F443261

General Info

Members Datasets Scaffolds Average Seq Length
435 257 423 260

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100177995|Ga0068869_1001779952
Length 286
Sequence MKKKRKKYSAAMPPDFITCNYNRVMDLLLKDKVIIVTGGAKGIGEGIVKVLAKEGAIPVIVGRNREDNQKTATAVMADGGKTFEVVAELSDPKTCEQAVKEVIEQLGRIDGLVNNAGVNDGVGLENGNYQNFLASLHKNVIHYYLMAHFALPELKKSKGSIVNITSKTADTGQGGTSAYAASNGGRNAMTREWAVELLKYRIRVNAVSVAECYTPLYARWIESLPNPKEKLKEIESKIPLGNRMTTAEEIANMVAFLLSERSSHTTGQIIHVDGGYVHLDRALANA

Samples

Sample ID Description Type Environment
1 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2738541284 Pedobacter sp. YR016 Isolate Unclassified
5 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
6 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
7 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
8 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
9 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
10 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
11 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
12 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
13 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
17 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
18 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
19 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
20 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
147 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
156 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
167 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
168 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
169 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
180 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
181 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
182 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
185 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
197 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
198 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
199 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
202 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
206 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
207 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
208 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
209 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
217 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
218 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
219 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
220 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
221 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
222 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
223 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
224 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
225 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
226 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
227 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
228 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
229 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
230 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
231 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
232 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
233 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
234 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
235 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
236 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
237 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
238 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
239 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
240 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
241 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
242 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
243 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
244 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
248 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
249 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
250 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
251 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
252 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
253 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
254 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
255 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
256 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
257 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.55
Metatranscriptomes 0.46
Isolates 2.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.44
Nodule 0.69
Rhizoplane 0.92
Rhizosphere 86.67
Stem 0
Stem Tuber 0
Unclassified 5.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10002789 3300001989 Bacteria 6712
2 JGI24737J22298_10003672 3300001990 Bacteria 5405
3 JGI24735J21928_10000324 3300002067 Bacteria 16589
4 JGI25162J39368_1004274 3300002737 Bacteria 3426
5 JGI25164J39214_1000814 3300002772 Bacteria 11009
6 JGI25165J46597_1000663 3300003214 Bacteria 27797
7 rootH1_10076361 3300003316 Bacteria 9005
8 rootH2_10094331 3300003320 Bacteria 1385
9 rootH2_10235801 3300003320 Bacteria 3036
10 rootL2_10040638 3300003322 Bacteria 11356
11 rootH1_10009528 3300003323 Bacteria 31356
12 rootH1_10022931 3300003323 Bacteria 51976
13 rootH1_10052755 3300003323 Bacteria 3579
14 rootH1_10062224 3300003316 Bacteria 2902
15 rootH1_10062224 3300003323 Bacteria 11182
16 rootH1_10105002 3300003323 Bacteria 3186
17 rootH1_10311811 3300003323 Unclassified 1619
18 rootH1_10379409 3300003323 Bacteria 1169
19 Ga0055536_1024067 3300003781 Bacteria 1774
20 Ga0058863_11101084 3300004799 Bacteria 948
21 Ga0065165_1000501 3300005262 Bacteria 60618
22 Ga0065714_10004250 3300005288 Bacteria 8027
23 Ga0065714_10009525 3300005288 Bacteria 4173
24 Ga0065714_10013800 3300005288 Bacteria 2604
25 Ga0065714_10079471 3300005288 Bacteria 2514
26 Ga0065714_10139919 3300005288 Bacteria 1180
27 Ga0065704_10000226 3300005289 Bacteria 67111
28 Ga0065704_10119969 3300005289 Bacteria 1791
29 Ga0065707_10090632 3300005295 Bacteria 4100
30 Ga0070658_10129286 3300005327 Bacteria 2104
31 Ga0070658_10441001 3300005327 Bacteria 1121
32 Ga0070676_10078696 3300005328 Bacteria 1995
33 Ga0070683_100017779 3300005329 Bacteria 6282
34 Ga0070683_100167866 3300005329 Unclassified 2083
35 Ga0070670_100078328 3300005331 Bacteria 2839
36 Ga0070670_100244878 3300005331 Bacteria 1561
37 Ga0068869_100038656 3300005334 Bacteria 3403
38 Ga0068869_100177995 3300005334 Bacteria 1666
39 Ga0070666_10000375 3300005335 Bacteria 28142
40 Ga0070680_100015462 3300005336 Bacteria 5983
41 Ga0070680_100031279 3300005336 Bacteria 4279
42 Ga0070682_100000482 3300005337 Bacteria 25028
43 Ga0070682_100332961 3300005337 Bacteria 1126
44 Ga0068868_100131455 3300005338 Bacteria 2048
45 Ga0070660_100016725 3300005339 Bacteria 5332
46 Ga0070668_100002219 3300005347 Bacteria 14265
47 Ga0070669_100001299 3300005353 Bacteria 18039
48 Ga0070675_100004217 3300005354 Bacteria 10929
49 Ga0070671_100252694 3300005355 Bacteria 1497
50 Ga0070673_100102977 3300005364 Bacteria 2354
51 Ga0070688_100028086 3300005365 Bacteria 3355
52 Ga0070659_100001146 3300005366 Bacteria 19346
53 Ga0070659_100002774 3300005366 Bacteria 12470
54 Ga0070659_100337810 3300005366 Bacteria 1261
55 Ga0070667_100008498 3300005367 Bacteria 8512
56 Ga0070667_100224713 3300005367 Bacteria 1672
57 Ga0070700_100125275 3300005441 Bacteria 1726
58 Ga0070662_100012820 3300005457 Bacteria 5568
59 Ga0068867_100298589 3300005459 Bacteria 1327
60 Ga0070698_100336679 3300005471 Bacteria 1440
61 Ga0070679_100000549 3300005530 Bacteria 31843
62 Ga0070679_100005898 3300005530 Bacteria 11382
63 Ga0070679_100024113 3300005530 Bacteria 5961
64 Ga0070679_100069716 3300005530 Bacteria 3507
65 Ga0070679_100200938 3300005530 Unclassified 1959
66 Ga0070679_100594823 3300005530 Bacteria 1049
67 Ga0070679_100624425 3300005530 Bacteria 1021
68 Ga0070684_100019229 3300005535 Bacteria 5647
69 Ga0068853_100079978 3300005539 Bacteria 2859
70 Ga0068853_100181435 3300005539 Bacteria 1909
71 Ga0068853_100550687 3300005539 Bacteria 1093
72 Ga0070672_100109650 3300005543 Bacteria 2248
73 Ga0068855_100000019 3300005563 Bacteria 205963
74 Ga0068855_100000388 3300005563 Bacteria 54070
75 Ga0068855_100012783 3300005563 Bacteria 10126
