga0495684_0018363 3300047471 Bacteria 5390
350 Ga0495684_0043476 3300047471 Bacteria 3439
351 Ga0495593_0003361 3300047673 Bacteria 9583
352 Ga0495593_0132245 3300047673 Bacteria 1266
353 Ga0495602_0001409 3300048088 Bacteria 23791
354 Ga0495614_0048118 3300048089 Bacteria 1829
355 Ga0496100_0199569 3300048903 Bacteria 1457
356 Ga0496100_0412082 3300048903 Bacteria 1031
357 Ga0496100_0484464 3300048903 Bacteria 951
358 Ga0496100_0641219 3300048903 Bacteria 827
359 Ga0496101_0642719 3300048904 Bacteria 838
360 Ga0496101_0747180 3300048904 Unclassified 772
361 Ga0496101_0889179 3300048904 Unclassified 701
362 Ga0496102_0011064 3300048905 Bacteria 7772
363 Ga0496102_0388509 3300048905 Bacteria 1313
364 Ga0496102_0684650 3300048905 Bacteria 948
365 Ga0496103_0011112 3300048906 Bacteria 5332
366 Ga0496104_0000977 3300048907 Bacteria 24462
367 Ga0496104_0467380 3300048907 Unclassified 1173
368 Ga0496104_0583218 3300048907 Bacteria 1028
369 Ga0496105_0006785 3300048908 Bacteria 8802
370 Ga0496105_0026672 3300048908 Bacteria 4715
371 Ga0496105_0071561 3300048908 Bacteria 2865
372 Ga0496105_0102886 3300048908 Bacteria 2359
373 Ga0496105_0113035 3300048908 Bacteria 2241
374 Ga0496105_0210991 3300048908 Bacteria 1583
375 Ga0496105_0500043 3300048908 Bacteria 954
376 Ga0496107_0517365 3300048910 Bacteria 885
377 Ga0496108_0006527 3300048911 Bacteria 9458
378 Ga0496108_0012998 3300048911 Bacteria 6782
379 Ga0496108_0028576 3300048911 Bacteria 4614
380 Ga0496108_0074291 3300048911 Bacteria 2870
381 Ga0496108_0182936 3300048911 Bacteria 1815
382 Ga0496108_0345583 3300048911 Bacteria 1298
383 Ga0496109_0001789 3300048912 Bacteria 17869
384 Ga0496109_0021370 3300048912 Bacteria 5722
385 Ga0496109_0126448 3300048912 Bacteria 2383
386 Ga0496109_0501747 3300048912 Bacteria 1145
387 Ga0496109_1309840 3300048912 Bacteria 660
388 Ga0496110_0277970 3300048913 Bacteria 1525
389 Ga0496110_0640849 3300048913 Bacteria 962
390 Ga0496110_1079508 3300048913 Bacteria 711
391 Ga0496111_0089620 3300048914 Bacteria 2253
392 Ga0496111_0330322 3300048914 Bacteria 1129
393 Ga0496111_0371335 3300048914 Bacteria 1058
394 Ga0496111_0934088 3300048914 Bacteria 624
395 Ga0496112_0047776 3300048915 Bacteria 4199
396 Ga0496112_0050857 3300048915 Bacteria 4064
397 Ga0496112_0109606 3300048915 Bacteria 2731
398 Ga0496112_0202467 3300048915 Bacteria 1944
399 Ga0496112_1167792 3300048915 Bacteria 687
400 Ga0496112_1409101 3300048915 Bacteria 611
401 Ga0496113_0123965 3300048916 Bacteria 2022
402 Ga0496113_0419147 3300048916 Bacteria 1075
403 Ga0496114_0114049 3300048917 Bacteria 2317
404 Ga0496114_0163449 3300048917 Bacteria 1937
405 Ga0496114_1245294 3300048917 Bacteria 630
406 Ga0496114_1303069 3300048917 Bacteria 613
407 Ga0496114_1530484 3300048917 Bacteria 555
408 Ga0496115_0039473 3300048918 Bacteria 3749
409 Ga0496115_0785697 3300048918 Bacteria 742
410 Ga0501067_0365549 3300049583 Bacteria 804
411 Ga0501069_0134680 3300049585 Bacteria 1416
412 nmdc:mga00v17_310410_c1 3300050491 Unclassified 1024
413 nmdc:mga0yw44_152170_c2 3300050492 Unclassified 827
414 nmdc:mga05p37_669032_c1 3300050507 Bacteria 1159
415 nmdc:mga0n895_382067_c1 3300050512 Bacteria 1425
416 nmdc:mga0n895_424542_c1 3300050512 Bacteria 1344
417 nmdc:mga08x19_67664_c1 3300050514 Bacteria 2323
418 Ga0495601_0000340 3300053077 Bacteria 24567
419 Ga0495601_0252899 3300053077 Bacteria 1150
420 Ga0495601_0444015 3300053077 Unclassified 839
421 Ga0495601_0494508 3300053077 Bacteria 789
422 Ga0495612_0041237 3300053078 Bacteria 1882
423 Ga0495595_0028771 3300053084 Bacteria 2483
424 Ga0495595_0229357 3300053084 Bacteria 927
425 Ga0495595_0242823 3300053084 Bacteria 901
426 Ga0495619_0004478 3300053085 Bacteria 8923
427 Ga0495619_0019945 3300053085 Bacteria 4265
428 Ga0495619_0162951 3300053085 Bacteria 1540
429 Ga0495619_0353573 3300053085 Bacteria 1016
430 Ga0495619_0469503 3300053085 Unclassified 867
431 Ga0500566_0183223 3300053094 Bacteria 1072
432 Ga0500566_0465907 3300053094 Bacteria 550
433 Ga0466962_0069227 3300061719 Bacteria 1685
434 Ga0466962_0075430 3300061719 Bacteria 1611
435 Ga0466962_0153132 3300061719 Bacteria 1119

