F443261
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 435 | 257 | 423 | 260 |
Family's Representative Sequence
| Representative Sequence | 3300005334|Ga0068869_100177995|Ga0068869_1001779952 |
| Length | 286 |
| Sequence | MKKKRKKYSAAMPPDFITCNYNRVMDLLLKDKVIIVTGGAKGIGEGIVKVLAKEGAIPVIVGRNREDNQKTATAVMADGGKTFEVVAELSDPKTCEQAVKEVIEQLGRIDGLVNNAGVNDGVGLENGNYQNFLASLHKNVIHYYLMAHFALPELKKSKGSIVNITSKTADTGQGGTSAYAASNGGRNAMTREWAVELLKYRIRVNAVSVAECYTPLYARWIESLPNPKEKLKEIESKIPLGNRMTTAEEIANMVAFLLSERSSHTTGQIIHVDGGYVHLDRALANA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 2 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 3 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 4 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 5 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 6 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 7 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 8 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 9 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 10 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 11 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 12 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 13 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 14 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 15 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 16 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 17 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 18 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 20 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 21 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 22 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 23 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 24 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 147 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 150 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 152 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 153 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 156 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 157 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 158 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 159 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 160 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 161 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 162 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 164 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 165 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 166 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 167 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 168 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 169 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 170 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 171 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 172 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 173 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 174 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 175 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 176 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 204 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 205 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 207 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 208 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 209 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 210 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 217 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 218 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 219 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 220 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 221 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 222 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 223 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 224 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 225 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 226 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 227 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 228 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 229 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 230 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 231 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 232 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 233 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 234 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 235 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 236 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 237 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 238 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 239 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 240 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 241 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 242 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 243 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 244 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 245 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 248 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 249 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 250 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 251 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 252 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 253 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 254 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 255 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 256 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 257 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.55 |
| Metatranscriptomes | 0.46 |
| Isolates | 2.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.44 |
| Nodule | 0.69 |
| Rhizoplane | 0.92 |
| Rhizosphere | 86.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10002789 | 3300001989 | Bacteria | 6712 |
| 2 | JGI24737J22298_10003672 | 3300001990 | Bacteria | 5405 |
| 3 | JGI24735J21928_10000324 | 3300002067 | Bacteria | 16589 |
| 4 | JGI25162J39368_1004274 | 3300002737 | Bacteria | 3426 |
| 5 | JGI25164J39214_1000814 | 3300002772 | Bacteria | 11009 |
| 6 | JGI25165J46597_1000663 | 3300003214 | Bacteria | 27797 |
| 7 | rootH1_10076361 | 3300003316 | Bacteria | 9005 |
| 8 | rootH2_10094331 | 3300003320 | Bacteria | 1385 |
| 9 | rootH2_10235801 | 3300003320 | Bacteria | 3036 |
| 10 | rootL2_10040638 | 3300003322 | Bacteria | 11356 |
| 11 | rootH1_10009528 | 3300003323 | Bacteria | 31356 |
| 12 | rootH1_10022931 | 3300003323 | Bacteria | 51976 |
| 13 | rootH1_10052755 | 3300003323 | Bacteria | 3579 |
| 14 | rootH1_10062224 | 3300003316 | Bacteria | 2902 |
| 15 | rootH1_10062224 | 3300003323 | Bacteria | 11182 |
| 16 | rootH1_10105002 | 3300003323 | Bacteria | 3186 |
| 17 | rootH1_10311811 | 3300003323 | Unclassified | 1619 |
| 18 | rootH1_10379409 | 3300003323 | Bacteria | 1169 |