76 Ga0068855_100013264 3300005563 Bacteria 9939
77 Ga0068855_100025873 3300005563 Bacteria 7018
78 Ga0068855_100027207 3300005563 Bacteria 6842
79 Ga0068855_100030245 3300005563 Bacteria 6478
80 Ga0068855_100444116 3300005563 Bacteria 1416
81 Ga0068857_100102605 3300005577 Bacteria 2568
82 Ga0068857_100669053 3300005577 Unclassified 985
83 Ga0068854_100008761 3300005578 Bacteria 6514
84 Ga0068854_100623402 3300005578 Bacteria 923
85 Ga0068856_100001034 3300005614 Bacteria 29577
86 Ga0068856_100075223 3300005614 Unclassified 3345
87 Ga0068856_100189912 3300005614 Bacteria 2068
88 Ga0068852_100025858 3300005616 Bacteria 4763
89 Ga0068852_100112751 3300005616 Bacteria 2475
90 Ga0068852_100615982 3300005616 Unclassified 1091
91 Ga0068859_100000086 3300005617 Bacteria 85696
92 Ga0068859_100039542 3300005617 Bacteria 4732
93 Ga0068864_100409164 3300005618 Bacteria 1290
94 Ga0068864_100740711 3300005618 Bacteria 963
95 Ga0068851_10025308 3300005834 Unclassified 2911
96 Ga0068870_10006552 3300005840 Bacteria 5137
97 Ga0068863_100013044 3300005841 Bacteria 8013
98 Ga0068863_100018526 3300005841 Bacteria 6663
99 Ga0068858_100002273 3300005842 Bacteria 19437
100 Ga0068858_100096352 3300005842 Bacteria 2757
101 Ga0068860_100002118 3300005843 Bacteria 20935
102 Ga0068860_100004278 3300005843 Bacteria 14603
103 Ga0081455_10118188 3300005937 Bacteria 2093
104 Ga0081539_10001743 3300005985 Bacteria 34704
105 Ga0075366_10002704 3300006195 Bacteria 9153
106 Ga0075366_10015888 3300006195 Bacteria 4320
107 Ga0075366_10077832 3300006195 Bacteria 1979
108 Ga0068871_100020799 3300006358 Bacteria 5033
109 Ga0068865_100627104 3300006881 Unclassified 911
110 Ga0097620_100000086 3300006931 Bacteria 85696
111 Ga0097620_100039542 3300006931 Bacteria 4732
112 Ga0099826_10059880 3300006948 Bacteria 2485
113 Ga0105240_10002660 3300009093 Bacteria 28423
114 Ga0105240_10063765 3300009093 Bacteria 4582
115 Ga0105240_10078201 3300009093 Bacteria 4074
116 Ga0105240_10172669 3300009093 Bacteria 2559
117 Ga0111539_10004188 3300009094 Bacteria 18932
118 Ga0111539_10022183 3300009094 Bacteria 7804
119 Ga0105245_10355338 3300009098 Bacteria 1453
120 Ga0105247_10002917 3300009101 Bacteria 11377
121 Ga0105243_10141359 3300009148 Bacteria 2054
122 Ga0105241_10000668 3300009174 Bacteria 25809
123 Ga0105241_10001385 3300009174 Bacteria 18527
124 Ga0105241_10015267 3300009174 Bacteria 5624
125 Ga0105241_10277378 3300009174 Bacteria 1430
126 Ga0105242_10376214 3300009176 Bacteria 1319
127 Ga0105237_10001001 3300009545 Bacteria 38035
128 Ga0105237_10001891 3300009545 Bacteria 26726
129 Ga0105237_10002720 3300009545 Bacteria 21581
130 Ga0105237_10011718 3300009545 Bacteria 9272
131 Ga0105237_10042255 3300009545 Bacteria 4598
132 Ga0105237_10144217 3300009545 Bacteria 2376
133 Ga0105237_10202771 3300009545 Bacteria 1984
134 Ga0105237_10202778 3300009545 Bacteria 1984
135 Ga0105237_10413352 3300009545 Bacteria 1354
136 Ga0105238_10011946 3300009551 Bacteria 8749
137 Ga0105238_10111589 3300009551 Bacteria 2714
138 Ga0105249_10003436 3300009553 Bacteria 13717
139 Ga0105239_10000004 3300010375 Bacteria 532483
140 Ga0105239_10000012 3300010375 Bacteria 332279
141 Ga0105239_10000249 3300010375 Bacteria 80515
142 Ga0105239_10000299 3300010375 Bacteria 73314
143 Ga0105239_10000976 3300010375 Bacteria 40167
144 Ga0105239_10002652 3300010375 Bacteria 22569
145 Ga0105239_10141943 3300010375 Bacteria 2677
146 Ga0105239_10154604 3300010375 Bacteria 2561
147 Ga0105239_10173365 3300010375 Unclassified 2413
148 Ga0157373_10000327 3300013100 Bacteria 38493
149 Ga0157373_10008374 3300013100 Bacteria 7681
150 Ga0157373_10050048 3300013100 Bacteria 2977
151 Ga0157373_10207440 3300013100 Bacteria 1381
152 Ga0157371_10023206 3300013102 Bacteria 4536
153 Ga0157371_10023855 3300013102 Unclassified 4471
154 Ga0157371_10028332 3300013102 Bacteria 4057
155 Ga0157371_10284657 3300013102 Unclassified 1195
156 Ga0157370_10000831 3300013104 Bacteria 39105
157 Ga0157370_10004819 3300013104 Bacteria 15338
158 Ga0157370_10085136 3300013104 Bacteria 2970
159 Ga0157370_10149180 3300013104 Unclassified 2176
160 Ga0157370_10283177 3300013104 Bacteria 1531
161 Ga0157370_10400819 3300013104 Bacteria 1263
162 Ga0157369_10010233 3300013105 Bacteria 10702
163 Ga0157369_10060549 3300013105 Bacteria 4082
164 Ga0157369_10508437 3300013105 Unclassified 1246
165 Ga0157374_10196854 3300013296 Unclassified 1972
166 Ga0157378_10017968 3300013297 Bacteria 6209
167 Ga0157378_10044100 3300013297 Bacteria 3960
168 Ga0163162_10003760 3300013306 Bacteria 14539
169 Ga0163162_10033338 3300013306 Bacteria 5117
170 Ga0157372_10000980 3300013307 Bacteria 31160
171 Ga0157372_10006396 3300013307 Bacteria 12533
172 Ga0157372_10006608 3300013307 Bacteria 12340
173 Ga0157372_10099048 3300013307 Bacteria 3325
174 Ga0157372_10112294 3300013307 Bacteria 3122
175 Ga0157372_10314118 3300013307 Bacteria 1824
176 Ga0157372_10444814 3300013307 Bacteria 1510
177 Ga0157372_10505936 3300013307 Unclassified 1408
178 Ga0157375_10021906 3300013308 Bacteria 5873
179 Ga0157375_10314087 3300013308 Bacteria 1731
180 Ga0163163_10651740 3300014325 Bacteria 1116
181 Ga0157380_10010487 3300014326 Bacteria 6666
182 Ga0157380_10162573 3300014326 Bacteria 1942
183 Ga0157380_10308635 3300014326 Unclassified 1461
184 Ga0182008_10000020 3300014497 Bacteria 228333
185 Ga0157377_10001601 3300014745 Bacteria 9848
186 Ga0157376_10044104 3300014969 Bacteria 3664
187 Ga0163161_10029273 3300017792 Bacteria 3915
188 Ga0206351_10242821 3300020077 Bacteria 4665
189 Ga0207427_100085 3300025231 Bacteria 142561
190 Ga0209437_100052 3300025233 Bacteria 380548
191 Ga0209437_100102 3300025233 Bacteria 224216
192 Ga0209233_1000067 3300025261 Bacteria 380554
193 Ga0209233_1009381 3300025261 Bacteria 2981
194 Ga0209455_1006064 3300025272 Bacteria 3632
195 Ga0209676_1001044 3300025292 Bacteria 31924
196 Ga0207656_10020596 3300025321 Unclassified 2624
197 Ga0207710_10117069 3300025900 Bacteria 1269
198 Ga0207680_10000117 3300025903 Bacteria 36819
199 Ga0207645_10008474 3300025907 Bacteria 7169
200 Ga0207645_10061460 3300025907 Bacteria 2399
201 Ga0207643_10042525 3300025908 Bacteria 2562
202 Ga0207705_10065283 3300025909 Bacteria 2631
203 Ga0207654_10000168 3300025911 Bacteria 41625
204 Ga0207654_10001156 3300025911 Bacteria 14193
205 Ga0207654_10040178 3300025911 Unclassified 2635
206 Ga0207707_10000117 3300025912 Bacteria 80929
207 Ga0207707_10088851 3300025912 Bacteria 2700
208 Ga0207695_10057507 3300025913 Bacteria 4039
209 Ga0207695_10371886 3300025913 Bacteria 1315
210 Ga0207671_10000905 3300025914 Bacteria 37474
211 Ga0207671_10001845 3300025914 Bacteria 23653
212 Ga0207671_10014324 3300025914 Bacteria 6274
213 Ga0207671_10021326 3300025914 Unclassified 4917
214 Ga0207671_10021367 3300025914 Bacteria 4911
215 Ga0207671_10058087 3300025914 Bacteria 2868
216 Ga0207660_10001028 3300025917 Bacteria 18473
217 Ga0207660_10032486 3300025917 Bacteria 3602
218 Ga0207660_10040992 3300025917 Bacteria 3243
219 Ga0207652_10000280 3300025921 Bacteria 53021
220 Ga0207652_10016686 3300025921 Bacteria 6001
221 Ga0207652_10039300 3300025921 Unclassified 4015
222 Ga0207652_10356930 3300025921 Unclassified 1319
223 Ga0207694_10071563 3300025924 Bacteria 2710
224 Ga0207694_10152248 3300025924 Bacteria 1864
225 Ga0207650_10045949 3300025925 Bacteria 3214
226 Ga0207650_10149109 3300025925 Bacteria 1844
227 Ga0207650_10183335 3300025925 Bacteria 1669
228 Ga0207659_10032248 3300025926 Bacteria 3593
229 Ga0207687_10272184 3300025927 Bacteria 1354
230 Ga0207644_10068500 3300025931 Bacteria 2589
231 Ga0207690_10000216 3300025932 Bacteria 43848
232 Ga0207690_10366231 3300025932 Bacteria 1143
233 Ga0207669_10314522 3300025937 Bacteria 1196
234 Ga0207691_10120168 3300025940 Bacteria 2329
235 Ga0207691_10402117 3300025940 Unclassified 1168
236 Ga0207689_10000260 3300025942 Bacteria 47416
237 Ga0207689_10018593 3300025942 Bacteria 5862
238 Ga0207661_10014978 3300025944 Bacteria 5694
239 Ga0207667_10000020 3300025949 Bacteria 374770
240 Ga0207667_10008655 3300025949 Bacteria 12069
241 Ga0207667_10020792 3300025949 Bacteria 7289
242 Ga0207667_10028694 3300025949 Bacteria 6042
243 Ga0207667_10044174 3300025949 Bacteria 4723
244 Ga0207667_10372558 3300025949 Bacteria 1455
245 Ga0207667_10423498 3300025949 Bacteria 1354
246 Ga0207651_10044937 3300025960 Bacteria 2960
247 Ga0207712_10113728 3300025961 Bacteria 2035