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025912 Ga0207707_10437695 Ga0207707_104376952 77
2 3300025917 Ga0207660_10135876 Ga0207660_101358762 77
3 3300025921 Ga0207652_10152074 Ga0207652_101520742 77
4 3300006163 Ga0070715_10020309 Ga0070715_100203092 83
5 3300044735 Ga0466968_0321484 Ga0466968_0321484_152_463 83
6 3300045976 Ga0466967_0078344 Ga0466967_0078344_239_547 84
7 3300044693 Ga0466961_0097270 Ga0466961_0097270_952_1260 86
8 3300044706 Ga0466964_0047594 Ga0466964_0047594_205_513 86
9 3300044706 Ga0466964_0111389 Ga0466964_0111389_86_394 86
10 3300044719 Ga0466971_0118918 Ga0466971_0118918_488_796 86
11 3300044765 Ga0466970_0100954 Ga0466970_0100954_769_1077 86
12 3300045049 Ga0466959_0270940 Ga0466959_0270940_160_468 86
13 3300045976 Ga0466967_0081931 Ga0466967_0081931_1267_1569 86
14 3300061719 Ga0466962_0075430 Ga0466962_0075430_533_841 86
15 3300034816 Ga0373930_0073744 Ga0373930_0073744_330_638 87
16 3300035119 Ga0373956_0304114 Ga0373956_0304114_232_543 87
17 3300035410 Ga0373924_0483357 Ga0373924_0483357_32_343 87
18 3300036401 Ga0373937_0000548 Ga0373937_0000548_28360_28671 87
19 3300044706 Ga0466964_0012292 Ga0466964_0012292_1547_1855 87
20 3300045976 Ga0466967_0040677 Ga0466967_0040677_3213_3521 87
21 3300046454 Ga0495592_0000597 Ga0495592_0000597_4462_4773 87
22 3300046462 Ga0495651_0000008 Ga0495651_0000008_135982_136293 87
23 3300046463 Ga0495653_0000725 Ga0495653_0000725_4405_4716 87
24 3300046514 Ga0495618_0014448 Ga0495618_0014448_3455_3766 87
25 3300046516 Ga0495628_0000105 Ga0495628_0000105_21051_21362 87
26 3300046529 Ga0495652_0001221 Ga0495652_0001221_24050_24361 87
27 3300046536 Ga0495587_0000048 Ga0495587_0000048_24051_24362 87
28 3300046543 Ga0495645_0000029 Ga0495645_0000029_88758_89069 87
29 3300046559 Ga0495667_0346351 Ga0495667_0346351_52_363 87
30 3300046675 Ga0495657_0026870 Ga0495657_0026870_1929_2240 87
31 3300046678 Ga0495599_0000110 Ga0495599_0000110_24050_24361 87
32 3300046679 Ga0495623_0000379 Ga0495623_0000379_4790_5101 87
33 3300046680 Ga0495646_0007711 Ga0495646_0007711_1480_1791 87
34 3300046809 Ga0495600_0038666 Ga0495600_0038666_794_1105 87
35 3300047317 Ga0495604_0000687 Ga0495604_0000687_4328_4639 87
36 3300047322 Ga0495680_0013363 Ga0495680_0013363_2409_2720 87
37 3300047444 Ga0495675_0000419 Ga0495675_0000419_24036_24347 87
38 3300048088 Ga0495602_0001409 Ga0495602_0001409_20393_20704 87
39 3300053077 Ga0495601_0000340 Ga0495601_0000340_3581_3892 87
40 3300053084 Ga0495595_0242823 Ga0495595_0242823_467_778 87
41 3300053085 Ga0495619_0004478 Ga0495619_0004478_4433_4744 87
42 3300005468 Ga0070707_100637895 Ga0070707_1006378952 88
43 3300006175 Ga0070712_100489564 Ga0070712_1004895641 88
44 3300006358 Ga0068871_101280957 Ga0068871_1012809572 88
45 3300025922 Ga0207646_10645084 Ga0207646_106450842 88
46 3300025934 Ga0207686_11473342 Ga0207686_114733421 88
47 3300044901 Ga0466960_0342398 Ga0466960_0342398_431_697 88
48 3300046452 Ga0495617_274068 Ga0495617_274068_57_365 88
49 3300048907 Ga0496104_0583218 Ga0496104_0583218_18_326 88
50 3300048908 Ga0496105_0071561 Ga0496105_0071561_2243_2551 88
51 3300048911 Ga0496108_0028576 Ga0496108_0028576_2282_2590 88
52 3300048912 Ga0496109_0126448 Ga0496109_0126448_1432_1740 88
53 3300048917 Ga0496114_1245294 Ga0496114_1245294_181_489 88
54 3300005336 Ga0070680_100147041 Ga0070680_1001470411 89
55 3300005337 Ga0070682_100855342 Ga0070682_1008553422 89
56 3300005458 Ga0070681_10099857 Ga0070681_100998572 89
57 3300013307 Ga0157372_11460960 Ga0157372_114609602 89
58 3300036401 Ga0373937_0896800 Ga0373937_0896800_117_428 89
59 3300045976 Ga0466967_2569438 Ga0466967_2569438_22_333 89
60 3300046459 Ga0495629_0001473 Ga0495629_0001473_11111_11419 89
61 3300046459 Ga0495629_0191938 Ga0495629_0191938_351_659 89
62 3300046462 Ga0495651_0043470 Ga0495651_0043470_817_1128 89
63 3300046473 Ga0495582_0374239 Ga0495582_0374239_460_768 89
64 3300046559 Ga0495667_0090250 Ga0495667_0090250_549_860 89
65 3300046663 Ga0495635_0031336 Ga0495635_0031336_1630_1938 89
66 3300046675 Ga0495657_0016661 Ga0495657_0016661_4342_4653 89
67 3300046689 Ga0495613_0206382 Ga0495613_0206382_768_1076 89