| 19 | Ga0055536_1024067 | 3300003781 | Bacteria | 1774 |
| 20 | Ga0058863_11101084 | 3300004799 | Bacteria | 948 |
| 21 | Ga0065165_1000501 | 3300005262 | Bacteria | 60618 |
| 22 | Ga0065714_10004250 | 3300005288 | Bacteria | 8027 |
| 23 | Ga0065714_10009525 | 3300005288 | Bacteria | 4173 |
| 24 | Ga0065714_10013800 | 3300005288 | Bacteria | 2604 |
| 25 | Ga0065714_10079471 | 3300005288 | Bacteria | 2514 |
| 26 | Ga0065714_10139919 | 3300005288 | Bacteria | 1180 |
| 27 | Ga0065704_10000226 | 3300005289 | Bacteria | 67111 |
| 28 | Ga0065704_10119969 | 3300005289 | Bacteria | 1791 |
| 29 | Ga0065707_10090632 | 3300005295 | Bacteria | 4100 |
| 30 | Ga0070658_10129286 | 3300005327 | Bacteria | 2104 |
| 31 | Ga0070658_10441001 | 3300005327 | Bacteria | 1121 |
| 32 | Ga0070676_10078696 | 3300005328 | Bacteria | 1995 |
| 33 | Ga0070683_100017779 | 3300005329 | Bacteria | 6282 |
| 34 | Ga0070683_100167866 | 3300005329 | Unclassified | 2083 |
| 35 | Ga0070670_100078328 | 3300005331 | Bacteria | 2839 |
| 36 | Ga0070670_100244878 | 3300005331 | Bacteria | 1561 |
| 37 | Ga0068869_100038656 | 3300005334 | Bacteria | 3403 |
| 38 | Ga0068869_100177995 | 3300005334 | Bacteria | 1666 |
| 39 | Ga0070666_10000375 | 3300005335 | Bacteria | 28142 |
| 40 | Ga0070680_100015462 | 3300005336 | Bacteria | 5983 |
| 41 | Ga0070680_100031279 | 3300005336 | Bacteria | 4279 |
| 42 | Ga0070682_100000482 | 3300005337 | Bacteria | 25028 |
| 43 | Ga0070682_100332961 | 3300005337 | Bacteria | 1126 |
| 44 | Ga0068868_100131455 | 3300005338 | Bacteria | 2048 |
| 45 | Ga0070660_100016725 | 3300005339 | Bacteria | 5332 |
| 46 | Ga0070668_100002219 | 3300005347 | Bacteria | 14265 |
| 47 | Ga0070669_100001299 | 3300005353 | Bacteria | 18039 |
| 48 | Ga0070675_100004217 | 3300005354 | Bacteria | 10929 |
| 49 | Ga0070671_100252694 | 3300005355 | Bacteria | 1497 |
| 50 | Ga0070673_100102977 | 3300005364 | Bacteria | 2354 |
| 51 | Ga0070688_100028086 | 3300005365 | Bacteria | 3355 |
| 52 | Ga0070659_100001146 | 3300005366 | Bacteria | 19346 |
| 53 | Ga0070659_100002774 | 3300005366 | Bacteria | 12470 |
| 54 | Ga0070659_100337810 | 3300005366 | Bacteria | 1261 |
| 55 | Ga0070667_100008498 | 3300005367 | Bacteria | 8512 |
| 56 | Ga0070667_100224713 | 3300005367 | Bacteria | 1672 |
| 57 | Ga0070700_100125275 | 3300005441 | Bacteria | 1726 |
| 58 | Ga0070662_100012820 | 3300005457 | Bacteria | 5568 |
| 59 | Ga0068867_100298589 | 3300005459 | Bacteria | 1327 |
| 60 | Ga0070698_100336679 | 3300005471 | Bacteria | 1440 |
| 61 | Ga0070679_100000549 | 3300005530 | Bacteria | 31843 |
| 62 | Ga0070679_100005898 | 3300005530 | Bacteria | 11382 |
| 63 | Ga0070679_100024113 | 3300005530 | Bacteria | 5961 |
| 64 | Ga0070679_100069716 | 3300005530 | Bacteria | 3507 |
| 65 | Ga0070679_100200938 | 3300005530 | Unclassified | 1959 |
| 66 | Ga0070679_100594823 | 3300005530 | Bacteria | 1049 |
| 67 | Ga0070679_100624425 | 3300005530 | Bacteria | 1021 |
| 68 | Ga0070684_100019229 | 3300005535 | Bacteria | 5647 |
| 69 | Ga0068853_100079978 | 3300005539 | Bacteria | 2859 |
| 70 | Ga0068853_100181435 | 3300005539 | Bacteria | 1909 |
| 71 | Ga0068853_100550687 | 3300005539 | Bacteria | 1093 |
| 72 | Ga0070672_100109650 | 3300005543 | Bacteria | 2248 |
| 73 | Ga0068855_100000019 | 3300005563 | Bacteria | 205963 |
| 74 | Ga0068855_100000388 | 3300005563 | Bacteria | 54070 |
| 75 | Ga0068855_100012783 | 3300005563 | Bacteria | 10126 |
| 76 | Ga0068855_100013264 | 3300005563 | Bacteria | 9939 |
| 77 | Ga0068855_100025873 | 3300005563 | Bacteria | 7018 |
| 78 | Ga0068855_100027207 | 3300005563 | Bacteria | 6842 |
| 79 | Ga0068855_100030245 | 3300005563 | Bacteria | 6478 |
| 80 | Ga0068855_100444116 | 3300005563 | Bacteria | 1416 |
| 81 | Ga0068857_100102605 | 3300005577 | Bacteria | 2568 |
| 82 | Ga0068857_100669053 | 3300005577 | Unclassified | 985 |
| 83 | Ga0068854_100008761 | 3300005578 | Bacteria | 6514 |
| 84 | Ga0068854_100623402 | 3300005578 | Bacteria | 923 |
| 85 | Ga0068856_100001034 | 3300005614 | Bacteria | 29577 |
| 86 | Ga0068856_100075223 | 3300005614 | Unclassified | 3345 |
| 87 | Ga0068856_100189912 | 3300005614 | Bacteria | 2068 |
| 88 | Ga0068852_100025858 | 3300005616 | Bacteria | 4763 |
| 89 | Ga0068852_100112751 | 3300005616 | Bacteria | 2475 |
| 90 | Ga0068852_100615982 | 3300005616 | Unclassified | 1091 |
| 91 | Ga0068859_100000086 | 3300005617 | Bacteria | 85696 |
| 92 | Ga0068859_100039542 | 3300005617 | Bacteria | 4732 |
| 93 | Ga0068864_100409164 | 3300005618 | Bacteria | 1290 |
| 94 | Ga0068864_100740711 | 3300005618 | Bacteria | 963 |
| 95 | Ga0068851_10025308 | 3300005834 | Unclassified | 2911 |
| 96 | Ga0068870_10006552 | 3300005840 | Bacteria | 5137 |
| 97 | Ga0068863_100013044 | 3300005841 | Bacteria | 8013 |
| 98 | Ga0068863_100018526 | 3300005841 | Bacteria | 6663 |
| 99 | Ga0068858_100002273 | 3300005842 | Bacteria | 19437 |
| 100 | Ga0068858_100096352 | 3300005842 | Bacteria | 2757 |
| 101 | Ga0068860_100002118 | 3300005843 | Bacteria | 20935 |
| 102 | Ga0068860_100004278 | 3300005843 | Bacteria | 14603 |
| 103 | Ga0081455_10118188 | 3300005937 | Bacteria | 2093 |
| 104 | Ga0081539_10001743 | 3300005985 | Bacteria | 34704 |
| 105 | Ga0075366_10002704 | 3300006195 | Bacteria | 9153 |
| 106 | Ga0075366_10015888 | 3300006195 | Bacteria | 4320 |
| 107 | Ga0075366_10077832 | 3300006195 | Bacteria | 1979 |
| 108 | Ga0068871_100020799 | 3300006358 | Bacteria | 5033 |
| 109 | Ga0068865_100627104 | 3300006881 | Unclassified | 911 |
| 110 | Ga0097620_100000086 | 3300006931 | Bacteria | 85696 |
| 111 | Ga0097620_100039542 | 3300006931 | Bacteria | 4732 |
| 112 | Ga0099826_10059880 | 3300006948 | Bacteria | 2485 |
| 113 | Ga0105240_10002660 | 3300009093 | Bacteria | 28423 |
| 114 | Ga0105240_10063765 | 3300009093 | Bacteria | 4582 |
| 115 | Ga0105240_10078201 | 3300009093 | Bacteria | 4074 |
| 116 | Ga0105240_10172669 | 3300009093 | Bacteria | 2559 |
| 117 | Ga0111539_10004188 | 3300009094 | Bacteria | 18932 |
| 118 | Ga0111539_10022183 | 3300009094 | Bacteria | 7804 |
| 119 | Ga0105245_10355338 | 3300009098 | Bacteria | 1453 |
| 120 | Ga0105247_10002917 | 3300009101 | Bacteria | 11377 |
| 121 | Ga0105243_10141359 | 3300009148 | Bacteria | 2054 |
| 122 | Ga0105241_10000668 | 3300009174 | Bacteria | 25809 |
| 123 | Ga0105241_10001385 | 3300009174 | Bacteria | 18527 |
| 124 | Ga0105241_10015267 | 3300009174 | Bacteria | 5624 |
| 125 | Ga0105241_10277378 | 3300009174 | Bacteria | 1430 |
| 126 | Ga0105242_10376214 | 3300009176 | Bacteria | 1319 |
| 127 | Ga0105237_10001001 | 3300009545 | Bacteria | 38035 |
| 128 | Ga0105237_10001891 | 3300009545 | Bacteria | 26726 |
| 129 | Ga0105237_10002720 | 3300009545 | Bacteria | 21581 |
| 130 | Ga0105237_10011718 | 3300009545 | Bacteria | 9272 |
| 131 | Ga0105237_10042255 | 3300009545 | Bacteria | 4598 |
| 132 | Ga0105237_10144217 | 3300009545 | Bacteria | 2376 |
| 133 | Ga0105237_10202771 | 3300009545 | Bacteria | 1984 |
| 134 | Ga0105237_10202778 | 3300009545 | Bacteria | 1984 |
| 135 | Ga0105237_10413352 | 3300009545 | Bacteria | 1354 |