248 Ga0207668_10026622 3300025972 Bacteria 3757
249 Ga0207640_10005930 3300025981 Bacteria 6670
250 Ga0207658_10001959 3300025986 Bacteria 15364
251 Ga0207658_10356346 3300025986 Bacteria 1275
252 Ga0207677_10156040 3300026023 Bacteria 1767
253 Ga0207677_10237164 3300026023 Bacteria 1473
254 Ga0207703_10004860 3300026035 Bacteria 10936
255 Ga0207639_10313354 3300026041 Unclassified 1391
256 Ga0207639_10612097 3300026041 Bacteria 1005
257 Ga0207639_10616438 3300026041 Bacteria 1002
258 Ga0207708_10180962 3300026075 Bacteria 1674
259 Ga0207702_10000161 3300026078 Bacteria 79598
260 Ga0207641_10000061 3300026088 Bacteria 160161
261 Ga0207641_10081194 3300026088 Bacteria 2815
262 Ga0207648_10090916 3300026089 Bacteria 2668
263 Ga0207676_10666118 3300026095 Bacteria 1005
264 Ga0207674_10062977 3300026116 Bacteria 3745
265 Ga0207674_10083394 3300026116 Bacteria 3196
266 Ga0207674_10094772 3300026116 Unclassified 2971
267 Ga0207675_100000468 3300026118 Bacteria 39425
268 Ga0207698_10041111 3300026142 Bacteria 3442
269 Ga0207698_10088805 3300026142 Bacteria 2522
270 Ga0207698_10472968 3300026142 Bacteria 1214
271 Ga0209489_111689 3300027361 Bacteria 8728
272 Ga0209282_1209820 3300027666 Bacteria 890
273 Ga0268264_10001938 3300028381 Bacteria 18618
274 Ga0268264_10002707 3300028381 Bacteria 15465
275 Ga0307515_10000002 3300028794 Bacteria 1231751
276 Ga0307515_10000007 3300028794 Bacteria 719669
277 Ga0307515_10000667 3300028794 Bacteria 79135
278 Ga0307515_10001029 3300028794 Bacteria 63730
279 Ga0307515_10081240 3300028794 Bacteria 4213
280 Ga0265338_10241376 3300028800 Bacteria 1338
281 Ga0265338_10263803 3300028800 Bacteria 1265
282 Ga0265324_10049365 3300029957 Bacteria 1447
283 Ga0265327_10000488 3300031251 Bacteria 69809
284 Ga0265327_10066454 3300031251 Bacteria 1820
285 Ga0265327_10069666 3300031251 Bacteria 1765
286 Ga0265327_10112238 3300031251 Bacteria 1301
287 Ga0307509_10095704 3300031507 Bacteria 3024
288 Ga0307408_100000329 3300031548 Bacteria 45457
289 Ga0265313_10044902 3300031595 Bacteria 2154
290 Ga0307514_10026210 3300031649 Bacteria 4714
291 Ga0307406_10136118 3300031901 Bacteria 1731
292 Ga0307412_10000001 3300031911 Bacteria 822691
293 Ga0307412_10678387 3300031911 Bacteria 882
294 Ga0307416_100000066 3300032002 Bacteria 94549
295 Ga0307414_10003898 3300032004 Bacteria 8037
296 Ga0307414_10027173 3300032004 Bacteria 3694
297 Ga0307414_10141516 3300032004 Bacteria 1884
298 Ga0307414_10176763 3300032004 Bacteria 1713
299 Ga0307414_10181315 3300032004 Bacteria 1694
300 Ga0373924_0035378 3300035410 Bacteria 2026
301 Ga0373935_0185703 3300035692 Bacteria 1429
302 Ga0395899_0000001 3300037312 Bacteria 1750322
303 Ga0395899_0000182 3300037312 Bacteria 92470
304 Ga0395900_0586530 3300037418 Bacteria 1056
305 Ga0436365_1478753 3300039437 Unclassified 1981
306 Ga0451807_0262958 3300041486 Unclassified 887
307 Ga0439445_0010836 3300042004 Bacteria 2165
308 Ga0439445_0049394 3300042004 Bacteria 1133
309 Ga0439449_0014799 3300042007 Bacteria 2931
310 Ga0450898_003719 3300042134 Bacteria 2208
311 Ga0451577_0180708 3300042876 Bacteria 1902
312 Ga0451577_0189116 3300042876 Bacteria 1857
313 Ga0466961_0009336 3300044693 Bacteria 6248
314 Ga0466970_0044673 3300044765 Bacteria 2359
315 Ga0466960_0158363 3300044901 Bacteria 1214
316 Ga0466959_0011130 3300045049 Bacteria 6455
317 Ga0466958_0044661 3300045836 Bacteria 2671
318 Ga0495651_0176374 3300046462 Bacteria 1517
319 Ga0495650_0002914 3300046471 Bacteria 12995
320 Ga0495580_0329522 3300046472 Bacteria 1037
321 Ga0495585_0000091 3300046492 Bacteria 95620
322 Ga0495606_0003447 3300046507 Bacteria 16780
323 Ga0495606_0005837 3300046507 Bacteria 11609
324 Ga0495610_0000959 3300046512 Bacteria 26649
325 Ga0495616_0003738 3300046513 Bacteria 9708
326 Ga0495616_0004186 3300046513 Bacteria 9143
327 Ga0495632_0096051 3300046519 Bacteria 1400
328 Ga0495637_0076706 3300046520 Bacteria 1339
329 Ga0495648_0099288 3300046524 Bacteria 1611
330 Ga0495652_0338857 3300046529 Bacteria 1081
331 Ga0495633_0000006 3300046558 Bacteria 326774
332 Ga0495633_0004900 3300046558 Bacteria 8358
333 Ga0495668_0000918 3300046616 Bacteria 32911
334 Ga0495668_0154775 3300046616 Bacteria 1255
335 Ga0495625_0000059 3300046660 Bacteria 180330
336 Ga0495625_0002083 3300046660 Bacteria 22359
337 Ga0495625_0036200 3300046660 Bacteria 3630
338 Ga0495625_0066387 3300046660 Bacteria 2541
339 Ga0495625_0086825 3300046660 Unclassified 2170
340 Ga0495625_0184100 3300046660 Bacteria 1387
341 Ga0495635_0049691 3300046663 Bacteria 2891
342 Ga0495661_0000511 3300046665 Bacteria 40405
343 Ga0495657_0191170 3300046675 Bacteria 1251
344 Ga0495658_0002979 3300046683 Bacteria 8478
345 Ga0495671_0144986 3300046692 Bacteria 1156
346 Ga0495649_0001008 3300046694 Bacteria 22135
347 Ga0495589_0142276 3300046794 Bacteria 1148
348 Ga0495660_0020260 3300046810 Bacteria 3812
349 Ga0495676_0151436 3300047321 Bacteria 1650
350 Ga0495687_003426 3300047443 Bacteria 11505
351 Ga0495684_0070218 3300047471 Bacteria 2663
352 Ga0495686_0001059 3300047472 Bacteria 32862
353 Ga0495686_0026024 3300047472 Bacteria 3830
354 Ga0495686_0140579 3300047472 Bacteria 1425
355 Ga0495686_0206370 3300047472 Bacteria 1125
356 Ga0495614_0019603 3300048089 Bacteria 2927
357 Ga0496114_0478018 3300048917 Bacteria 1102
358 Ga0496115_0090369 3300048918 Bacteria 2502
359 Ga0495678_003800 3300049459 Bacteria 9110
360 Ga0501290_007613 3300049513 Bacteria 1359
361 Ga0501296_008386 3300049519 Bacteria 1197
362 Ga0501298_000487 3300049521 Bacteria 5356
363 Ga0501300_002270 3300049523 Bacteria 2876
364 Ga0501300_017145 3300049523 Bacteria 1057
365 Ga0501032_0005230 3300049569 Bacteria 9661
366 Ga0501034_0028044 3300049571 Bacteria 5726
367 Ga0501034_0064515 3300049571 Bacteria 3676
368 Ga0501036_0111632 3300049572 Bacteria 2310
369 Ga0501037_0113031 3300049573 Bacteria 1955
370 Ga0501038_0023587 3300049574 Bacteria 5498
371 Ga0501043_0024414 3300049579 Bacteria 4744
372 Ga0501043_0066386 3300049579 Bacteria 2833
373 Ga0501198_000671 3300049649 Bacteria 4262
374 Ga0501201_000292 3300049651 Bacteria 4554
375 Ga0501202_000022 3300049652 Bacteria 16472
376 Ga0501206_004994 3300049653 Bacteria 1704
377 Ga0501207_004358 3300049654 Bacteria 1920
378 Ga0501217_001283 3300049661 Bacteria 4664
379 Ga0501222_005096 3300049662 Bacteria 1778
380 Ga0501223_008431 3300049663 Bacteria 2101
381 Ga0501224_018034 3300049664 Bacteria 1051
382 Ga0501233_020250 3300049668 Bacteria 1418
383 Ga0501235_003884 3300049669 Bacteria 3231
384 Ga0501238_011693 3300049671 Bacteria 1182
385 Ga0501240_001027 3300049673 Bacteria 2580
386 Ga0501243_004826 3300049675 Bacteria 2024
387 Ga0501251_015843 3300049681 Bacteria 952
388 Ga0501252_019175 3300049682 Bacteria 881
389 Ga0501253_005186 3300049683 Bacteria 1693
390 Ga0501257_003705 3300049686 Bacteria 3300
391 Ga0501257_004825 3300049686 Bacteria 2952
392 Ga0501259_000349 3300049688 Bacteria 7232
393 Ga0501259_002575 3300049688 Bacteria 2925
394 Ga0501259_027308 3300049688 Bacteria 1056
395 Ga0501261_000251 3300049690 Bacteria 7363
396 Ga0501221_008138 3300049704 Bacteria 1816
397 Ga0501225_0012343 3300049705 Bacteria 2399
398 Ga0501234_000168 3300049707 Bacteria 8998
399 Ga0501245_001736 3300049708 Bacteria 2854
400 Ga0501232_001540 3300049757 Bacteria 1857
401 Ga0501241_012847 3300049758 Bacteria 1522
402 Ga0501268_024277 3300049765 Bacteria 1058
403 Ga0501279_008877 3300049775 Bacteria 1345
404 Ga0501280_008061 3300049776 Bacteria 1469
405 Ga0501035_0018034 3300049822 Bacteria 6505
406 Ga0501035_0118933 3300049822 Bacteria 2311
407 Ga0501044_0029038 3300049823 Bacteria 5833
408 Ga0501044_0070176 3300049823 Bacteria 3565
409 Ga0501212_005826 3300049851 Bacteria 1642
410 nmdc:mga0k408_105645_c1 3300050493 Bacteria 1663
411 nmdc:mga0k408_9670_c1 3300050493 Bacteria 5205
412 Ga0500578_0191869 3300053086 Bacteria 1254
413 Ga0500651_0000357 3300053093 Bacteria 25575
414 Ga0500556_0016763 3300053104 Bacteria 2284
415 Ga0500608_000365 3300053122 Bacteria 17523
416 Ga0500618_000010 3300053125 Bacteria 203909
417 Ga0500616_0000853 3300053153 Bacteria 33843
418 Ga0500616_0142589 3300053153 Bacteria 1118
419 Ga0500622_0000008 3300053156 Bacteria 423636
420 Ga0500622_0000417 3300053156 Bacteria 40427
421 Ga0500622_0001946 3300053156 Bacteria 15545
422 Ga0500611_000008 3300053727 Bacteria 198346
423 Ga0466962_0038765 3300061719 Bacteria 2282