68 3300048918 Ga0496115_0039473 Ga0496115_0039473_1657_1965 89
69 3300053084 Ga0495595_0028771 Ga0495595_0028771_901_1212 89
70 3300053085 Ga0495619_0469503 Ga0495619_0469503_430_741 89
71 3300053094 Ga0500566_0183223 Ga0500566_0183223_451_759 89
72 3300005435 Ga0070714_100942152 Ga0070714_1009421522 90
73 3300005535 Ga0070684_100198642 Ga0070684_1001986422 90
74 3300005548 Ga0070665_102218777 Ga0070665_1022187772 90
75 3300005563 Ga0068855_100294419 Ga0068855_1002944194 90
76 3300005564 Ga0070664_100602915 Ga0070664_1006029152 90
77 3300005614 Ga0068856_100046139 Ga0068856_1000461394 90
78 3300005614 Ga0068856_100313034 Ga0068856_1003130342 90
79 3300005614 Ga0068856_101168941 Ga0068856_1011689412 90
80 3300005616 Ga0068852_101066079 Ga0068852_1010660792 90
81 3300005618 Ga0068864_100462591 Ga0068864_1004625912 90
82 3300006028 Ga0070717_11826818 Ga0070717_118268182 90
83 3300006237 Ga0097621_100079697 Ga0097621_1000796972 90
84 3300006881 Ga0068865_100163296 Ga0068865_1001632962 90
85 3300020070 Ga0206356_10242922 Ga0206356_102429222 90
86 3300020070 Ga0206356_11688088 Ga0206356_116880882 90
87 3300020082 Ga0206353_10246071 Ga0206353_102460712 90
88 3300022467 Ga0224712_10535334 Ga0224712_105353342 90
89 3300025909 Ga0207705_10259272 Ga0207705_102592722 90
90 3300025913 Ga0207695_10457838 Ga0207695_104578383 90
91 3300025917 Ga0207660_10229986 Ga0207660_102299861 90
92 3300025919 Ga0207657_10015732 Ga0207657_100157327 90
93 3300025920 Ga0207649_10748520 Ga0207649_107485202 90
94 3300025922 Ga0207646_10002421 Ga0207646_1000242121 90
95 3300025924 Ga0207694_10431560 Ga0207694_104315602 90
96 3300025924 Ga0207694_11339382 Ga0207694_113393822 90
97 3300025928 Ga0207700_10669788 Ga0207700_106697882 90
98 3300025932 Ga0207690_10041781 Ga0207690_100417812 90
99 3300025933 Ga0207706_10550194 Ga0207706_105501942 90
100 3300025934 Ga0207686_10096539 Ga0207686_100965392 90
101 3300025944 Ga0207661_10384586 Ga0207661_103845864 90
102 3300025945 Ga0207679_10252419 Ga0207679_102524192 90
103 3300026078 Ga0207702_11213928 Ga0207702_112139282 90
104 3300026095 Ga0207676_10463861 Ga0207676_104638612 90
105 3300026142 Ga0207698_10562509 Ga0207698_105625093 90
106 3300034820 Ga0373959_0138743 Ga0373959_0138743_318_590 90
107 3300044693 Ga0466961_0425940 Ga0466961_0425940_69_377 90
108 3300044735 Ga0466968_0079345 Ga0466968_0079345_595_894 90
109 3300045049 Ga0466959_0170173 Ga0466959_0170173_886_1194 90
110 3300045976 Ga0466967_1141238 Ga0466967_1141238_33_305 90
111 3300045976 Ga0466967_1227445 Ga0466967_1227445_379_678 90
112 3300053094 Ga0500566_0465907 Ga0500566_0465907_10_282 90
113 3300048907 Ga0496104_0000977 Ga0496104_0000977_6217_6525 91
114 3300048908 Ga0496105_0006785 Ga0496105_0006785_2204_2512 91
115 3300048911 Ga0496108_0006527 Ga0496108_0006527_4732_5040 91
116 3300048912 Ga0496109_0001789 Ga0496109_0001789_12994_13302 91
117 3300048913 Ga0496110_0640849 Ga0496110_0640849_148_456 91
118 3300048914 Ga0496111_0371335 Ga0496111_0371335_377_685 91
119 3300048915 Ga0496112_0202467 Ga0496112_0202467_329_637 91
120 3300048916 Ga0496113_0419147 Ga0496113_0419147_399_707 91
121 3300026116 Ga0207674_11105960 Ga0207674_111059602 92
122 3300044694 Ga0466963_0433169 Ga0466963_0433169_329_631 93
123 3300045976 Ga0466967_0030006 Ga0466967_0030006_1499_1801 93
124 3300049583 Ga0501067_0365549 Ga0501067_0365549_425_733 94
125 3300044694 Ga0466963_1268534 Ga0466963_1268534_73_360 95
126 3300045836 Ga0466958_1041047 Ga0466958_1041047_234_521 95
127 3300061719 Ga0466962_0153132 Ga0466962_0153132_140_427 95
128 3300045976 Ga0466967_0943495 Ga0466967_0943495_33_341 96
129 3300046455 Ga0495603_0355146 Ga0495603_0355146_135_443 96
130 3300005563 Ga0068855_101165779 Ga0068855_1011657792 97
131 3300005564 Ga0070664_100716754 Ga0070664_1007167542 97
132 3300005614 Ga0068856_101759699 Ga0068856_1017596991 97
133 3300006028 Ga0070717_10036844 Ga0070717_100368445 97
134 3300006914 Ga0075436_100153381 Ga0075436_1001533812 97
135 3300009551 Ga0105238_13025239 Ga0105238_130252391 97
136 3300025898 Ga0207692_10696099 Ga0207692_106960992 97
137 3300025915 Ga0207693_10821911 Ga0207693_108219112 97