| 136 | Ga0105238_10011946 | 3300009551 | Bacteria | 8749 |
| 137 | Ga0105238_10111589 | 3300009551 | Bacteria | 2714 |
| 138 | Ga0105249_10003436 | 3300009553 | Bacteria | 13717 |
| 139 | Ga0105239_10000004 | 3300010375 | Bacteria | 532483 |
| 140 | Ga0105239_10000012 | 3300010375 | Bacteria | 332279 |
| 141 | Ga0105239_10000249 | 3300010375 | Bacteria | 80515 |
| 142 | Ga0105239_10000299 | 3300010375 | Bacteria | 73314 |
| 143 | Ga0105239_10000976 | 3300010375 | Bacteria | 40167 |
| 144 | Ga0105239_10002652 | 3300010375 | Bacteria | 22569 |
| 145 | Ga0105239_10141943 | 3300010375 | Bacteria | 2677 |
| 146 | Ga0105239_10154604 | 3300010375 | Bacteria | 2561 |
| 147 | Ga0105239_10173365 | 3300010375 | Unclassified | 2413 |
| 148 | Ga0157373_10000327 | 3300013100 | Bacteria | 38493 |
| 149 | Ga0157373_10008374 | 3300013100 | Bacteria | 7681 |
| 150 | Ga0157373_10050048 | 3300013100 | Bacteria | 2977 |
| 151 | Ga0157373_10207440 | 3300013100 | Bacteria | 1381 |
| 152 | Ga0157371_10023206 | 3300013102 | Bacteria | 4536 |
| 153 | Ga0157371_10023855 | 3300013102 | Unclassified | 4471 |
| 154 | Ga0157371_10028332 | 3300013102 | Bacteria | 4057 |
| 155 | Ga0157371_10284657 | 3300013102 | Unclassified | 1195 |
| 156 | Ga0157370_10000831 | 3300013104 | Bacteria | 39105 |
| 157 | Ga0157370_10004819 | 3300013104 | Bacteria | 15338 |
| 158 | Ga0157370_10085136 | 3300013104 | Bacteria | 2970 |
| 159 | Ga0157370_10149180 | 3300013104 | Unclassified | 2176 |
| 160 | Ga0157370_10283177 | 3300013104 | Bacteria | 1531 |
| 161 | Ga0157370_10400819 | 3300013104 | Bacteria | 1263 |
| 162 | Ga0157369_10010233 | 3300013105 | Bacteria | 10702 |
| 163 | Ga0157369_10060549 | 3300013105 | Bacteria | 4082 |
| 164 | Ga0157369_10508437 | 3300013105 | Unclassified | 1246 |
| 165 | Ga0157374_10196854 | 3300013296 | Unclassified | 1972 |
| 166 | Ga0157378_10017968 | 3300013297 | Bacteria | 6209 |
| 167 | Ga0157378_10044100 | 3300013297 | Bacteria | 3960 |
| 168 | Ga0163162_10003760 | 3300013306 | Bacteria | 14539 |
| 169 | Ga0163162_10033338 | 3300013306 | Bacteria | 5117 |
| 170 | Ga0157372_10000980 | 3300013307 | Bacteria | 31160 |
| 171 | Ga0157372_10006396 | 3300013307 | Bacteria | 12533 |
| 172 | Ga0157372_10006608 | 3300013307 | Bacteria | 12340 |
| 173 | Ga0157372_10099048 | 3300013307 | Bacteria | 3325 |
| 174 | Ga0157372_10112294 | 3300013307 | Bacteria | 3122 |
| 175 | Ga0157372_10314118 | 3300013307 | Bacteria | 1824 |
| 176 | Ga0157372_10444814 | 3300013307 | Bacteria | 1510 |
| 177 | Ga0157372_10505936 | 3300013307 | Unclassified | 1408 |
| 178 | Ga0157375_10021906 | 3300013308 | Bacteria | 5873 |
| 179 | Ga0157375_10314087 | 3300013308 | Bacteria | 1731 |
| 180 | Ga0163163_10651740 | 3300014325 | Bacteria | 1116 |
| 181 | Ga0157380_10010487 | 3300014326 | Bacteria | 6666 |
| 182 | Ga0157380_10162573 | 3300014326 | Bacteria | 1942 |
| 183 | Ga0157380_10308635 | 3300014326 | Unclassified | 1461 |
| 184 | Ga0182008_10000020 | 3300014497 | Bacteria | 228333 |
| 185 | Ga0157377_10001601 | 3300014745 | Bacteria | 9848 |
| 186 | Ga0157376_10044104 | 3300014969 | Bacteria | 3664 |
| 187 | Ga0163161_10029273 | 3300017792 | Bacteria | 3915 |
| 188 | Ga0206351_10242821 | 3300020077 | Bacteria | 4665 |
| 189 | Ga0207427_100085 | 3300025231 | Bacteria | 142561 |
| 190 | Ga0209437_100052 | 3300025233 | Bacteria | 380548 |
| 191 | Ga0209437_100102 | 3300025233 | Bacteria | 224216 |
| 192 | Ga0209233_1000067 | 3300025261 | Bacteria | 380554 |
| 193 | Ga0209233_1009381 | 3300025261 | Bacteria | 2981 |
| 194 | Ga0209455_1006064 | 3300025272 | Bacteria | 3632 |
| 195 | Ga0209676_1001044 | 3300025292 | Bacteria | 31924 |
| 196 | Ga0207656_10020596 | 3300025321 | Unclassified | 2624 |
| 197 | Ga0207710_10117069 | 3300025900 | Bacteria | 1269 |
| 198 | Ga0207680_10000117 | 3300025903 | Bacteria | 36819 |
| 199 | Ga0207645_10008474 | 3300025907 | Bacteria | 7169 |
| 200 | Ga0207645_10061460 | 3300025907 | Bacteria | 2399 |
| 201 | Ga0207643_10042525 | 3300025908 | Bacteria | 2562 |
| 202 | Ga0207705_10065283 | 3300025909 | Bacteria | 2631 |
| 203 | Ga0207654_10000168 | 3300025911 | Bacteria | 41625 |
| 204 | Ga0207654_10001156 | 3300025911 | Bacteria | 14193 |
| 205 | Ga0207654_10040178 | 3300025911 | Unclassified | 2635 |
| 206 | Ga0207707_10000117 | 3300025912 | Bacteria | 80929 |
| 207 | Ga0207707_10088851 | 3300025912 | Bacteria | 2700 |
| 208 | Ga0207695_10057507 | 3300025913 | Bacteria | 4039 |
| 209 | Ga0207695_10371886 | 3300025913 | Bacteria | 1315 |
| 210 | Ga0207671_10000905 | 3300025914 | Bacteria | 37474 |
| 211 | Ga0207671_10001845 | 3300025914 | Bacteria | 23653 |
| 212 | Ga0207671_10014324 | 3300025914 | Bacteria | 6274 |
| 213 | Ga0207671_10021326 | 3300025914 | Unclassified | 4917 |
| 214 | Ga0207671_10021367 | 3300025914 | Bacteria | 4911 |
| 215 | Ga0207671_10058087 | 3300025914 | Bacteria | 2868 |
| 216 | Ga0207660_10001028 | 3300025917 | Bacteria | 18473 |
| 217 | Ga0207660_10032486 | 3300025917 | Bacteria | 3602 |
| 218 | Ga0207660_10040992 | 3300025917 | Bacteria | 3243 |
| 219 | Ga0207652_10000280 | 3300025921 | Bacteria | 53021 |
| 220 | Ga0207652_10016686 | 3300025921 | Bacteria | 6001 |
| 221 | Ga0207652_10039300 | 3300025921 | Unclassified | 4015 |
| 222 | Ga0207652_10356930 | 3300025921 | Unclassified | 1319 |
| 223 | Ga0207694_10071563 | 3300025924 | Bacteria | 2710 |
| 224 | Ga0207694_10152248 | 3300025924 | Bacteria | 1864 |
| 225 | Ga0207650_10045949 | 3300025925 | Bacteria | 3214 |
| 226 | Ga0207650_10149109 | 3300025925 | Bacteria | 1844 |
| 227 | Ga0207650_10183335 | 3300025925 | Bacteria | 1669 |
| 228 | Ga0207659_10032248 | 3300025926 | Bacteria | 3593 |
| 229 | Ga0207687_10272184 | 3300025927 | Bacteria | 1354 |
| 230 | Ga0207644_10068500 | 3300025931 | Bacteria | 2589 |
| 231 | Ga0207690_10000216 | 3300025932 | Bacteria | 43848 |
| 232 | Ga0207690_10366231 | 3300025932 | Bacteria | 1143 |
| 233 | Ga0207669_10314522 | 3300025937 | Bacteria | 1196 |
| 234 | Ga0207691_10120168 | 3300025940 | Bacteria | 2329 |
| 235 | Ga0207691_10402117 | 3300025940 | Unclassified | 1168 |
| 236 | Ga0207689_10000260 | 3300025942 | Bacteria | 47416 |
| 237 | Ga0207689_10018593 | 3300025942 | Bacteria | 5862 |
| 238 | Ga0207661_10014978 | 3300025944 | Bacteria | 5694 |
| 239 | Ga0207667_10000020 | 3300025949 | Bacteria | 374770 |
| 240 | Ga0207667_10008655 | 3300025949 | Bacteria | 12069 |
| 241 | Ga0207667_10020792 | 3300025949 | Bacteria | 7289 |
| 242 | Ga0207667_10028694 | 3300025949 | Bacteria | 6042 |
| 243 | Ga0207667_10044174 | 3300025949 | Bacteria | 4723 |
| 244 | Ga0207667_10372558 | 3300025949 | Bacteria | 1455 |
| 245 | Ga0207667_10423498 | 3300025949 | Bacteria | 1354 |
| 246 | Ga0207651_10044937 | 3300025960 | Bacteria | 2960 |
| 247 | Ga0207712_10113728 | 3300025961 | Bacteria | 2035 |
| 248 | Ga0207668_10026622 | 3300025972 | Bacteria | 3757 |
| 249 | Ga0207640_10005930 | 3300025981 | Bacteria | 6670 |
| 250 | Ga0207658_10001959 | 3300025986 | Bacteria | 15364 |
| 251 | Ga0207658_10356346 | 3300025986 | Bacteria | 1275 |