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013296 Ga0157374_10196854 Ga0157374_101968542 236
2 3300026142 Ga0207698_10472968 Ga0207698_104729682 236
3 3300031548 Ga0307408_100000329 Ga0307408_10000032943 237
4 3300049523 Ga0501300_002270 Ga0501300_002270_382_1155 241
5 3300005355 Ga0070671_100252694 Ga0070671_1002526942 242
6 3300005364 Ga0070673_100102977 Ga0070673_1001029773 242
7 3300005618 Ga0068864_100740711 Ga0068864_1007407111 242
8 3300005834 Ga0068851_10025308 Ga0068851_100253084 242
9 3300005841 Ga0068863_100018526 Ga0068863_1000185265 242
10 3300005842 Ga0068858_100096352 Ga0068858_1000963522 242
11 3300010375 Ga0105239_10000249 Ga0105239_1000024953 242
12 3300013308 Ga0157375_10314087 Ga0157375_103140872 242
13 3300014325 Ga0163163_10651740 Ga0163163_106517402 242
14 3300025321 Ga0207656_10020596 Ga0207656_100205962 242
15 3300025925 Ga0207650_10149109 Ga0207650_101491092 242
16 3300025931 Ga0207644_10068500 Ga0207644_100685002 242
17 3300025960 Ga0207651_10044937 Ga0207651_100449372 242
18 3300026088 Ga0207641_10081194 Ga0207641_100811944 242
19 3300046665 Ga0495661_0000511 Ga0495661_0000511_29363_30091 242
20 3300013307 Ga0157372_10112294 Ga0157372_101122942 246
21 3300046616 Ga0495668_0000918 Ga0495668_0000918_10947_11777 246
22 3300031901 Ga0307406_10136118 Ga0307406_101361182 247
23 3300005367 Ga0070667_100008498 Ga0070667_1000084986 248
24 3300005843 Ga0068860_100002118 Ga0068860_1000021185 248
25 3300013297 Ga0157378_10044100 Ga0157378_100441004 248
26 3300025986 Ga0207658_10001959 Ga0207658_1000195914 248
27 3300028381 Ga0268264_10001938 Ga0268264_100019386 248
28 3300037312 Ga0395899_0000182 Ga0395899_0000182_54894_55682 248
29 3300037418 Ga0395900_0586530 Ga0395900_0586530_187_975 248
30 3300046472 Ga0495580_0329522 Ga0495580_0329522_97_879 248
31 3300003320 rootH2_10235801 rootH2_102358014 249
32 3300003322 rootL2_10040638 rootL2_100406384 249
33 3300005366 Ga0070659_100001146 Ga0070659_10000114612 249
34 3300025932 Ga0207690_10000216 Ga0207690_1000021614 249
35 3300009094 Ga0111539_10022183 Ga0111539_100221832 251
36 3300049671 Ga0501238_011693 Ga0501238_011693_369_1157 251
37 3300003323 rootH1_10379409 rootH1_103794092 252
38 3300005985 Ga0081539_10001743 Ga0081539_1000174312 252
39 3300013102 Ga0157371_10284657 Ga0157371_102846572 252
40 3300049569 Ga0501032_0005230 Ga0501032_0005230_1572_2360 252
41 3300049571 Ga0501034_0028044 Ga0501034_0028044_778_1566 252
42 3300049572 Ga0501036_0111632 Ga0501036_0111632_834_1622 252
43 3300049573 Ga0501037_0113031 Ga0501037_0113031_307_1095 252
44 3300049574 Ga0501038_0023587 Ga0501038_0023587_571_1359 252
45 3300049579 Ga0501043_0024414 Ga0501043_0024414_3663_4451 252
46 3300049579 Ga0501043_0066386 Ga0501043_0066386_1528_2316 252
47 3300049822 Ga0501035_0118933 Ga0501035_0118933_762_1550 252
48 3300049823 Ga0501044_0029038 Ga0501044_0029038_3975_4763 252
49 3300026041 Ga0207639_10616438 Ga0207639_106164382 253
50 3300025909 Ga0207705_10065283 Ga0207705_100652832 254
51 3300053086 Ga0500578_0191869 Ga0500578_0191869_169_936 255
52 3300053156 Ga0500622_0001946 Ga0500622_0001946_1286_2053 255
53 iso_pu_bacteria 2519899754 2520880522 255
54 iso_pu_bacteria 2816332280 2817414186 255
55 iso_pu_bacteria 2903895155 2903895262 255
56 iso_pu_bacteria 2958458903 2958459609 255
57 3300005366 Ga0070659_100337810 Ga0070659_1003378102 256
58 3300013102 Ga0157371_10028332 Ga0157371_100283322 256
59 3300013307 Ga0157372_10099048 Ga0157372_100990483 256
60 3300025932 Ga0207690_10366231 Ga0207690_103662311 256
61 3300049571 Ga0501034_0064515 Ga0501034_0064515_1183_1953 256
62 3300049822 Ga0501035_0018034 Ga0501035_0018034_1586_2356 256
63 3300049823 Ga0501044_0070176 Ga0501044_0070176_1017_1787 256
64 iso_pu_bacteria 2738541284 2738763269 256
65 3300005327 Ga0070658_10441001 Ga0070658_104410012 257
66 3300005336 Ga0070680_100015462 Ga0070680_1000154625 257
67 3300005339 Ga0070660_100016725 Ga0070660_1000167254 257
68 3300005366 Ga0070659_100002774 Ga0070659_1000027742 257
69 3300005530 Ga0070679_100069716 Ga0070679_1000697163 257
70 3300005530 Ga0070679_100200938 Ga0070679_1002009382 257
71 3300005530 Ga0070679_100594823 Ga0070679_1005948231 257
72 3300005563 Ga0068855_100027207 Ga0068855_1000272074 257
73 3300005577 Ga0068857_100102605 Ga0068857_1001026051 257
74 3300005577 Ga0068857_100669053 Ga0068857_1006690531 257
75 3300013100 Ga0157373_10050048 Ga0157373_100500482 257
76 3300013104 Ga0157370_10149180 Ga0157370_101491802 257
77 3300013105 Ga0157369_10508437 Ga0157369_105084372 257
78 3300013307 Ga0157372_10444814 Ga0157372_104448142 257
79 3300013307 Ga0157372_10505936 Ga0157372_105059361 257
80 3300025917 Ga0207660_10040992 Ga0207660_100409924 257
81 3300025921 Ga0207652_10356930 Ga0207652_103569301 257
82 3300025949 Ga0207667_10044174 Ga0207667_100441741 257
83 3300026116 Ga0207674_10094772 Ga0207674_100947722 257
84 3300053122 Ga0500608_000365 Ga0500608_000365_14678_15451 257
85 3300053156 Ga0500622_0000008 Ga0500622_0000008_397745_398518 257
86 3300005937 Ga0081455_10118188 Ga0081455_101181882 258
87 iso_pu_bacteria 2522125168 2522552137 258
88 iso_pu_bacteria 2599185184 2599482025 258
89 iso_pu_bacteria 2919186247 2919190597 258
90 iso_pu_bacteria 2919437846 2919443027 258
91 iso_pu_bacteria 2928078545 2928082080 258
92 iso_pu_bacteria 2928147474 2928153051 258
93 iso_pu_bacteria 2932082852 2932087923 258
94 iso_pu_bacteria 2939664404 2939669193 258
95 3300003323 rootH1_10311811 rootH1_103118111 259
96 3300005329 Ga0070683_100167866 Ga0070683_1001678661 259
97 3300005334 Ga0068869_100038656 Ga0068869_1000386562 259
98 3300005335 Ga0070666_10000375 Ga0070666_1000037517 259
99 3300005337 Ga0070682_100332961 Ga0070682_1003329611 259
100 3300005367 Ga0070667_100224713 Ga0070667_1002247132 259
101 3300005530 Ga0070679_100005898 Ga0070679_1000058982 259
102 3300005539 Ga0068853_100550687 Ga0068853_1005506872 259
103 3300005543 Ga0070672_100109650 Ga0070672_1001096502 259
104 3300005563 Ga0068855_100012783 Ga0068855_1000127837 259
105 3300005614 Ga0068856_100075223 Ga0068856_1000752234 259
106 3300005614 Ga0068856_100189912 Ga0068856_1001899122 259
107 3300005616 Ga0068852_100615982 Ga0068852_1006159822 259
108 3300005617 Ga0068859_100000086 Ga0068859_10000008619 259
109 3300005618 Ga0068864_100409164 Ga0068864_1004091641 259
110 3300005841 Ga0068863_100013044 Ga0068863_1000130447 259
111 3300005842 Ga0068858_100002273 Ga0068858_1000022733 259
112 3300005843 Ga0068860_100004278 Ga0068860_1000042785 259