138 3300025939 Ga0207665_10000197 Ga0207665_1000019723 97
139 3300025941 Ga0207711_11176696 Ga0207711_111766962 97
140 3300026078 Ga0207702_11784637 Ga0207702_117846372 97
141 3300041459 Ga0451800_1373213 Ga0451800_1373213_117_410 97
142 3300041460 Ga0451802_1136725 Ga0451802_1136725_19_312 97
143 3300041512 Ga0451853_0240863 Ga0451853_0240863_394_687 97
144 3300046459 Ga0495629_0490547 Ga0495629_0490547_135_443 97
145 3300048903 Ga0496100_0641219 Ga0496100_0641219_170_463 97
146 3300048904 Ga0496101_0889179 Ga0496101_0889179_396_689 97
147 3300048907 Ga0496104_0467380 Ga0496104_0467380_298_591 97
148 3300048908 Ga0496105_0102886 Ga0496105_0102886_1009_1302 97
149 3300048911 Ga0496108_0012998 Ga0496108_0012998_5772_6065 97
150 3300048913 Ga0496110_0277970 Ga0496110_0277970_721_1014 97
151 3300048914 Ga0496111_0089620 Ga0496111_0089620_1009_1302 97
152 3300048915 Ga0496112_0047776 Ga0496112_0047776_336_629 97
153 3300048915 Ga0496112_0050857 Ga0496112_0050857_2627_2920 97
154 3300048917 Ga0496114_1303069 Ga0496114_1303069_129_422 97
155 3300049585 Ga0501069_0134680 Ga0501069_0134680_929_1222 97
156 3300021377 Ga0213874_10124900 Ga0213874_101249002 98
157 3300039450 Ga0436363_1653846 Ga0436363_1653846_794_1090 98
158 3300048914 Ga0496111_0934088 Ga0496111_0934088_238_534 98
159 3300005356 Ga0070674_101013666 Ga0070674_1010136662 99
160 3300005471 Ga0070698_100267157 Ga0070698_1002671572 99
161 3300005518 Ga0070699_101278382 Ga0070699_1012783822 99
162 3300005937 Ga0081455_10078963 Ga0081455_100789632 99
163 3300006038 Ga0075365_10009701 Ga0075365_100097017 99
164 3300006051 Ga0075364_10420709 Ga0075364_104207092 99
165 3300025937 Ga0207669_10830475 Ga0207669_108304752 99
166 3300026121 Ga0207683_10370162 Ga0207683_103701622 99
167 3300035691 Ga0373931_0653730 Ga0373931_0653730_199_498 99
168 3300037418 Ga0395900_0307310 Ga0395900_0307310_676_975 99
169 3300038443 Ga0395901_0344226 Ga0395901_0344226_342_641 99
170 3300044706 Ga0466964_0087423 Ga0466964_0087423_510_809 99
171 3300044735 Ga0466968_0000642 Ga0466968_0000642_7747_8046 99
172 3300044901 Ga0466960_0004515 Ga0466960_0004515_3665_3964 99
173 3300045976 Ga0466967_0010413 Ga0466967_0010413_405_704 99
174 3300050491 nmdc:mga00v17_310410_c1 nmdc:mga00v17_310410_c1_506_805 99
175 3300050492 nmdc:mga0yw44_152170_c2 nmdc:mga0yw44_152170_c2_208_507 99
176 3300006871 Ga0075434_100416277 Ga0075434_1004162774 100
177 3300028563 Ga0265319_1033239 Ga0265319_10332392 100
178 3300028666 Ga0265336_10055948 Ga0265336_100559482 100
179 3300028800 Ga0265338_10129352 Ga0265338_101293524 100
180 3300031240 Ga0265320_10229505 Ga0265320_102295052 100
181 3300031251 Ga0265327_10295451 Ga0265327_102954512 100
182 3300031344 Ga0265316_10384193 Ga0265316_103841932 100
183 3300037312 Ga0395899_0097791 Ga0395899_0097791_938_1246 100
184 3300037418 Ga0395900_1722293 Ga0395900_1722293_11_319 100
185 3300037466 Ga0395898_0059286 Ga0395898_0059286_868_1176 100
186 3300037471 Ga0395905_0040216 Ga0395905_0040216_2046_2354 100
187 3300038443 Ga0395901_1081196 Ga0395901_1081196_108_416 100
188 3300044842 Ga0466957_1023351 Ga0466957_1023351_115_420 100
189 3300046463 Ga0495653_0479656 Ga0495653_0479656_465_767 100
190 3300047317 Ga0495604_0268506 Ga0495604_0268506_353_655 100
191 3300050507 nmdc:mga05p37_669032_c1 nmdc:mga05p37_669032_c1_754_1062 100
192 3300050512 nmdc:mga0n895_382067_c1 nmdc:mga0n895_382067_c1_825_1133 100
193 3300005329 Ga0070683_100248005 Ga0070683_1002480052 102
194 3300005329 Ga0070683_101046930 Ga0070683_1010469302 102
195 3300005336 Ga0070680_100588776 Ga0070680_1005887762 102
196 3300005337 Ga0070682_100805140 Ga0070682_1008051402 102
197 3300005339 Ga0070660_100405640 Ga0070660_1004056402 102
198 3300005341 Ga0070691_10105068 Ga0070691_101050682 102
199 3300005345 Ga0070692_10217356 Ga0070692_102173562 102
200 3300005366 Ga0070659_100088397 Ga0070659_1000883972 102
201 3300005434 Ga0070709_10464575 Ga0070709_104645752 102
202 3300005435 Ga0070714_100145677 Ga0070714_1001456774 102
203 3300005435 Ga0070714_100217655 Ga0070714_1002176552 102
204 3300005435 Ga0070714_101829563 Ga0070714_1018295631 102