| 252 | Ga0207677_10156040 | 3300026023 | Bacteria | 1767 |
| 253 | Ga0207677_10237164 | 3300026023 | Bacteria | 1473 |
| 254 | Ga0207703_10004860 | 3300026035 | Bacteria | 10936 |
| 255 | Ga0207639_10313354 | 3300026041 | Unclassified | 1391 |
| 256 | Ga0207639_10612097 | 3300026041 | Bacteria | 1005 |
| 257 | Ga0207639_10616438 | 3300026041 | Bacteria | 1002 |
| 258 | Ga0207708_10180962 | 3300026075 | Bacteria | 1674 |
| 259 | Ga0207702_10000161 | 3300026078 | Bacteria | 79598 |
| 260 | Ga0207641_10000061 | 3300026088 | Bacteria | 160161 |
| 261 | Ga0207641_10081194 | 3300026088 | Bacteria | 2815 |
| 262 | Ga0207648_10090916 | 3300026089 | Bacteria | 2668 |
| 263 | Ga0207676_10666118 | 3300026095 | Bacteria | 1005 |
| 264 | Ga0207674_10062977 | 3300026116 | Bacteria | 3745 |
| 265 | Ga0207674_10083394 | 3300026116 | Bacteria | 3196 |
| 266 | Ga0207674_10094772 | 3300026116 | Unclassified | 2971 |
| 267 | Ga0207675_100000468 | 3300026118 | Bacteria | 39425 |
| 268 | Ga0207698_10041111 | 3300026142 | Bacteria | 3442 |
| 269 | Ga0207698_10088805 | 3300026142 | Bacteria | 2522 |
| 270 | Ga0207698_10472968 | 3300026142 | Bacteria | 1214 |
| 271 | Ga0209489_111689 | 3300027361 | Bacteria | 8728 |
| 272 | Ga0209282_1209820 | 3300027666 | Bacteria | 890 |
| 273 | Ga0268264_10001938 | 3300028381 | Bacteria | 18618 |
| 274 | Ga0268264_10002707 | 3300028381 | Bacteria | 15465 |
| 275 | Ga0307515_10000002 | 3300028794 | Bacteria | 1231751 |
| 276 | Ga0307515_10000007 | 3300028794 | Bacteria | 719669 |
| 277 | Ga0307515_10000667 | 3300028794 | Bacteria | 79135 |
| 278 | Ga0307515_10001029 | 3300028794 | Bacteria | 63730 |
| 279 | Ga0307515_10081240 | 3300028794 | Bacteria | 4213 |
| 280 | Ga0265338_10241376 | 3300028800 | Bacteria | 1338 |
| 281 | Ga0265338_10263803 | 3300028800 | Bacteria | 1265 |
| 282 | Ga0265324_10049365 | 3300029957 | Bacteria | 1447 |
| 283 | Ga0265327_10000488 | 3300031251 | Bacteria | 69809 |
| 284 | Ga0265327_10066454 | 3300031251 | Bacteria | 1820 |
| 285 | Ga0265327_10069666 | 3300031251 | Bacteria | 1765 |
| 286 | Ga0265327_10112238 | 3300031251 | Bacteria | 1301 |
| 287 | Ga0307509_10095704 | 3300031507 | Bacteria | 3024 |
| 288 | Ga0307408_100000329 | 3300031548 | Bacteria | 45457 |
| 289 | Ga0265313_10044902 | 3300031595 | Bacteria | 2154 |
| 290 | Ga0307514_10026210 | 3300031649 | Bacteria | 4714 |
| 291 | Ga0307406_10136118 | 3300031901 | Bacteria | 1731 |
| 292 | Ga0307412_10000001 | 3300031911 | Bacteria | 822691 |
| 293 | Ga0307412_10678387 | 3300031911 | Bacteria | 882 |
| 294 | Ga0307416_100000066 | 3300032002 | Bacteria | 94549 |
| 295 | Ga0307414_10003898 | 3300032004 | Bacteria | 8037 |
| 296 | Ga0307414_10027173 | 3300032004 | Bacteria | 3694 |
| 297 | Ga0307414_10141516 | 3300032004 | Bacteria | 1884 |
| 298 | Ga0307414_10176763 | 3300032004 | Bacteria | 1713 |
| 299 | Ga0307414_10181315 | 3300032004 | Bacteria | 1694 |
| 300 | Ga0373924_0035378 | 3300035410 | Bacteria | 2026 |
| 301 | Ga0373935_0185703 | 3300035692 | Bacteria | 1429 |
| 302 | Ga0395899_0000001 | 3300037312 | Bacteria | 1750322 |
| 303 | Ga0395899_0000182 | 3300037312 | Bacteria | 92470 |
| 304 | Ga0395900_0586530 | 3300037418 | Bacteria | 1056 |
| 305 | Ga0436365_1478753 | 3300039437 | Unclassified | 1981 |
| 306 | Ga0451807_0262958 | 3300041486 | Unclassified | 887 |
| 307 | Ga0439445_0010836 | 3300042004 | Bacteria | 2165 |
| 308 | Ga0439445_0049394 | 3300042004 | Bacteria | 1133 |
| 309 | Ga0439449_0014799 | 3300042007 | Bacteria | 2931 |
| 310 | Ga0450898_003719 | 3300042134 | Bacteria | 2208 |
| 311 | Ga0451577_0180708 | 3300042876 | Bacteria | 1902 |
| 312 | Ga0451577_0189116 | 3300042876 | Bacteria | 1857 |
| 313 | Ga0466961_0009336 | 3300044693 | Bacteria | 6248 |
| 314 | Ga0466970_0044673 | 3300044765 | Bacteria | 2359 |
| 315 | Ga0466960_0158363 | 3300044901 | Bacteria | 1214 |
| 316 | Ga0466959_0011130 | 3300045049 | Bacteria | 6455 |
| 317 | Ga0466958_0044661 | 3300045836 | Bacteria | 2671 |
| 318 | Ga0495651_0176374 | 3300046462 | Bacteria | 1517 |
| 319 | Ga0495650_0002914 | 3300046471 | Bacteria | 12995 |
| 320 | Ga0495580_0329522 | 3300046472 | Bacteria | 1037 |
| 321 | Ga0495585_0000091 | 3300046492 | Bacteria | 95620 |
| 322 | Ga0495606_0003447 | 3300046507 | Bacteria | 16780 |
| 323 | Ga0495606_0005837 | 3300046507 | Bacteria | 11609 |
| 324 | Ga0495610_0000959 | 3300046512 | Bacteria | 26649 |
| 325 | Ga0495616_0003738 | 3300046513 | Bacteria | 9708 |
| 326 | Ga0495616_0004186 | 3300046513 | Bacteria | 9143 |
| 327 | Ga0495632_0096051 | 3300046519 | Bacteria | 1400 |
| 328 | Ga0495637_0076706 | 3300046520 | Bacteria | 1339 |
| 329 | Ga0495648_0099288 | 3300046524 | Bacteria | 1611 |
| 330 | Ga0495652_0338857 | 3300046529 | Bacteria | 1081 |
| 331 | Ga0495633_0000006 | 3300046558 | Bacteria | 326774 |
| 332 | Ga0495633_0004900 | 3300046558 | Bacteria | 8358 |
| 333 | Ga0495668_0000918 | 3300046616 | Bacteria | 32911 |
| 334 | Ga0495668_0154775 | 3300046616 | Bacteria | 1255 |
| 335 | Ga0495625_0000059 | 3300046660 | Bacteria | 180330 |
| 336 | Ga0495625_0002083 | 3300046660 | Bacteria | 22359 |
| 337 | Ga0495625_0036200 | 3300046660 | Bacteria | 3630 |
| 338 | Ga0495625_0066387 | 3300046660 | Bacteria | 2541 |
| 339 | Ga0495625_0086825 | 3300046660 | Unclassified | 2170 |
| 340 | Ga0495625_0184100 | 3300046660 | Bacteria | 1387 |
| 341 | Ga0495635_0049691 | 3300046663 | Bacteria | 2891 |
| 342 | Ga0495661_0000511 | 3300046665 | Bacteria | 40405 |
| 343 | Ga0495657_0191170 | 3300046675 | Bacteria | 1251 |
| 344 | Ga0495658_0002979 | 3300046683 | Bacteria | 8478 |
| 345 | Ga0495671_0144986 | 3300046692 | Bacteria | 1156 |
| 346 | Ga0495649_0001008 | 3300046694 | Bacteria | 22135 |
| 347 | Ga0495589_0142276 | 3300046794 | Bacteria | 1148 |
| 348 | Ga0495660_0020260 | 3300046810 | Bacteria | 3812 |
| 349 | Ga0495676_0151436 | 3300047321 | Bacteria | 1650 |
| 350 | Ga0495687_003426 | 3300047443 | Bacteria | 11505 |
| 351 | Ga0495684_0070218 | 3300047471 | Bacteria | 2663 |
| 352 | Ga0495686_0001059 | 3300047472 | Bacteria | 32862 |
| 353 | Ga0495686_0026024 | 3300047472 | Bacteria | 3830 |
| 354 | Ga0495686_0140579 | 3300047472 | Bacteria | 1425 |
| 355 | Ga0495686_0206370 | 3300047472 | Bacteria | 1125 |
| 356 | Ga0495614_0019603 | 3300048089 | Bacteria | 2927 |
| 357 | Ga0496114_0478018 | 3300048917 | Bacteria | 1102 |
| 358 | Ga0496115_0090369 | 3300048918 | Bacteria | 2502 |
| 359 | Ga0495678_003800 | 3300049459 | Bacteria | 9110 |
| 360 | Ga0501290_007613 | 3300049513 | Bacteria | 1359 |
| 361 | Ga0501296_008386 | 3300049519 | Bacteria | 1197 |
| 362 | Ga0501298_000487 | 3300049521 | Bacteria | 5356 |
| 363 | Ga0501300_002270 | 3300049523 | Bacteria | 2876 |
| 364 | Ga0501300_017145 | 3300049523 | Bacteria | 1057 |
| 365 | Ga0501032_0005230 | 3300049569 | Bacteria | 9661 |
| 366 | Ga0501034_0028044 | 3300049571 | Bacteria | 5726 |
| 367 | Ga0501034_0064515 | 3300049571 | Bacteria | 3676 |
| 368 | Ga0501036_0111632 | 3300049572 | Bacteria | 2310 |
| 369 | Ga0501037_0113031 | 3300049573 | Bacteria | 1955 |
| 370 | Ga0501038_0023587 | 3300049574 | Bacteria | 5498 |