113 3300006358 Ga0068871_100020799 Ga0068871_1000207994 259
114 3300006931 Ga0097620_100000086 Ga0097620_10000008664 259
115 3300006948 Ga0099826_10059880 Ga0099826_100598801 259
116 3300009098 Ga0105245_10355338 Ga0105245_103553382 259
117 3300009101 Ga0105247_10002917 Ga0105247_100029176 259
118 3300009148 Ga0105243_10141359 Ga0105243_101413591 259
119 3300009174 Ga0105241_10001385 Ga0105241_100013855 259
120 3300009174 Ga0105241_10015267 Ga0105241_100152676 259
121 3300009174 Ga0105241_10277378 Ga0105241_102773782 259
122 3300009176 Ga0105242_10376214 Ga0105242_103762142 259
123 3300009545 Ga0105237_10001891 Ga0105237_1000189113 259
124 3300009545 Ga0105237_10413352 Ga0105237_104133522 259
125 3300009553 Ga0105249_10003436 Ga0105249_1000343615 259
126 3300010375 Ga0105239_10154604 Ga0105239_101546043 259
127 3300010375 Ga0105239_10173365 Ga0105239_101733652 259
128 3300013100 Ga0157373_10207440 Ga0157373_102074402 259
129 3300013102 Ga0157371_10023855 Ga0157371_100238552 259
130 3300013104 Ga0157370_10004819 Ga0157370_100048198 259
131 3300013105 Ga0157369_10010233 Ga0157369_1001023310 259
132 3300013306 Ga0163162_10003760 Ga0163162_100037603 259
133 3300014969 Ga0157376_10044104 Ga0157376_100441043 259
134 3300025900 Ga0207710_10117069 Ga0207710_101170692 259
135 3300025903 Ga0207680_10000117 Ga0207680_1000011713 259
136 3300025907 Ga0207645_10061460 Ga0207645_100614601 259
137 3300025911 Ga0207654_10001156 Ga0207654_100011565 259
138 3300025911 Ga0207654_10040178 Ga0207654_100401783 259
139 3300025914 Ga0207671_10001845 Ga0207671_1000184518 259
140 3300025914 Ga0207671_10021326 Ga0207671_100213263 259
141 3300025921 Ga0207652_10039300 Ga0207652_100393004 259
142 3300025927 Ga0207687_10272184 Ga0207687_102721842 259
143 3300025940 Ga0207691_10120168 Ga0207691_101201683 259
144 3300025942 Ga0207689_10000260 Ga0207689_1000026023 259
145 3300025949 Ga0207667_10020792 Ga0207667_100207927 259
146 3300025961 Ga0207712_10113728 Ga0207712_101137282 259
147 3300025972 Ga0207668_10026622 Ga0207668_100266222 259
148 3300025986 Ga0207658_10356346 Ga0207658_103563461 259
149 3300026023 Ga0207677_10237164 Ga0207677_102371642 259
150 3300026035 Ga0207703_10004860 Ga0207703_1000486010 259
151 3300026041 Ga0207639_10612097 Ga0207639_106120972 259
152 3300026088 Ga0207641_10000061 Ga0207641_10000061136 259
153 3300026095 Ga0207676_10666118 Ga0207676_106661181 259
154 3300026142 Ga0207698_10088805 Ga0207698_100888052 259
155 3300027361 Ga0209489_111689 Ga0209489_1116892 259
156 3300027666 Ga0209282_1209820 Ga0209282_12098201 259
157 3300028381 Ga0268264_10002707 Ga0268264_100027079 259
158 3300028800 Ga0265338_10263803 Ga0265338_102638032 259
159 3300029957 Ga0265324_10049365 Ga0265324_100493651 259
160 3300031507 Ga0307509_10095704 Ga0307509_100957043 259
161 3300032002 Ga0307416_100000066 Ga0307416_10000006628 259
162 3300044901 Ga0466960_0158363 Ga0466960_0158363_336_1115 259
163 3300005288 Ga0065714_10004250 Ga0065714_100042504 260
164 3300005288 Ga0065714_10139919 Ga0065714_101399192 260
165 3300005289 Ga0065704_10000226 Ga0065704_1000022650 260
166 3300005289 Ga0065704_10119969 Ga0065704_101199692 260
167 3300005295 Ga0065707_10090632 Ga0065707_100906322 260
168 3300005328 Ga0070676_10078696 Ga0070676_100786962 260
169 3300005459 Ga0068867_100298589 Ga0068867_1002985891 260
170 3300006881 Ga0068865_100627104 Ga0068865_1006271041 260
171 3300009545 Ga0105237_10001001 Ga0105237_1000100113 260
172 3300009551 Ga0105238_10011946 Ga0105238_100119462 260
173 3300010375 Ga0105239_10000004 Ga0105239_10000004324 260
174 3300013100 Ga0157373_10008374 Ga0157373_100083742 260
175 3300013104 Ga0157370_10283177 Ga0157370_102831772 260
176 3300013104 Ga0157370_10400819 Ga0157370_104008192 260
177 3300013307 Ga0157372_10006608 Ga0157372_100066087 260
178 3300014497 Ga0182008_10000020 Ga0182008_10000020172 260
179 3300020077 Ga0206351_10242821 Ga0206351_102428212 260
180 3300025914 Ga0207671_10000905 Ga0207671_1000090511 260
181 3300025924 Ga0207694_10071563 Ga0207694_100715632 260
182 3300026089 Ga0207648_10090916 Ga0207648_100909162 260
183 3300026116 Ga0207674_10062977 Ga0207674_100629772 260
184 3300031251 Ga0265327_10066454 Ga0265327_100664542 260
185 3300031595 Ga0265313_10044902 Ga0265313_100449022 260
186 3300031911 Ga0307412_10000001 Ga0307412_10000001220 260
187 3300032004 Ga0307414_10027173 Ga0307414_100271732 260
188 3300042876 Ga0451577_0180708 Ga0451577_0180708_313_1095 260
189 3300042876 Ga0451577_0189116 Ga0451577_0189116_594_1376 260
190 3300049686 Ga0501257_004825 Ga0501257_004825_168_950 260
191 3300049688 Ga0501259_000349 Ga0501259_000349_1090_1872 260
192 3300049758 Ga0501241_012847 Ga0501241_012847_411_1193 260
193 3300053093 Ga0500651_0000357 Ga0500651_0000357_11896_12678 260
194 3300003323 rootH1_10052755 rootH1_100527552 261
195 3300026041 Ga0207639_10313354 Ga0207639_103133542 261
196 3300001989 JGI24739J22299_10002789 JGI24739J22299_100027893 262
197 3300001990 JGI24737J22298_10003672 JGI24737J22298_100036723 262
198 3300002067 JGI24735J21928_10000324 JGI24735J21928_100003247 262
199 3300002737 JGI25162J39368_1004274 JGI25162J39368_10042742 262
200 3300002772 JGI25164J39214_1000814 JGI25164J39214_10008145 262
201 3300003214 JGI25165J46597_1000663 JGI25165J46597_100066320 262
202 3300003316 rootH1_10076361 rootH1_100763614 262
203 3300003320 rootH2_10094331 rootH2_100943311 262
204 3300003323 rootH1_10009528 rootH1_1000952830 262
205 3300003323 rootH1_10022931 rootH1_1002293113 262
206 3300003323 rootH1_10062224 rootH1_100622244 262
207 3300003323 rootH1_10105002 rootH1_101050022 262
208 3300003781 Ga0055536_1024067 Ga0055536_10240672 262
209 3300004799 Ga0058863_11101084 Ga0058863_111010841 262
210 3300005262 Ga0065165_1000501 Ga0065165_100050112 262
211 3300005288 Ga0065714_10009525 Ga0065714_100095251 262
212 3300005288 Ga0065714_10013800 Ga0065714_100138002 262
213 3300005288 Ga0065714_10079471 Ga0065714_100794713 262
214 3300005327 Ga0070658_10129286 Ga0070658_101292862 262
215 3300005329 Ga0070683_100017779 Ga0070683_1000177792 262
216 3300005331 Ga0070670_100078328 Ga0070670_1000783282 262
217 3300005331 Ga0070670_100244878 Ga0070670_1002448782 262
218 3300005334 Ga0068869_100177995 Ga0068869_1001779952 262
219 3300005336 Ga0070680_100031279 Ga0070680_1000312793 262
220 3300005337 Ga0070682_100000482 Ga0070682_10000048210 262
221 3300005338 Ga0068868_100131455 Ga0068868_1001314552 262
222 3300005347 Ga0070668_100002219 Ga0070668_1000022197 262