205 3300005436 Ga0070713_100373319 Ga0070713_1003733194 102
206 3300005436 Ga0070713_100799971 Ga0070713_1007999712 102
207 3300005436 Ga0070713_101673803 Ga0070713_1016738032 102
208 3300005439 Ga0070711_100102404 Ga0070711_1001024042 102
209 3300005439 Ga0070711_100449600 Ga0070711_1004496002 102
210 3300005440 Ga0070705_100321186 Ga0070705_1003211863 102
211 3300005455 Ga0070663_100835037 Ga0070663_1008350372 102
212 3300005457 Ga0070662_101366518 Ga0070662_1013665182 102
213 3300005458 Ga0070681_10165708 Ga0070681_101657082 102
214 3300005530 Ga0070679_100051690 Ga0070679_1000516902 102
215 3300005535 Ga0070684_100155028 Ga0070684_1001550283 102
216 3300005535 Ga0070684_100441134 Ga0070684_1004411342 102
217 3300005535 Ga0070684_100552548 Ga0070684_1005525482 102
218 3300005536 Ga0070697_101530548 Ga0070697_1015305482 102
219 3300005545 Ga0070695_100000023 Ga0070695_10000002322 102
220 3300005546 Ga0070696_100250873 Ga0070696_1002508732 102
221 3300005563 Ga0068855_100866959 Ga0068855_1008669592 102
222 3300006028 Ga0070717_10215703 Ga0070717_102157034 102
223 3300006173 Ga0070716_100237694 Ga0070716_1002376942 102
224 3300009093 Ga0105240_10072593 Ga0105240_100725936 102
225 3300009093 Ga0105240_10297307 Ga0105240_102973074 102
226 3300009093 Ga0105240_11254813 Ga0105240_112548132 102
227 3300009098 Ga0105245_10074335 Ga0105245_100743355 102
228 3300009176 Ga0105242_10154230 Ga0105242_101542302 102
229 3300009551 Ga0105238_10223556 Ga0105238_102235564 102
230 3300009551 Ga0105238_11206712 Ga0105238_112067122 102
231 3300010375 Ga0105239_10289690 Ga0105239_102896901 102
232 3300010375 Ga0105239_11146577 Ga0105239_111465772 102
233 3300013105 Ga0157369_10045666 Ga0157369_100456664 102
234 3300013105 Ga0157369_10058990 Ga0157369_100589902 102
235 3300013105 Ga0157369_10507135 Ga0157369_105071352 102
236 3300013296 Ga0157374_10543857 Ga0157374_105438572 102
237 3300013307 Ga0157372_10359490 Ga0157372_103594902 102
238 3300013307 Ga0157372_10565894 Ga0157372_105658942 102
239 3300013308 Ga0157375_10614496 Ga0157375_106144962 102
240 3300014497 Ga0182008_10117637 Ga0182008_101176372 102
241 3300014968 Ga0157379_10465459 Ga0157379_104654592 102
242 3300014969 Ga0157376_10014354 Ga0157376_100143542 102
243 3300025906 Ga0207699_10311634 Ga0207699_103116342 102
244 3300025913 Ga0207695_10595537 Ga0207695_105955372 102
245 3300025929 Ga0207664_10168682 Ga0207664_101686822 102
246 3300025929 Ga0207664_10373849 Ga0207664_103738494 102
247 3300025939 Ga0207665_10552734 Ga0207665_105527342 102
248 3300026078 Ga0207702_10979621 Ga0207702_109796212 102
249 3300026121 Ga0207683_11061875 Ga0207683_110618752 102
250 3300035111 Ga0373923_0472149 Ga0373923_0472149_148_456 102
251 3300035116 Ga0373945_0005244 Ga0373945_0005244_1747_2055 102
252 3300035170 Ga0373943_0004575 Ga0373943_0004575_4217_4525 102
253 3300035207 Ga0373942_0076644 Ga0373942_0076644_48_356 102
254 3300035692 Ga0373935_0129384 Ga0373935_0129384_934_1242 102
255 3300035695 Ga0373927_0026313 Ga0373927_0026313_235_543 102
256 3300035724 Ga0373933_0779618 Ga0373933_0779618_51_359 102
257 3300035725 Ga0373947_0005033 Ga0373947_0005033_23_331 102
258 3300036401 Ga0373937_0775331 Ga0373937_0775331_139_447 102
259 3300037068 Ga0373925_0001456 Ga0373925_0001456_18161_18469 102
260 3300037418 Ga0395900_0050079 Ga0395900_0050079_2989_3297 102
261 3300037466 Ga0395898_0123193 Ga0395898_0123193_157_465 102
262 3300037466 Ga0395898_0778058 Ga0395898_0778058_319_627 102
263 3300037466 Ga0395898_1220958 Ga0395898_1220958_97_408 102
264 3300037471 Ga0395905_0221235 Ga0395905_0221235_751_1059 102
265 3300038443 Ga0395901_1676844 Ga0395901_1676844_17_325 102
266 3300044693 Ga0466961_0430255 Ga0466961_0430255_148_456 102
267 3300044694 Ga0466963_0000261 Ga0466963_0000261_5510_5818 102
268 3300044694 Ga0466963_0003462 Ga0466963_0003462_1488_1796 102
269 3300044694 Ga0466963_0005668 Ga0466963_0005668_6346_6654 102
270 3300044694 Ga0466963_0009427 Ga0466963_0009427_2480_2788 102
271 3300044694 Ga0466963_0023530 Ga0466963_0023530_2198_2506 102
272 3300044694 Ga0466963_0034912 Ga0466963_0034912_569_877 102