| 371 | Ga0501043_0024414 | 3300049579 | Bacteria | 4744 |
| 372 | Ga0501043_0066386 | 3300049579 | Bacteria | 2833 |
| 373 | Ga0501198_000671 | 3300049649 | Bacteria | 4262 |
| 374 | Ga0501201_000292 | 3300049651 | Bacteria | 4554 |
| 375 | Ga0501202_000022 | 3300049652 | Bacteria | 16472 |
| 376 | Ga0501206_004994 | 3300049653 | Bacteria | 1704 |
| 377 | Ga0501207_004358 | 3300049654 | Bacteria | 1920 |
| 378 | Ga0501217_001283 | 3300049661 | Bacteria | 4664 |
| 379 | Ga0501222_005096 | 3300049662 | Bacteria | 1778 |
| 380 | Ga0501223_008431 | 3300049663 | Bacteria | 2101 |
| 381 | Ga0501224_018034 | 3300049664 | Bacteria | 1051 |
| 382 | Ga0501233_020250 | 3300049668 | Bacteria | 1418 |
| 383 | Ga0501235_003884 | 3300049669 | Bacteria | 3231 |
| 384 | Ga0501238_011693 | 3300049671 | Bacteria | 1182 |
| 385 | Ga0501240_001027 | 3300049673 | Bacteria | 2580 |
| 386 | Ga0501243_004826 | 3300049675 | Bacteria | 2024 |
| 387 | Ga0501251_015843 | 3300049681 | Bacteria | 952 |
| 388 | Ga0501252_019175 | 3300049682 | Bacteria | 881 |
| 389 | Ga0501253_005186 | 3300049683 | Bacteria | 1693 |
| 390 | Ga0501257_003705 | 3300049686 | Bacteria | 3300 |
| 391 | Ga0501257_004825 | 3300049686 | Bacteria | 2952 |
| 392 | Ga0501259_000349 | 3300049688 | Bacteria | 7232 |
| 393 | Ga0501259_002575 | 3300049688 | Bacteria | 2925 |
| 394 | Ga0501259_027308 | 3300049688 | Bacteria | 1056 |
| 395 | Ga0501261_000251 | 3300049690 | Bacteria | 7363 |
| 396 | Ga0501221_008138 | 3300049704 | Bacteria | 1816 |
| 397 | Ga0501225_0012343 | 3300049705 | Bacteria | 2399 |
| 398 | Ga0501234_000168 | 3300049707 | Bacteria | 8998 |
| 399 | Ga0501245_001736 | 3300049708 | Bacteria | 2854 |
| 400 | Ga0501232_001540 | 3300049757 | Bacteria | 1857 |
| 401 | Ga0501241_012847 | 3300049758 | Bacteria | 1522 |
| 402 | Ga0501268_024277 | 3300049765 | Bacteria | 1058 |
| 403 | Ga0501279_008877 | 3300049775 | Bacteria | 1345 |
| 404 | Ga0501280_008061 | 3300049776 | Bacteria | 1469 |
| 405 | Ga0501035_0018034 | 3300049822 | Bacteria | 6505 |
| 406 | Ga0501035_0118933 | 3300049822 | Bacteria | 2311 |
| 407 | Ga0501044_0029038 | 3300049823 | Bacteria | 5833 |
| 408 | Ga0501044_0070176 | 3300049823 | Bacteria | 3565 |
| 409 | Ga0501212_005826 | 3300049851 | Bacteria | 1642 |
| 410 | nmdc:mga0k408_105645_c1 | 3300050493 | Bacteria | 1663 |
| 411 | nmdc:mga0k408_9670_c1 | 3300050493 | Bacteria | 5205 |
| 412 | Ga0500578_0191869 | 3300053086 | Bacteria | 1254 |
| 413 | Ga0500651_0000357 | 3300053093 | Bacteria | 25575 |
| 414 | Ga0500556_0016763 | 3300053104 | Bacteria | 2284 |
| 415 | Ga0500608_000365 | 3300053122 | Bacteria | 17523 |
| 416 | Ga0500618_000010 | 3300053125 | Bacteria | 203909 |
| 417 | Ga0500616_0000853 | 3300053153 | Bacteria | 33843 |
| 418 | Ga0500616_0142589 | 3300053153 | Bacteria | 1118 |
| 419 | Ga0500622_0000008 | 3300053156 | Bacteria | 423636 |
| 420 | Ga0500622_0000417 | 3300053156 | Bacteria | 40427 |
| 421 | Ga0500622_0001946 | 3300053156 | Bacteria | 15545 |
| 422 | Ga0500611_000008 | 3300053727 | Bacteria | 198346 |
| 423 | Ga0466962_0038765 | 3300061719 | Bacteria | 2282 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013296 | Ga0157374_10196854 | Ga0157374_101968542 | 236 |
| 2 | 3300026142 | Ga0207698_10472968 | Ga0207698_104729682 | 236 |
| 3 | 3300031548 | Ga0307408_100000329 | Ga0307408_10000032943 | 237 |
| 4 | 3300049523 | Ga0501300_002270 | Ga0501300_002270_382_1155 | 241 |
| 5 | 3300005355 | Ga0070671_100252694 | Ga0070671_1002526942 | 242 |
| 6 | 3300005364 | Ga0070673_100102977 | Ga0070673_1001029773 | 242 |
| 7 | 3300005618 | Ga0068864_100740711 | Ga0068864_1007407111 | 242 |
| 8 | 3300005834 | Ga0068851_10025308 | Ga0068851_100253084 | 242 |
| 9 | 3300005841 | Ga0068863_100018526 | Ga0068863_1000185265 | 242 |
| 10 | 3300005842 | Ga0068858_100096352 | Ga0068858_1000963522 | 242 |
| 11 | 3300010375 | Ga0105239_10000249 | Ga0105239_1000024953 | 242 |
| 12 | 3300013308 | Ga0157375_10314087 | Ga0157375_103140872 | 242 |
| 13 | 3300014325 | Ga0163163_10651740 | Ga0163163_106517402 | 242 |
| 14 | 3300025321 | Ga0207656_10020596 | Ga0207656_100205962 | 242 |
| 15 | 3300025925 | Ga0207650_10149109 | Ga0207650_101491092 | 242 |
| 16 | 3300025931 | Ga0207644_10068500 | Ga0207644_100685002 | 242 |
| 17 | 3300025960 | Ga0207651_10044937 | Ga0207651_100449372 | 242 |
| 18 | 3300026088 | Ga0207641_10081194 | Ga0207641_100811944 | 242 |
| 19 | 3300046665 | Ga0495661_0000511 | Ga0495661_0000511_29363_30091 | 242 |
| 20 | 3300013307 | Ga0157372_10112294 | Ga0157372_101122942 | 246 |
| 21 | 3300046616 | Ga0495668_0000918 | Ga0495668_0000918_10947_11777 | 246 |
| 22 | 3300031901 | Ga0307406_10136118 | Ga0307406_101361182 | 247 |
| 23 | 3300005367 | Ga0070667_100008498 | Ga0070667_1000084986 | 248 |
| 24 | 3300005843 | Ga0068860_100002118 | Ga0068860_1000021185 | 248 |
| 25 | 3300013297 | Ga0157378_10044100 | Ga0157378_100441004 | 248 |
| 26 | 3300025986 | Ga0207658_10001959 | Ga0207658_1000195914 | 248 |
| 27 | 3300028381 | Ga0268264_10001938 | Ga0268264_100019386 | 248 |
| 28 | 3300037312 | Ga0395899_0000182 | Ga0395899_0000182_54894_55682 | 248 |
| 29 | 3300037418 | Ga0395900_0586530 | Ga0395900_0586530_187_975 | 248 |
| 30 | 3300046472 | Ga0495580_0329522 | Ga0495580_0329522_97_879 | 248 |
| 31 | 3300003320 | rootH2_10235801 | rootH2_102358014 | 249 |
| 32 | 3300003322 | rootL2_10040638 | rootL2_100406384 | 249 |
| 33 | 3300005366 | Ga0070659_100001146 | Ga0070659_10000114612 | 249 |
| 34 | 3300025932 | Ga0207690_10000216 | Ga0207690_1000021614 | 249 |
| 35 | 3300009094 | Ga0111539_10022183 | Ga0111539_100221832 | 251 |
| 36 | 3300049671 | Ga0501238_011693 | Ga0501238_011693_369_1157 | 251 |
| 37 | 3300003323 | rootH1_10379409 | rootH1_103794092 | 252 |
| 38 | 3300005985 | Ga0081539_10001743 | Ga0081539_1000174312 | 252 |
| 39 | 3300013102 | Ga0157371_10284657 | Ga0157371_102846572 | 252 |
| 40 | 3300049569 | Ga0501032_0005230 | Ga0501032_0005230_1572_2360 | 252 |
| 41 | 3300049571 | Ga0501034_0028044 | Ga0501034_0028044_778_1566 | 252 |
| 42 | 3300049572 | Ga0501036_0111632 | Ga0501036_0111632_834_1622 | 252 |
| 43 | 3300049573 | Ga0501037_0113031 | Ga0501037_0113031_307_1095 | 252 |
| 44 | 3300049574 | Ga0501038_0023587 | Ga0501038_0023587_571_1359 | 252 |
| 45 | 3300049579 | Ga0501043_0024414 | Ga0501043_0024414_3663_4451 | 252 |
| 46 | 3300049579 | Ga0501043_0066386 | Ga0501043_0066386_1528_2316 | 252 |
| 47 | 3300049822 | Ga0501035_0118933 | Ga0501035_0118933_762_1550 | 252 |
| 48 | 3300049823 | Ga0501044_0029038 | Ga0501044_0029038_3975_4763 | 252 |
| 49 | 3300026041 | Ga0207639_10616438 | Ga0207639_106164382 | 253 |
| 50 | 3300025909 | Ga0207705_10065283 | Ga0207705_100652832 | 254 |
| 51 | 3300053086 | Ga0500578_0191869 | Ga0500578_0191869_169_936 | 255 |
| 52 | 3300053156 | Ga0500622_0001946 | Ga0500622_0001946_1286_2053 | 255 |
| 53 | iso_pu_bacteria | 2519899754 | 2520880522 | 255 |
| 54 | iso_pu_bacteria | 2816332280 | 2817414186 | 255 |
| 55 | iso_pu_bacteria | 2903895155 | 2903895262 | 255 |