223 3300005353 Ga0070669_100001299 Ga0070669_10000129913 262
224 3300005354 Ga0070675_100004217 Ga0070675_1000042178 262
225 3300005365 Ga0070688_100028086 Ga0070688_1000280862 262
226 3300005441 Ga0070700_100125275 Ga0070700_1001252752 262
227 3300005457 Ga0070662_100012820 Ga0070662_1000128202 262
228 3300005471 Ga0070698_100336679 Ga0070698_1003366792 262
229 3300005530 Ga0070679_100000549 Ga0070679_1000005499 262
230 3300005530 Ga0070679_100024113 Ga0070679_1000241137 262
231 3300005530 Ga0070679_100624425 Ga0070679_1006244252 262
232 3300005535 Ga0070684_100019229 Ga0070684_1000192291 262
233 3300005539 Ga0068853_100079978 Ga0068853_1000799782 262
234 3300005539 Ga0068853_100181435 Ga0068853_1001814352 262
235 3300005563 Ga0068855_100000019 Ga0068855_100000019106 262
236 3300005563 Ga0068855_100000388 Ga0068855_10000038835 262
237 3300005563 Ga0068855_100013264 Ga0068855_10001326411 262
238 3300005563 Ga0068855_100025873 Ga0068855_1000258737 262
239 3300005563 Ga0068855_100030245 Ga0068855_1000302454 262
240 3300005563 Ga0068855_100444116 Ga0068855_1004441162 262
241 3300005578 Ga0068854_100008761 Ga0068854_1000087613 262
242 3300005578 Ga0068854_100623402 Ga0068854_1006234021 262
243 3300005614 Ga0068856_100001034 Ga0068856_10000103410 262
244 3300005616 Ga0068852_100025858 Ga0068852_1000258583 262
245 3300005616 Ga0068852_100112751 Ga0068852_1001127512 262
246 3300005617 Ga0068859_100039542 Ga0068859_1000395422 262
247 3300005840 Ga0068870_10006552 Ga0068870_100065525 262
248 3300006195 Ga0075366_10002704 Ga0075366_100027045 262
249 3300006195 Ga0075366_10015888 Ga0075366_100158885 262
250 3300006195 Ga0075366_10077832 Ga0075366_100778322 262
251 3300006931 Ga0097620_100039542 Ga0097620_1000395422 262
252 3300009093 Ga0105240_10002660 Ga0105240_1000266013 262
253 3300009093 Ga0105240_10063765 Ga0105240_100637652 262
254 3300009093 Ga0105240_10078201 Ga0105240_100782013 262
255 3300009093 Ga0105240_10172669 Ga0105240_101726692 262
256 3300009094 Ga0111539_10004188 Ga0111539_100041884 262
257 3300009174 Ga0105241_10000668 Ga0105241_100006687 262
258 3300009545 Ga0105237_10002720 Ga0105237_1000272010 262
259 3300009545 Ga0105237_10011718 Ga0105237_100117183 262
260 3300009545 Ga0105237_10042255 Ga0105237_100422553 262
261 3300009545 Ga0105237_10144217 Ga0105237_101442174 262
262 3300009545 Ga0105237_10202771 Ga0105237_102027711 262
263 3300009545 Ga0105237_10202778 Ga0105237_102027781 262
264 3300009551 Ga0105238_10111589 Ga0105238_101115892 262
265 3300010375 Ga0105239_10000012 Ga0105239_10000012199 262
266 3300010375 Ga0105239_10000299 Ga0105239_1000029953 262
267 3300010375 Ga0105239_10000976 Ga0105239_1000097610 262
268 3300010375 Ga0105239_10002652 Ga0105239_1000265213 262
269 3300010375 Ga0105239_10141943 Ga0105239_101419432 262
270 3300013100 Ga0157373_10000327 Ga0157373_1000032712 262
271 3300013102 Ga0157371_10023206 Ga0157371_100232062 262
272 3300013104 Ga0157370_10000831 Ga0157370_1000083113 262
273 3300013104 Ga0157370_10085136 Ga0157370_100851362 262
274 3300013105 Ga0157369_10060549 Ga0157369_100605493 262
275 3300013297 Ga0157378_10017968 Ga0157378_100179685 262
276 3300013306 Ga0163162_10033338 Ga0163162_100333383 262
277 3300013307 Ga0157372_10000980 Ga0157372_1000098015 262
278 3300013307 Ga0157372_10006396 Ga0157372_1000639610 262
279 3300013307 Ga0157372_10314118 Ga0157372_103141182 262
280 3300013308 Ga0157375_10021906 Ga0157375_100219063 262
281 3300014326 Ga0157380_10010487 Ga0157380_100104879 262
282 3300014326 Ga0157380_10162573 Ga0157380_101625732 262
283 3300014326 Ga0157380_10308635 Ga0157380_103086351 262
284 3300014745 Ga0157377_10001601 Ga0157377_100016018 262
285 3300017792 Ga0163161_10029273 Ga0163161_100292733 262
286 3300025231 Ga0207427_100085 Ga0207427_100085119 262
287 3300025233 Ga0209437_100052 Ga0209437_100052126 262
288 3300025233 Ga0209437_100102 Ga0209437_100102195 262
289 3300025261 Ga0209233_1000067 Ga0209233_1000067126 262
290 3300025261 Ga0209233_1009381 Ga0209233_10093811 262
291 3300025272 Ga0209455_1006064 Ga0209455_10060643 262
292 3300025292 Ga0209676_1001044 Ga0209676_100104423 262
293 3300025907 Ga0207645_10008474 Ga0207645_100084744 262
294 3300025908 Ga0207643_10042525 Ga0207643_100425254 262
295 3300025911 Ga0207654_10000168 Ga0207654_1000016810 262
296 3300025912 Ga0207707_10000117 Ga0207707_1000011742 262
297 3300025912 Ga0207707_10088851 Ga0207707_100888512 262
298 3300025913 Ga0207695_10057507 Ga0207695_100575074 262
299 3300025913 Ga0207695_10371886 Ga0207695_103718862 262
300 3300025914 Ga0207671_10014324 Ga0207671_100143243 262
301 3300025914 Ga0207671_10021367 Ga0207671_100213674 262
302 3300025914 Ga0207671_10058087 Ga0207671_100580872 262
303 3300025917 Ga0207660_10001028 Ga0207660_100010289 262
304 3300025917 Ga0207660_10032486 Ga0207660_100324862 262
305 3300025921 Ga0207652_10000280 Ga0207652_1000028030 262
306 3300025921 Ga0207652_10016686 Ga0207652_100166867 262
307 3300025924 Ga0207694_10152248 Ga0207694_101522482 262
308 3300025925 Ga0207650_10045949 Ga0207650_100459492 262
309 3300025925 Ga0207650_10183335 Ga0207650_101833352 262
310 3300025926 Ga0207659_10032248 Ga0207659_100322482 262
311 3300025937 Ga0207669_10314522 Ga0207669_103145222 262
312 3300025940 Ga0207691_10402117 Ga0207691_104021171 262
313 3300025942 Ga0207689_10018593 Ga0207689_100185936 262
314 3300025944 Ga0207661_10014978 Ga0207661_100149782 262
315 3300025949 Ga0207667_10000020 Ga0207667_1000002063 262
316 3300025949 Ga0207667_10008655 Ga0207667_100086557 262
317 3300025949 Ga0207667_10028694 Ga0207667_100286943 262
318 3300025949 Ga0207667_10372558 Ga0207667_103725582 262
319 3300025949 Ga0207667_10423498 Ga0207667_104234982 262
320 3300025981 Ga0207640_10005930 Ga0207640_100059305 262
321 3300026023 Ga0207677_10156040 Ga0207677_101560402 262
322 3300026075 Ga0207708_10180962 Ga0207708_101809622 262
323 3300026078 Ga0207702_10000161 Ga0207702_1000016144 262
324 3300026116 Ga0207674_10083394 Ga0207674_100833944 262
325 3300026118 Ga0207675_100000468 Ga0207675_10000046838 262
326 3300026142 Ga0207698_10041111 Ga0207698_100411113 262
327 3300028794 Ga0307515_10000002 Ga0307515_10000002709 262
328 3300028794 Ga0307515_10000007 Ga0307515_10000007632 262
329 3300028794 Ga0307515_10000667 Ga0307515_1000066728 262
330 3300028794 Ga0307515_10001029 Ga0307515_1000102915 262
331 3300028794 Ga0307515_10081240 Ga0307515_100812404 262
332 3300028800 Ga0265338_10241376 Ga0265338_102413762 262
333 3300031251 Ga0265327_10000488 Ga0265327_100004884 262