273 3300044694 Ga0466963_0195336 Ga0466963_0195336_975_1283 102
274 3300044694 Ga0466963_0265506 Ga0466963_0265506_330_638 102
275 3300044694 Ga0466963_0955581 Ga0466963_0955581_189_497 102
276 3300044706 Ga0466964_0161508 Ga0466964_0161508_622_933 102
277 3300044735 Ga0466968_0007872 Ga0466968_0007872_2481_2789 102
278 3300044735 Ga0466968_0023087 Ga0466968_0023087_1101_1409 102
279 3300044735 Ga0466968_0080658 Ga0466968_0080658_165_473 102
280 3300044765 Ga0466970_0291658 Ga0466970_0291658_92_400 102
281 3300044842 Ga0466957_0022317 Ga0466957_0022317_2073_2381 102
282 3300044842 Ga0466957_0022370 Ga0466957_0022370_3349_3657 102
283 3300044842 Ga0466957_0036234 Ga0466957_0036234_2182_2490 102
284 3300044842 Ga0466957_0135813 Ga0466957_0135813_935_1243 102
285 3300044901 Ga0466960_0512753 Ga0466960_0512753_69_377 102
286 3300045049 Ga0466959_0362497 Ga0466959_0362497_186_494 102
287 3300045836 Ga0466958_0014327 Ga0466958_0014327_944_1252 102
288 3300045836 Ga0466958_0030553 Ga0466958_0030553_2797_3105 102
289 3300045836 Ga0466958_0063249 Ga0466958_0063249_1067_1375 102
290 3300045836 Ga0466958_0977018 Ga0466958_0977018_129_437 102
291 3300045976 Ga0466967_0000470 Ga0466967_0000470_5293_5601 102
292 3300045976 Ga0466967_0006755 Ga0466967_0006755_5275_5583 102
293 3300045976 Ga0466967_0009734 Ga0466967_0009734_1671_1979 102
294 3300045976 Ga0466967_0415253 Ga0466967_0415253_373_684 102
295 3300045976 Ga0466967_0445837 Ga0466967_0445837_600_908 102
296 3300045976 Ga0466967_0449336 Ga0466967_0449336_612_920 102
297 3300045976 Ga0466967_0489145 Ga0466967_0489145_459_767 102
298 3300045976 Ga0466967_0523323 Ga0466967_0523323_95_403 102
299 3300045976 Ga0466967_0548658 Ga0466967_0548658_312_620 102
300 3300045976 Ga0466967_0692134 Ga0466967_0692134_592_900 102
301 3300045976 Ga0466967_1025853 Ga0466967_1025853_141_449 102
302 3300046454 Ga0495592_0309567 Ga0495592_0309567_373_681 102
303 3300046454 Ga0495592_0566731 Ga0495592_0566731_74_382 102
304 3300046455 Ga0495603_0306467 Ga0495603_0306467_412_720 102
305 3300046459 Ga0495629_0021747 Ga0495629_0021747_1573_1881 102
306 3300046461 Ga0495641_0001513 Ga0495641_0001513_3525_3833 102
307 3300046461 Ga0495641_0029286 Ga0495641_0029286_852_1160 102
308 3300046461 Ga0495641_0277989 Ga0495641_0277989_428_736 102
309 3300046462 Ga0495651_0841869 Ga0495651_0841869_102_410 102
310 3300046463 Ga0495653_0070765 Ga0495653_0070765_19_327 102
311 3300046463 Ga0495653_0078918 Ga0495653_0078918_1888_2196 102
312 3300046463 Ga0495653_0921963 Ga0495653_0921963_158_466 102
313 3300046472 Ga0495580_0986315 Ga0495580_0986315_102_410 102
314 3300046473 Ga0495582_0079126 Ga0495582_0079126_1267_1575 102
315 3300046473 Ga0495582_0113177 Ga0495582_0113177_259_567 102
316 3300046473 Ga0495582_0163418 Ga0495582_0163418_870_1178 102
317 3300046473 Ga0495582_0513857 Ga0495582_0513857_364_672 102
318 3300046474 Ga0495605_0053872 Ga0495605_0053872_423_731 102
319 3300046475 Ga0495639_0059589 Ga0495639_0059589_1161_1469 102
320 3300046475 Ga0495639_0453702 Ga0495639_0453702_55_363 102
321 3300046476 Ga0495662_0002877 Ga0495662_0002877_755_1063 102
322 3300046476 Ga0495662_0044459 Ga0495662_0044459_682_990 102
323 3300046477 Ga0495664_0008288 Ga0495664_0008288_5090_5398 102
324 3300046477 Ga0495664_0315229 Ga0495664_0315229_74_382 102
325 3300046477 Ga0495664_0394243 Ga0495664_0394243_279_587 102
326 3300046499 Ga0495594_0060684 Ga0495594_0060684_493_801 102
327 3300046499 Ga0495594_0081605 Ga0495594_0081605_1427_1735 102
328 3300046511 Ga0495608_0070774 Ga0495608_0070774_703_1011 102
329 3300046514 Ga0495618_0002855 Ga0495618_0002855_5010_5318 102
330 3300046514 Ga0495618_0092061 Ga0495618_0092061_1102_1410 102
331 3300046516 Ga0495628_0381372 Ga0495628_0381372_245_553 102
332 3300046517 Ga0495630_0005583 Ga0495630_0005583_1800_2108 102
333 3300046517 Ga0495630_0107922 Ga0495630_0107922_324_632 102
334 3300046517 Ga0495630_0861832 Ga0495630_0861832_117_425 102
335 3300046517 Ga0495630_1415786 Ga0495630_1415786_123_431 102
336 3300046518 Ga0495631_0108108 Ga0495631_0108108_449_757 102
337 3300046523 Ga0495644_0006079 Ga0495644_0006079_1843_2151 102