| 56 | iso_pu_bacteria | 2958458903 | 2958459609 | 255 |
| 57 | 3300005366 | Ga0070659_100337810 | Ga0070659_1003378102 | 256 |
| 58 | 3300013102 | Ga0157371_10028332 | Ga0157371_100283322 | 256 |
| 59 | 3300013307 | Ga0157372_10099048 | Ga0157372_100990483 | 256 |
| 60 | 3300025932 | Ga0207690_10366231 | Ga0207690_103662311 | 256 |
| 61 | 3300049571 | Ga0501034_0064515 | Ga0501034_0064515_1183_1953 | 256 |
| 62 | 3300049822 | Ga0501035_0018034 | Ga0501035_0018034_1586_2356 | 256 |
| 63 | 3300049823 | Ga0501044_0070176 | Ga0501044_0070176_1017_1787 | 256 |
| 64 | iso_pu_bacteria | 2738541284 | 2738763269 | 256 |
| 65 | 3300005327 | Ga0070658_10441001 | Ga0070658_104410012 | 257 |
| 66 | 3300005336 | Ga0070680_100015462 | Ga0070680_1000154625 | 257 |
| 67 | 3300005339 | Ga0070660_100016725 | Ga0070660_1000167254 | 257 |
| 68 | 3300005366 | Ga0070659_100002774 | Ga0070659_1000027742 | 257 |
| 69 | 3300005530 | Ga0070679_100069716 | Ga0070679_1000697163 | 257 |
| 70 | 3300005530 | Ga0070679_100200938 | Ga0070679_1002009382 | 257 |
| 71 | 3300005530 | Ga0070679_100594823 | Ga0070679_1005948231 | 257 |
| 72 | 3300005563 | Ga0068855_100027207 | Ga0068855_1000272074 | 257 |
| 73 | 3300005577 | Ga0068857_100102605 | Ga0068857_1001026051 | 257 |
| 74 | 3300005577 | Ga0068857_100669053 | Ga0068857_1006690531 | 257 |
| 75 | 3300013100 | Ga0157373_10050048 | Ga0157373_100500482 | 257 |
| 76 | 3300013104 | Ga0157370_10149180 | Ga0157370_101491802 | 257 |
| 77 | 3300013105 | Ga0157369_10508437 | Ga0157369_105084372 | 257 |
| 78 | 3300013307 | Ga0157372_10444814 | Ga0157372_104448142 | 257 |
| 79 | 3300013307 | Ga0157372_10505936 | Ga0157372_105059361 | 257 |
| 80 | 3300025917 | Ga0207660_10040992 | Ga0207660_100409924 | 257 |
| 81 | 3300025921 | Ga0207652_10356930 | Ga0207652_103569301 | 257 |
| 82 | 3300025949 | Ga0207667_10044174 | Ga0207667_100441741 | 257 |
| 83 | 3300026116 | Ga0207674_10094772 | Ga0207674_100947722 | 257 |
| 84 | 3300053122 | Ga0500608_000365 | Ga0500608_000365_14678_15451 | 257 |
| 85 | 3300053156 | Ga0500622_0000008 | Ga0500622_0000008_397745_398518 | 257 |
| 86 | 3300005937 | Ga0081455_10118188 | Ga0081455_101181882 | 258 |
| 87 | iso_pu_bacteria | 2522125168 | 2522552137 | 258 |
| 88 | iso_pu_bacteria | 2599185184 | 2599482025 | 258 |
| 89 | iso_pu_bacteria | 2919186247 | 2919190597 | 258 |
| 90 | iso_pu_bacteria | 2919437846 | 2919443027 | 258 |
| 91 | iso_pu_bacteria | 2928078545 | 2928082080 | 258 |
| 92 | iso_pu_bacteria | 2928147474 | 2928153051 | 258 |
| 93 | iso_pu_bacteria | 2932082852 | 2932087923 | 258 |
| 94 | iso_pu_bacteria | 2939664404 | 2939669193 | 258 |
| 95 | 3300003323 | rootH1_10311811 | rootH1_103118111 | 259 |
| 96 | 3300005329 | Ga0070683_100167866 | Ga0070683_1001678661 | 259 |
| 97 | 3300005334 | Ga0068869_100038656 | Ga0068869_1000386562 | 259 |
| 98 | 3300005335 | Ga0070666_10000375 | Ga0070666_1000037517 | 259 |
| 99 | 3300005337 | Ga0070682_100332961 | Ga0070682_1003329611 | 259 |
| 100 | 3300005367 | Ga0070667_100224713 | Ga0070667_1002247132 | 259 |
| 101 | 3300005530 | Ga0070679_100005898 | Ga0070679_1000058982 | 259 |
| 102 | 3300005539 | Ga0068853_100550687 | Ga0068853_1005506872 | 259 |
| 103 | 3300005543 | Ga0070672_100109650 | Ga0070672_1001096502 | 259 |
| 104 | 3300005563 | Ga0068855_100012783 | Ga0068855_1000127837 | 259 |
| 105 | 3300005614 | Ga0068856_100075223 | Ga0068856_1000752234 | 259 |
| 106 | 3300005614 | Ga0068856_100189912 | Ga0068856_1001899122 | 259 |
| 107 | 3300005616 | Ga0068852_100615982 | Ga0068852_1006159822 | 259 |
| 108 | 3300005617 | Ga0068859_100000086 | Ga0068859_10000008619 | 259 |
| 109 | 3300005618 | Ga0068864_100409164 | Ga0068864_1004091641 | 259 |
| 110 | 3300005841 | Ga0068863_100013044 | Ga0068863_1000130447 | 259 |
| 111 | 3300005842 | Ga0068858_100002273 | Ga0068858_1000022733 | 259 |
| 112 | 3300005843 | Ga0068860_100004278 | Ga0068860_1000042785 | 259 |
| 113 | 3300006358 | Ga0068871_100020799 | Ga0068871_1000207994 | 259 |
| 114 | 3300006931 | Ga0097620_100000086 | Ga0097620_10000008664 | 259 |
| 115 | 3300006948 | Ga0099826_10059880 | Ga0099826_100598801 | 259 |
| 116 | 3300009098 | Ga0105245_10355338 | Ga0105245_103553382 | 259 |
| 117 | 3300009101 | Ga0105247_10002917 | Ga0105247_100029176 | 259 |
| 118 | 3300009148 | Ga0105243_10141359 | Ga0105243_101413591 | 259 |
| 119 | 3300009174 | Ga0105241_10001385 | Ga0105241_100013855 | 259 |
| 120 | 3300009174 | Ga0105241_10015267 | Ga0105241_100152676 | 259 |
| 121 | 3300009174 | Ga0105241_10277378 | Ga0105241_102773782 | 259 |
| 122 | 3300009176 | Ga0105242_10376214 | Ga0105242_103762142 | 259 |
| 123 | 3300009545 | Ga0105237_10001891 | Ga0105237_1000189113 | 259 |
| 124 | 3300009545 | Ga0105237_10413352 | Ga0105237_104133522 | 259 |
| 125 | 3300009553 | Ga0105249_10003436 | Ga0105249_1000343615 | 259 |
| 126 | 3300010375 | Ga0105239_10154604 | Ga0105239_101546043 | 259 |
| 127 | 3300010375 | Ga0105239_10173365 | Ga0105239_101733652 | 259 |
| 128 | 3300013100 | Ga0157373_10207440 | Ga0157373_102074402 | 259 |
| 129 | 3300013102 | Ga0157371_10023855 | Ga0157371_100238552 | 259 |
| 130 | 3300013104 | Ga0157370_10004819 | Ga0157370_100048198 | 259 |
| 131 | 3300013105 | Ga0157369_10010233 | Ga0157369_1001023310 | 259 |
| 132 | 3300013306 | Ga0163162_10003760 | Ga0163162_100037603 | 259 |
| 133 | 3300014969 | Ga0157376_10044104 | Ga0157376_100441043 | 259 |
| 134 | 3300025900 | Ga0207710_10117069 | Ga0207710_101170692 | 259 |
| 135 | 3300025903 | Ga0207680_10000117 | Ga0207680_1000011713 | 259 |
| 136 | 3300025907 | Ga0207645_10061460 | Ga0207645_100614601 | 259 |
| 137 | 3300025911 | Ga0207654_10001156 | Ga0207654_100011565 | 259 |
| 138 | 3300025911 | Ga0207654_10040178 | Ga0207654_100401783 | 259 |
| 139 | 3300025914 | Ga0207671_10001845 | Ga0207671_1000184518 | 259 |
| 140 | 3300025914 | Ga0207671_10021326 | Ga0207671_100213263 | 259 |
| 141 | 3300025921 | Ga0207652_10039300 | Ga0207652_100393004 | 259 |
| 142 | 3300025927 | Ga0207687_10272184 | Ga0207687_102721842 | 259 |
| 143 | 3300025940 | Ga0207691_10120168 | Ga0207691_101201683 | 259 |
| 144 | 3300025942 | Ga0207689_10000260 | Ga0207689_1000026023 | 259 |
| 145 | 3300025949 | Ga0207667_10020792 | Ga0207667_100207927 | 259 |
| 146 | 3300025961 | Ga0207712_10113728 | Ga0207712_101137282 | 259 |
| 147 | 3300025972 | Ga0207668_10026622 | Ga0207668_100266222 | 259 |
| 148 | 3300025986 | Ga0207658_10356346 | Ga0207658_103563461 | 259 |
| 149 | 3300026023 | Ga0207677_10237164 | Ga0207677_102371642 | 259 |
| 150 | 3300026035 | Ga0207703_10004860 | Ga0207703_1000486010 | 259 |
| 151 | 3300026041 | Ga0207639_10612097 | Ga0207639_106120972 | 259 |
| 152 | 3300026088 | Ga0207641_10000061 | Ga0207641_10000061136 | 259 |
| 153 | 3300026095 | Ga0207676_10666118 | Ga0207676_106661181 | 259 |
| 154 | 3300026142 | Ga0207698_10088805 | Ga0207698_100888052 | 259 |
| 155 | 3300027361 | Ga0209489_111689 | Ga0209489_1116892 | 259 |
| 156 | 3300027666 | Ga0209282_1209820 | Ga0209282_12098201 | 259 |
| 157 | 3300028381 | Ga0268264_10002707 | Ga0268264_100027079 | 259 |