334 3300031251 Ga0265327_10069666 Ga0265327_100696662 262
335 3300031251 Ga0265327_10112238 Ga0265327_101122382 262
336 3300031649 Ga0307514_10026210 Ga0307514_100262102 262
337 3300031911 Ga0307412_10678387 Ga0307412_106783871 262
338 3300032004 Ga0307414_10003898 Ga0307414_100038989 262
339 3300032004 Ga0307414_10141516 Ga0307414_101415162 262
340 3300032004 Ga0307414_10176763 Ga0307414_101767632 262
341 3300032004 Ga0307414_10181315 Ga0307414_101813152 262
342 3300035410 Ga0373924_0035378 Ga0373924_0035378_431_1219 262
343 3300035692 Ga0373935_0185703 Ga0373935_0185703_373_1161 262
344 3300037312 Ga0395899_0000001 Ga0395899_0000001_1292521_1293312 262
345 3300039437 Ga0436365_1478753 Ga0436365_1478753_892_1680 262
346 3300041486 Ga0451807_0262958 Ga0451807_0262958_60_848 262
347 3300042004 Ga0439445_0010836 Ga0439445_0010836_387_1175 262
348 3300042004 Ga0439445_0049394 Ga0439445_0049394_94_882 262
349 3300042007 Ga0439449_0014799 Ga0439449_0014799_1772_2560 262
350 3300042134 Ga0450898_003719 Ga0450898_003719_656_1444 262
351 3300044693 Ga0466961_0009336 Ga0466961_0009336_5116_5904 262
352 3300044765 Ga0466970_0044673 Ga0466970_0044673_450_1238 262
353 3300045049 Ga0466959_0011130 Ga0466959_0011130_3177_3965 262
354 3300045836 Ga0466958_0044661 Ga0466958_0044661_511_1299 262
355 3300046462 Ga0495651_0176374 Ga0495651_0176374_316_1104 262
356 3300046471 Ga0495650_0002914 Ga0495650_0002914_4296_5084 262
357 3300046492 Ga0495585_0000091 Ga0495585_0000091_3468_4256 262
358 3300046507 Ga0495606_0003447 Ga0495606_0003447_8167_8955 262
359 3300046507 Ga0495606_0005837 Ga0495606_0005837_4234_5022 262
360 3300046512 Ga0495610_0000959 Ga0495610_0000959_21692_22480 262
361 3300046513 Ga0495616_0003738 Ga0495616_0003738_2060_2848 262
362 3300046513 Ga0495616_0004186 Ga0495616_0004186_6660_7448 262
363 3300046519 Ga0495632_0096051 Ga0495632_0096051_460_1248 262
364 3300046520 Ga0495637_0076706 Ga0495637_0076706_37_825 262
365 3300046524 Ga0495648_0099288 Ga0495648_0099288_199_987 262
366 3300046529 Ga0495652_0338857 Ga0495652_0338857_70_858 262
367 3300046558 Ga0495633_0000006 Ga0495633_0000006_311819_312607 262
368 3300046558 Ga0495633_0004900 Ga0495633_0004900_2995_3783 262
369 3300046616 Ga0495668_0154775 Ga0495668_0154775_211_999 262
370 3300046660 Ga0495625_0000059 Ga0495625_0000059_7926_8714 262
371 3300046660 Ga0495625_0002083 Ga0495625_0002083_5575_6363 262
372 3300046660 Ga0495625_0036200 Ga0495625_0036200_2386_3174 262
373 3300046660 Ga0495625_0066387 Ga0495625_0066387_419_1207 262
374 3300046660 Ga0495625_0086825 Ga0495625_0086825_196_984 262
375 3300046660 Ga0495625_0184100 Ga0495625_0184100_221_1009 262
376 3300046663 Ga0495635_0049691 Ga0495635_0049691_334_1122 262
377 3300046675 Ga0495657_0191170 Ga0495657_0191170_407_1195 262
378 3300046683 Ga0495658_0002979 Ga0495658_0002979_5453_6241 262
379 3300046692 Ga0495671_0144986 Ga0495671_0144986_334_1122 262
380 3300046694 Ga0495649_0001008 Ga0495649_0001008_13431_14219 262
381 3300046794 Ga0495589_0142276 Ga0495589_0142276_59_847 262
382 3300046810 Ga0495660_0020260 Ga0495660_0020260_1929_2717 262
383 3300047321 Ga0495676_0151436 Ga0495676_0151436_296_1084 262
384 3300047443 Ga0495687_003426 Ga0495687_003426_7246_8034 262
385 3300047471 Ga0495684_0070218 Ga0495684_0070218_1228_2016 262
386 3300047472 Ga0495686_0001059 Ga0495686_0001059_25057_25845 262
387 3300047472 Ga0495686_0026024 Ga0495686_0026024_1116_1904 262
388 3300047472 Ga0495686_0140579 Ga0495686_0140579_258_1046 262
389 3300047472 Ga0495686_0206370 Ga0495686_0206370_219_1007 262
390 3300048089 Ga0495614_0019603 Ga0495614_0019603_827_1615 262
391 3300048917 Ga0496114_0478018 Ga0496114_0478018_39_827 262
392 3300048918 Ga0496115_0090369 Ga0496115_0090369_1124_1912 262
393 3300049459 Ga0495678_003800 Ga0495678_003800_6982_7770 262
394 3300049513 Ga0501290_007613 Ga0501290_007613_281_1069 262
395 3300049519 Ga0501296_008386 Ga0501296_008386_231_1019 262
396 3300049521 Ga0501298_000487 Ga0501298_000487_4385_5173 262
397 3300049523 Ga0501300_017145 Ga0501300_017145_169_957 262
398 3300049649 Ga0501198_000671 Ga0501198_000671_1344_2132 262
399 3300049651 Ga0501201_000292 Ga0501201_000292_3465_4253 262
400 3300049652 Ga0501202_000022 Ga0501202_000022_101_889 262
401 3300049653 Ga0501206_004994 Ga0501206_004994_697_1485 262
402 3300049654 Ga0501207_004358 Ga0501207_004358_871_1659 262
403 3300049661 Ga0501217_001283 Ga0501217_001283_1215_2003 262
404 3300049662 Ga0501222_005096 Ga0501222_005096_242_1030 262
405 3300049663 Ga0501223_008431 Ga0501223_008431_1020_1808 262
406 3300049664 Ga0501224_018034 Ga0501224_018034_163_951 262
407 3300049668 Ga0501233_020250 Ga0501233_020250_153_941 262
408 3300049669 Ga0501235_003884 Ga0501235_003884_380_1168 262
409 3300049673 Ga0501240_001027 Ga0501240_001027_685_1473 262
410 3300049675 Ga0501243_004826 Ga0501243_004826_561_1349 262
411 3300049681 Ga0501251_015843 Ga0501251_015843_63_851 262
412 3300049682 Ga0501252_019175 Ga0501252_019175_54_842 262
413 3300049683 Ga0501253_005186 Ga0501253_005186_740_1528 262
414 3300049686 Ga0501257_003705 Ga0501257_003705_2039_2827 262
415 3300049688 Ga0501259_002575 Ga0501259_002575_942_1730 262
416 3300049688 Ga0501259_027308 Ga0501259_027308_162_950 262
417 3300049690 Ga0501261_000251 Ga0501261_000251_340_1128 262
418 3300049704 Ga0501221_008138 Ga0501221_008138_239_1027 262
419 3300049705 Ga0501225_0012343 Ga0501225_0012343_82_870 262
420 3300049707 Ga0501234_000168 Ga0501234_000168_3265_4053 262
421 3300049708 Ga0501245_001736 Ga0501245_001736_155_943 262
422 3300049757 Ga0501232_001540 Ga0501232_001540_873_1661 262
423 3300049765 Ga0501268_024277 Ga0501268_024277_95_883 262
424 3300049775 Ga0501279_008877 Ga0501279_008877_446_1234 262
425 3300049776 Ga0501280_008061 Ga0501280_008061_556_1344 262
426 3300049851 Ga0501212_005826 Ga0501212_005826_519_1307 262
427 3300050493 nmdc:mga0k408_105645_c1 nmdc:mga0k408_105645_c1_599_1387 262
428 3300050493 nmdc:mga0k408_9670_c1 nmdc:mga0k408_9670_c1_4195_4983 262
429 3300053104 Ga0500556_0016763 Ga0500556_0016763_363_1151 262
430 3300053125 Ga0500618_000010 Ga0500618_000010_10229_11017 262
431 3300053153 Ga0500616_0000853 Ga0500616_0000853_21585_22373 262
432 3300053153 Ga0500616_0142589 Ga0500616_0142589_262_1050 262
433 3300053156 Ga0500622_0000417 Ga0500622_0000417_35627_36415 262
434 3300053727 Ga0500611_000008 Ga0500611_000008_189541_190329 262
435 3300061719 Ga0466962_0038765 Ga0466962_0038765_1377_2165 262