338 3300046525 Ga0495663_0213175 Ga0495663_0213175_296_604 102
339 3300046528 Ga0495642_0064331 Ga0495642_0064331_98_406 102
340 3300046529 Ga0495652_0266879 Ga0495652_0266879_200_508 102
341 3300046531 Ga0495665_0005405 Ga0495665_0005405_636_944 102
342 3300046533 Ga0495640_0014828 Ga0495640_0014828_1973_2281 102
343 3300046533 Ga0495640_0225090 Ga0495640_0225090_158_466 102
344 3300046535 Ga0495586_0191438 Ga0495586_0191438_104_412 102
345 3300046539 Ga0495621_0079966 Ga0495621_0079966_141_449 102
346 3300046543 Ga0495645_0164836 Ga0495645_0164836_592_900 102
347 3300046558 Ga0495633_0232466 Ga0495633_0232466_367_675 102
348 3300046559 Ga0495667_0070901 Ga0495667_0070901_784_1092 102
349 3300046559 Ga0495667_0151025 Ga0495667_0151025_988_1296 102
350 3300046559 Ga0495667_0459311 Ga0495667_0459311_109_417 102
351 3300046615 Ga0495656_0091712 Ga0495656_0091712_796_1104 102
352 3300046616 Ga0495668_0449674 Ga0495668_0449674_192_500 102
353 3300046642 Ga0495634_0021598 Ga0495634_0021598_3857_4165 102
354 3300046642 Ga0495634_0141173 Ga0495634_0141173_820_1128 102
355 3300046642 Ga0495634_0443251 Ga0495634_0443251_434_742 102
356 3300046648 Ga0495611_0060976 Ga0495611_0060976_708_1016 102
357 3300046663 Ga0495635_0443678 Ga0495635_0443678_229_537 102
358 3300046664 Ga0495659_0067487 Ga0495659_0067487_278_586 102
359 3300046680 Ga0495646_0447601 Ga0495646_0447601_178_486 102
360 3300046681 Ga0495647_0000245 Ga0495647_0000245_399_707 102
361 3300046681 Ga0495647_0050385 Ga0495647_0050385_750_1058 102
362 3300046681 Ga0495647_0334383 Ga0495647_0334383_103_411 102
363 3300046683 Ga0495658_0000675 Ga0495658_0000675_17391_17699 102
364 3300046683 Ga0495658_0133286 Ga0495658_0133286_333_641 102
365 3300046683 Ga0495658_0412696 Ga0495658_0412696_419_727 102
366 3300046683 Ga0495658_0877489 Ga0495658_0877489_119_427 102
367 3300046689 Ga0495613_0002533 Ga0495613_0002533_4983_5291 102
368 3300046689 Ga0495613_0026598 Ga0495613_0026598_3362_3670 102
369 3300046689 Ga0495613_0256748 Ga0495613_0256748_808_1116 102
370 3300046689 Ga0495613_0954927 Ga0495613_0954927_124_432 102
371 3300046690 Ga0495624_0008425 Ga0495624_0008425_2044_2352 102
372 3300046690 Ga0495624_0076897 Ga0495624_0076897_1475_1783 102
373 3300046691 Ga0495670_0221907 Ga0495670_0221907_122_430 102
374 3300046809 Ga0495600_0688918 Ga0495600_0688918_20_328 102
375 3300047315 Ga0495581_0007732 Ga0495581_0007732_691_999 102
376 3300047315 Ga0495581_0157929 Ga0495581_0157929_10_318 102
377 3300047315 Ga0495581_0681302 Ga0495581_0681302_128_436 102
378 3300047317 Ga0495604_0373000 Ga0495604_0373000_573_881 102
379 3300047319 Ga0495674_0051905 Ga0495674_0051905_2150_2458 102
380 3300047319 Ga0495674_0076182 Ga0495674_0076182_716_1024 102
381 3300047319 Ga0495674_0172243 Ga0495674_0172243_1477_1785 102
382 3300047319 Ga0495674_0899019 Ga0495674_0899019_272_580 102
383 3300047321 Ga0495676_0014258 Ga0495676_0014258_6482_6790 102
384 3300047321 Ga0495676_0049195 Ga0495676_0049195_528_836 102
385 3300047321 Ga0495676_0409703 Ga0495676_0409703_172_480 102
386 3300047321 Ga0495676_1111601 Ga0495676_1111601_180_488 102
387 3300047322 Ga0495680_0043442 Ga0495680_0043442_1544_1852 102
388 3300047445 Ga0495677_0091271 Ga0495677_0091271_11_319 102
389 3300047471 Ga0495684_0015084 Ga0495684_0015084_4194_4502 102
390 3300047471 Ga0495684_0018363 Ga0495684_0018363_1637_1945 102
391 3300047471 Ga0495684_0043476 Ga0495684_0043476_3060_3368 102
392 3300047673 Ga0495593_0003361 Ga0495593_0003361_8824_9132 102
393 3300047673 Ga0495593_0132245 Ga0495593_0132245_313_621 102
394 3300048089 Ga0495614_0048118 Ga0495614_0048118_839_1147 102
395 3300048903 Ga0496100_0199569 Ga0496100_0199569_1074_1382 102
396 3300048903 Ga0496100_0412082 Ga0496100_0412082_566_874 102
397 3300048903 Ga0496100_0484464 Ga0496100_0484464_462_770 102
398 3300048904 Ga0496101_0642719 Ga0496101_0642719_356_664 102
399 3300048904 Ga0496101_0747180 Ga0496101_0747180_160_468 102
400 3300048905 Ga0496102_0011064 Ga0496102_0011064_2341_2649 102
401 3300048905 Ga0496102_0388509 Ga0496102_0388509_932_1240 102
402 3300048905 Ga0496102_0684650 Ga0496102_0684650_598_906 102