| 158 | 3300028800 | Ga0265338_10263803 | Ga0265338_102638032 | 259 |
| 159 | 3300029957 | Ga0265324_10049365 | Ga0265324_100493651 | 259 |
| 160 | 3300031507 | Ga0307509_10095704 | Ga0307509_100957043 | 259 |
| 161 | 3300032002 | Ga0307416_100000066 | Ga0307416_10000006628 | 259 |
| 162 | 3300044901 | Ga0466960_0158363 | Ga0466960_0158363_336_1115 | 259 |
| 163 | 3300005288 | Ga0065714_10004250 | Ga0065714_100042504 | 260 |
| 164 | 3300005288 | Ga0065714_10139919 | Ga0065714_101399192 | 260 |
| 165 | 3300005289 | Ga0065704_10000226 | Ga0065704_1000022650 | 260 |
| 166 | 3300005289 | Ga0065704_10119969 | Ga0065704_101199692 | 260 |
| 167 | 3300005295 | Ga0065707_10090632 | Ga0065707_100906322 | 260 |
| 168 | 3300005328 | Ga0070676_10078696 | Ga0070676_100786962 | 260 |
| 169 | 3300005459 | Ga0068867_100298589 | Ga0068867_1002985891 | 260 |
| 170 | 3300006881 | Ga0068865_100627104 | Ga0068865_1006271041 | 260 |
| 171 | 3300009545 | Ga0105237_10001001 | Ga0105237_1000100113 | 260 |
| 172 | 3300009551 | Ga0105238_10011946 | Ga0105238_100119462 | 260 |
| 173 | 3300010375 | Ga0105239_10000004 | Ga0105239_10000004324 | 260 |
| 174 | 3300013100 | Ga0157373_10008374 | Ga0157373_100083742 | 260 |
| 175 | 3300013104 | Ga0157370_10283177 | Ga0157370_102831772 | 260 |
| 176 | 3300013104 | Ga0157370_10400819 | Ga0157370_104008192 | 260 |
| 177 | 3300013307 | Ga0157372_10006608 | Ga0157372_100066087 | 260 |
| 178 | 3300014497 | Ga0182008_10000020 | Ga0182008_10000020172 | 260 |
| 179 | 3300020077 | Ga0206351_10242821 | Ga0206351_102428212 | 260 |
| 180 | 3300025914 | Ga0207671_10000905 | Ga0207671_1000090511 | 260 |
| 181 | 3300025924 | Ga0207694_10071563 | Ga0207694_100715632 | 260 |
| 182 | 3300026089 | Ga0207648_10090916 | Ga0207648_100909162 | 260 |
| 183 | 3300026116 | Ga0207674_10062977 | Ga0207674_100629772 | 260 |
| 184 | 3300031251 | Ga0265327_10066454 | Ga0265327_100664542 | 260 |
| 185 | 3300031595 | Ga0265313_10044902 | Ga0265313_100449022 | 260 |
| 186 | 3300031911 | Ga0307412_10000001 | Ga0307412_10000001220 | 260 |
| 187 | 3300032004 | Ga0307414_10027173 | Ga0307414_100271732 | 260 |
| 188 | 3300042876 | Ga0451577_0180708 | Ga0451577_0180708_313_1095 | 260 |
| 189 | 3300042876 | Ga0451577_0189116 | Ga0451577_0189116_594_1376 | 260 |
| 190 | 3300049686 | Ga0501257_004825 | Ga0501257_004825_168_950 | 260 |
| 191 | 3300049688 | Ga0501259_000349 | Ga0501259_000349_1090_1872 | 260 |
| 192 | 3300049758 | Ga0501241_012847 | Ga0501241_012847_411_1193 | 260 |
| 193 | 3300053093 | Ga0500651_0000357 | Ga0500651_0000357_11896_12678 | 260 |
| 194 | 3300003323 | rootH1_10052755 | rootH1_100527552 | 261 |
| 195 | 3300026041 | Ga0207639_10313354 | Ga0207639_103133542 | 261 |
| 196 | 3300001989 | JGI24739J22299_10002789 | JGI24739J22299_100027893 | 262 |
| 197 | 3300001990 | JGI24737J22298_10003672 | JGI24737J22298_100036723 | 262 |
| 198 | 3300002067 | JGI24735J21928_10000324 | JGI24735J21928_100003247 | 262 |
| 199 | 3300002737 | JGI25162J39368_1004274 | JGI25162J39368_10042742 | 262 |
| 200 | 3300002772 | JGI25164J39214_1000814 | JGI25164J39214_10008145 | 262 |
| 201 | 3300003214 | JGI25165J46597_1000663 | JGI25165J46597_100066320 | 262 |
| 202 | 3300003316 | rootH1_10076361 | rootH1_100763614 | 262 |
| 203 | 3300003320 | rootH2_10094331 | rootH2_100943311 | 262 |
| 204 | 3300003323 | rootH1_10009528 | rootH1_1000952830 | 262 |
| 205 | 3300003323 | rootH1_10022931 | rootH1_1002293113 | 262 |
| 206 | 3300003323 | rootH1_10062224 | rootH1_100622244 | 262 |
| 207 | 3300003323 | rootH1_10105002 | rootH1_101050022 | 262 |
| 208 | 3300003781 | Ga0055536_1024067 | Ga0055536_10240672 | 262 |
| 209 | 3300004799 | Ga0058863_11101084 | Ga0058863_111010841 | 262 |
| 210 | 3300005262 | Ga0065165_1000501 | Ga0065165_100050112 | 262 |
| 211 | 3300005288 | Ga0065714_10009525 | Ga0065714_100095251 | 262 |
| 212 | 3300005288 | Ga0065714_10013800 | Ga0065714_100138002 | 262 |
| 213 | 3300005288 | Ga0065714_10079471 | Ga0065714_100794713 | 262 |
| 214 | 3300005327 | Ga0070658_10129286 | Ga0070658_101292862 | 262 |
| 215 | 3300005329 | Ga0070683_100017779 | Ga0070683_1000177792 | 262 |
| 216 | 3300005331 | Ga0070670_100078328 | Ga0070670_1000783282 | 262 |
| 217 | 3300005331 | Ga0070670_100244878 | Ga0070670_1002448782 | 262 |
| 218 | 3300005334 | Ga0068869_100177995 | Ga0068869_1001779952 | 262 |
| 219 | 3300005336 | Ga0070680_100031279 | Ga0070680_1000312793 | 262 |
| 220 | 3300005337 | Ga0070682_100000482 | Ga0070682_10000048210 | 262 |
| 221 | 3300005338 | Ga0068868_100131455 | Ga0068868_1001314552 | 262 |
| 222 | 3300005347 | Ga0070668_100002219 | Ga0070668_1000022197 | 262 |
| 223 | 3300005353 | Ga0070669_100001299 | Ga0070669_10000129913 | 262 |
| 224 | 3300005354 | Ga0070675_100004217 | Ga0070675_1000042178 | 262 |
| 225 | 3300005365 | Ga0070688_100028086 | Ga0070688_1000280862 | 262 |
| 226 | 3300005441 | Ga0070700_100125275 | Ga0070700_1001252752 | 262 |
| 227 | 3300005457 | Ga0070662_100012820 | Ga0070662_1000128202 | 262 |
| 228 | 3300005471 | Ga0070698_100336679 | Ga0070698_1003366792 | 262 |
| 229 | 3300005530 | Ga0070679_100000549 | Ga0070679_1000005499 | 262 |
| 230 | 3300005530 | Ga0070679_100024113 | Ga0070679_1000241137 | 262 |
| 231 | 3300005530 | Ga0070679_100624425 | Ga0070679_1006244252 | 262 |
| 232 | 3300005535 | Ga0070684_100019229 | Ga0070684_1000192291 | 262 |
| 233 | 3300005539 | Ga0068853_100079978 | Ga0068853_1000799782 | 262 |
| 234 | 3300005539 | Ga0068853_100181435 | Ga0068853_1001814352 | 262 |
| 235 | 3300005563 | Ga0068855_100000019 | Ga0068855_100000019106 | 262 |
| 236 | 3300005563 | Ga0068855_100000388 | Ga0068855_10000038835 | 262 |
| 237 | 3300005563 | Ga0068855_100013264 | Ga0068855_10001326411 | 262 |
| 238 | 3300005563 | Ga0068855_100025873 | Ga0068855_1000258737 | 262 |
| 239 | 3300005563 | Ga0068855_100030245 | Ga0068855_1000302454 | 262 |
| 240 | 3300005563 | Ga0068855_100444116 | Ga0068855_1004441162 | 262 |
| 241 | 3300005578 | Ga0068854_100008761 | Ga0068854_1000087613 | 262 |
| 242 | 3300005578 | Ga0068854_100623402 | Ga0068854_1006234021 | 262 |
| 243 | 3300005614 | Ga0068856_100001034 | Ga0068856_10000103410 | 262 |
| 244 | 3300005616 | Ga0068852_100025858 | Ga0068852_1000258583 | 262 |
| 245 | 3300005616 | Ga0068852_100112751 | Ga0068852_1001127512 | 262 |
| 246 | 3300005617 | Ga0068859_100039542 | Ga0068859_1000395422 | 262 |
| 247 | 3300005840 | Ga0068870_10006552 | Ga0068870_100065525 | 262 |
| 248 | 3300006195 | Ga0075366_10002704 | Ga0075366_100027045 | 262 |
| 249 | 3300006195 | Ga0075366_10015888 | Ga0075366_100158885 | 262 |
| 250 | 3300006195 | Ga0075366_10077832 | Ga0075366_100778322 | 262 |
| 251 | 3300006931 | Ga0097620_100039542 | Ga0097620_1000395422 | 262 |
| 252 | 3300009093 | Ga0105240_10002660 | Ga0105240_1000266013 | 262 |
| 253 | 3300009093 | Ga0105240_10063765 | Ga0105240_100637652 | 262 |
| 254 | 3300009093 | Ga0105240_10078201 | Ga0105240_100782013 | 262 |
| 255 | 3300009093 | Ga0105240_10172669 | Ga0105240_101726692 | 262 |
| 256 | 3300009094 | Ga0111539_10004188 | Ga0111539_100041884 | 262 |