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

32

224

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

38

277

0.94

PF08659

KR

KR domain

33

210

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6h0m-assembly1.cif.gz_A 17beta-hydroxysteroid dehydrogenase type 14 mutant k158a in complex with nicotinamide adenine dinucleotide 0.9617 5 251
2d1y-assembly1.cif.gz_C crystal structure of tt0321 from thermus thermophilus hb8 0.9611 5 251
2d1y-assembly1.cif.gz_A crystal structure of tt0321 from thermus thermophilus hb8 0.9592 5 251
2d1y-assembly1.cif.gz_D crystal structure of tt0321 from thermus thermophilus hb8 0.9586 5 251
3ai3-assembly1.cif.gz_G the crystal structure of l-sorbose reductase from gluconobacter frateurii complexed with nadph and l-sorbose 0.958 1 251
ID Description Score Start End Superfamily
2d1yC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9611 5 251 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9596 5 196 3.40.50.720
3ai1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9565 1 251 3.40.50.720
af_A0A0N7KIR0_69_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9541 5 163 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9521 2 185 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3C1TIR6-F1-model_v4 Short chain dehydrogenase 0.9927 1 232
AF-A0A2V7WVV5-F1-model_v4 Short chain dehydrogenase 0.9919 1 224 GO:0016491
AF-A0A2W0ARM4-F1-model_v4 Short chain dehydrogenase 0.9889 1 248 GO:0016020
AF-A0A3C1TIR6-F1-model_v4 Short chain dehydrogenase 0.9842 1 232
AF-A0A2N2PXS5-F1-model_v4 Short-chain dehydrogenase 0.9799 4 250 GO:0016491

Feature Viewer

pLDDT pTM Quality
92.68 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map