403 3300048906 Ga0496103_0011112 Ga0496103_0011112_1078_1386 102
404 3300048908 Ga0496105_0026672 Ga0496105_0026672_3845_4153 102
405 3300048908 Ga0496105_0113035 Ga0496105_0113035_879_1187 102
406 3300048908 Ga0496105_0210991 Ga0496105_0210991_1140_1448 102
407 3300048908 Ga0496105_0500043 Ga0496105_0500043_574_882 102
408 3300048910 Ga0496107_0517365 Ga0496107_0517365_466_774 102
409 3300048911 Ga0496108_0074291 Ga0496108_0074291_627_935 102
410 3300048911 Ga0496108_0182936 Ga0496108_0182936_1379_1687 102
411 3300048911 Ga0496108_0345583 Ga0496108_0345583_123_431 102
412 3300048912 Ga0496109_0021370 Ga0496109_0021370_4981_5289 102
413 3300048912 Ga0496109_0501747 Ga0496109_0501747_160_468 102
414 3300048912 Ga0496109_1309840 Ga0496109_1309840_259_567 102
415 3300048913 Ga0496110_1079508 Ga0496110_1079508_74_382 102
416 3300048914 Ga0496111_0330322 Ga0496111_0330322_400_708 102
417 3300048915 Ga0496112_0109606 Ga0496112_0109606_1100_1408 102
418 3300048915 Ga0496112_1167792 Ga0496112_1167792_220_528 102
419 3300048915 Ga0496112_1409101 Ga0496112_1409101_64_372 102
420 3300048916 Ga0496113_0123965 Ga0496113_0123965_586_894 102
421 3300048917 Ga0496114_0114049 Ga0496114_0114049_605_913 102
422 3300048917 Ga0496114_0163449 Ga0496114_0163449_1511_1819 102
423 3300048917 Ga0496114_1530484 Ga0496114_1530484_62_370 102
424 3300048918 Ga0496115_0785697 Ga0496115_0785697_20_328 102
425 3300050512 nmdc:mga0n895_424542_c1 nmdc:mga0n895_424542_c1_122_430 102
426 3300050514 nmdc:mga08x19_67664_c1 nmdc:mga08x19_67664_c1_882_1190 102
427 3300053077 Ga0495601_0252899 Ga0495601_0252899_568_876 102
428 3300053077 Ga0495601_0444015 Ga0495601_0444015_296_604 102
429 3300053077 Ga0495601_0494508 Ga0495601_0494508_158_466 102
430 3300053078 Ga0495612_0041237 Ga0495612_0041237_592_900 102
431 3300053084 Ga0495595_0229357 Ga0495595_0229357_543_851 102
432 3300053085 Ga0495619_0019945 Ga0495619_0019945_3021_3329 102
433 3300053085 Ga0495619_0162951 Ga0495619_0162951_1015_1323 102
434 3300053085 Ga0495619_0353573 Ga0495619_0353573_71_379 102
435 3300061719 Ga0466962_0069227 Ga0466962_0069227_30_338 102

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03780

Asp23

Asp23 family, cell envelope-related function

9

100

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wnu-assembly1.cif.gz_B mycobacterium tuberculosis rnase j complex with 7nt rna 0.8053 67 98
6h9p-assembly2.cif.gz_B mamm ctd e289d - manganese form 0.776 16 98
8j80-assembly1.cif.gz_A cryo-em structure of hznt7-fab complex in zinc state 1, determined in heterogeneous conformations- one subunit in an inward-facing zinc-bound and the other in an outward-facing zinc-unbound conformation 0.7674 17 98
6tm4-assembly1.cif.gz_BBB natl2 in complex with two molecules of salicylic acid 0.7656 15 96
8j7w-assembly1.cif.gz_A cryo-em structure of hznt7-fab complex in zinc state 2, determined in heterogeneous conformations- one subunit in an inward-facing zinc-bound and the other in an outward-facing zinc-bound conformation 0.7647 17 97
ID Description Score Start End Superfamily
af_P9WGZ9_456_558_3.10.20.580 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.8379 67 98 3.10.20.580
af_Q2FZ19_451_557_3.10.20.580 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.8359 63 98 3.10.20.580
af_Q2FZ59_8_116_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8226 11 100 3.30.300.20
af_Q2FY44_11_117_3.30.70.1350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain 0.8212 11 100 3.30.70.1350
3zq4E03 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.8135 63 98 3.10.20.580
ID Description Score Start End GO Terms
AF-A0A538LNK1-F1-model_v4 Asp23/Gls24 family envelope stress response protein 0.9841 13 100
AF-A0A3N9WMD9-F1-model_v4 deleted 0.9431 20 102
AF-A0A538H090-F1-model_v4 Asp23/Gls24 family envelope stress response protein 0.9381 4 100
AF-A0A7V4MZJ2-F1-model_v4 Asp23/Gls24 family envelope stress response protein 0.9378 15 102
AF-A0A3C0QRZ1-F1-model_v4 Asp23/Gls24 family envelope stress response protein 0.9336 15 102

Feature Viewer

pLDDT pTM Quality
87.41 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map