| 257 | 3300009174 | Ga0105241_10000668 | Ga0105241_100006687 | 262 |
| 258 | 3300009545 | Ga0105237_10002720 | Ga0105237_1000272010 | 262 |
| 259 | 3300009545 | Ga0105237_10011718 | Ga0105237_100117183 | 262 |
| 260 | 3300009545 | Ga0105237_10042255 | Ga0105237_100422553 | 262 |
| 261 | 3300009545 | Ga0105237_10144217 | Ga0105237_101442174 | 262 |
| 262 | 3300009545 | Ga0105237_10202771 | Ga0105237_102027711 | 262 |
| 263 | 3300009545 | Ga0105237_10202778 | Ga0105237_102027781 | 262 |
| 264 | 3300009551 | Ga0105238_10111589 | Ga0105238_101115892 | 262 |
| 265 | 3300010375 | Ga0105239_10000012 | Ga0105239_10000012199 | 262 |
| 266 | 3300010375 | Ga0105239_10000299 | Ga0105239_1000029953 | 262 |
| 267 | 3300010375 | Ga0105239_10000976 | Ga0105239_1000097610 | 262 |
| 268 | 3300010375 | Ga0105239_10002652 | Ga0105239_1000265213 | 262 |
| 269 | 3300010375 | Ga0105239_10141943 | Ga0105239_101419432 | 262 |
| 270 | 3300013100 | Ga0157373_10000327 | Ga0157373_1000032712 | 262 |
| 271 | 3300013102 | Ga0157371_10023206 | Ga0157371_100232062 | 262 |
| 272 | 3300013104 | Ga0157370_10000831 | Ga0157370_1000083113 | 262 |
| 273 | 3300013104 | Ga0157370_10085136 | Ga0157370_100851362 | 262 |
| 274 | 3300013105 | Ga0157369_10060549 | Ga0157369_100605493 | 262 |
| 275 | 3300013297 | Ga0157378_10017968 | Ga0157378_100179685 | 262 |
| 276 | 3300013306 | Ga0163162_10033338 | Ga0163162_100333383 | 262 |
| 277 | 3300013307 | Ga0157372_10000980 | Ga0157372_1000098015 | 262 |
| 278 | 3300013307 | Ga0157372_10006396 | Ga0157372_1000639610 | 262 |
| 279 | 3300013307 | Ga0157372_10314118 | Ga0157372_103141182 | 262 |
| 280 | 3300013308 | Ga0157375_10021906 | Ga0157375_100219063 | 262 |
| 281 | 3300014326 | Ga0157380_10010487 | Ga0157380_100104879 | 262 |
| 282 | 3300014326 | Ga0157380_10162573 | Ga0157380_101625732 | 262 |
| 283 | 3300014326 | Ga0157380_10308635 | Ga0157380_103086351 | 262 |
| 284 | 3300014745 | Ga0157377_10001601 | Ga0157377_100016018 | 262 |
| 285 | 3300017792 | Ga0163161_10029273 | Ga0163161_100292733 | 262 |
| 286 | 3300025231 | Ga0207427_100085 | Ga0207427_100085119 | 262 |
| 287 | 3300025233 | Ga0209437_100052 | Ga0209437_100052126 | 262 |
| 288 | 3300025233 | Ga0209437_100102 | Ga0209437_100102195 | 262 |
| 289 | 3300025261 | Ga0209233_1000067 | Ga0209233_1000067126 | 262 |
| 290 | 3300025261 | Ga0209233_1009381 | Ga0209233_10093811 | 262 |
| 291 | 3300025272 | Ga0209455_1006064 | Ga0209455_10060643 | 262 |
| 292 | 3300025292 | Ga0209676_1001044 | Ga0209676_100104423 | 262 |
| 293 | 3300025907 | Ga0207645_10008474 | Ga0207645_100084744 | 262 |
| 294 | 3300025908 | Ga0207643_10042525 | Ga0207643_100425254 | 262 |
| 295 | 3300025911 | Ga0207654_10000168 | Ga0207654_1000016810 | 262 |
| 296 | 3300025912 | Ga0207707_10000117 | Ga0207707_1000011742 | 262 |
| 297 | 3300025912 | Ga0207707_10088851 | Ga0207707_100888512 | 262 |
| 298 | 3300025913 | Ga0207695_10057507 | Ga0207695_100575074 | 262 |
| 299 | 3300025913 | Ga0207695_10371886 | Ga0207695_103718862 | 262 |
| 300 | 3300025914 | Ga0207671_10014324 | Ga0207671_100143243 | 262 |
| 301 | 3300025914 | Ga0207671_10021367 | Ga0207671_100213674 | 262 |
| 302 | 3300025914 | Ga0207671_10058087 | Ga0207671_100580872 | 262 |
| 303 | 3300025917 | Ga0207660_10001028 | Ga0207660_100010289 | 262 |
| 304 | 3300025917 | Ga0207660_10032486 | Ga0207660_100324862 | 262 |
| 305 | 3300025921 | Ga0207652_10000280 | Ga0207652_1000028030 | 262 |
| 306 | 3300025921 | Ga0207652_10016686 | Ga0207652_100166867 | 262 |
| 307 | 3300025924 | Ga0207694_10152248 | Ga0207694_101522482 | 262 |
| 308 | 3300025925 | Ga0207650_10045949 | Ga0207650_100459492 | 262 |
| 309 | 3300025925 | Ga0207650_10183335 | Ga0207650_101833352 | 262 |
| 310 | 3300025926 | Ga0207659_10032248 | Ga0207659_100322482 | 262 |
| 311 | 3300025937 | Ga0207669_10314522 | Ga0207669_103145222 | 262 |
| 312 | 3300025940 | Ga0207691_10402117 | Ga0207691_104021171 | 262 |
| 313 | 3300025942 | Ga0207689_10018593 | Ga0207689_100185936 | 262 |
| 314 | 3300025944 | Ga0207661_10014978 | Ga0207661_100149782 | 262 |
| 315 | 3300025949 | Ga0207667_10000020 | Ga0207667_1000002063 | 262 |
| 316 | 3300025949 | Ga0207667_10008655 | Ga0207667_100086557 | 262 |
| 317 | 3300025949 | Ga0207667_10028694 | Ga0207667_100286943 | 262 |
| 318 | 3300025949 | Ga0207667_10372558 | Ga0207667_103725582 | 262 |
| 319 | 3300025949 | Ga0207667_10423498 | Ga0207667_104234982 | 262 |
| 320 | 3300025981 | Ga0207640_10005930 | Ga0207640_100059305 | 262 |
| 321 | 3300026023 | Ga0207677_10156040 | Ga0207677_101560402 | 262 |
| 322 | 3300026075 | Ga0207708_10180962 | Ga0207708_101809622 | 262 |
| 323 | 3300026078 | Ga0207702_10000161 | Ga0207702_1000016144 | 262 |
| 324 | 3300026116 | Ga0207674_10083394 | Ga0207674_100833944 | 262 |
| 325 | 3300026118 | Ga0207675_100000468 | Ga0207675_10000046838 | 262 |
| 326 | 3300026142 | Ga0207698_10041111 | Ga0207698_100411113 | 262 |
| 327 | 3300028794 | Ga0307515_10000002 | Ga0307515_10000002709 | 262 |
| 328 | 3300028794 | Ga0307515_10000007 | Ga0307515_10000007632 | 262 |
| 329 | 3300028794 | Ga0307515_10000667 | Ga0307515_1000066728 | 262 |
| 330 | 3300028794 | Ga0307515_10001029 | Ga0307515_1000102915 | 262 |
| 331 | 3300028794 | Ga0307515_10081240 | Ga0307515_100812404 | 262 |
| 332 | 3300028800 | Ga0265338_10241376 | Ga0265338_102413762 | 262 |
| 333 | 3300031251 | Ga0265327_10000488 | Ga0265327_100004884 | 262 |
| 334 | 3300031251 | Ga0265327_10069666 | Ga0265327_100696662 | 262 |
| 335 | 3300031251 | Ga0265327_10112238 | Ga0265327_101122382 | 262 |
| 336 | 3300031649 | Ga0307514_10026210 | Ga0307514_100262102 | 262 |
| 337 | 3300031911 | Ga0307412_10678387 | Ga0307412_106783871 | 262 |
| 338 | 3300032004 | Ga0307414_10003898 | Ga0307414_100038989 | 262 |
| 339 | 3300032004 | Ga0307414_10141516 | Ga0307414_101415162 | 262 |
| 340 | 3300032004 | Ga0307414_10176763 | Ga0307414_101767632 | 262 |
| 341 | 3300032004 | Ga0307414_10181315 | Ga0307414_101813152 | 262 |
| 342 | 3300035410 | Ga0373924_0035378 | Ga0373924_0035378_431_1219 | 262 |
| 343 | 3300035692 | Ga0373935_0185703 | Ga0373935_0185703_373_1161 | 262 |
| 344 | 3300037312 | Ga0395899_0000001 | Ga0395899_0000001_1292521_1293312 | 262 |
| 345 | 3300039437 | Ga0436365_1478753 | Ga0436365_1478753_892_1680 | 262 |
| 346 | 3300041486 | Ga0451807_0262958 | Ga0451807_0262958_60_848 | 262 |
| 347 | 3300042004 | Ga0439445_0010836 | Ga0439445_0010836_387_1175 | 262 |
| 348 | 3300042004 | Ga0439445_0049394 | Ga0439445_0049394_94_882 | 262 |
| 349 | 3300042007 | Ga0439449_0014799 | Ga0439449_0014799_1772_2560 | 262 |
| 350 | 3300042134 | Ga0450898_003719 | Ga0450898_003719_656_1444 | 262 |
| 351 | 3300044693 | Ga0466961_0009336 | Ga0466961_0009336_5116_5904 | 262 |
| 352 | 3300044765 | Ga0466970_0044673 | Ga0466970_0044673_450_1238 | 262 |
| 353 | 3300045049 | Ga0466959_0011130 | Ga0466959_0011130_3177_3965 | 262 |
| 354 | 3300045836 | Ga0466958_0044661 | Ga0466958_0044661_511_1299 | 262 |
| 355 | 3300046462 | Ga0495651_0176374 | Ga0495651_0176374_316_1104 | 262 |
| 356 | 3300046471 | Ga0495650_0002914 | Ga0495650_0002914_4296_5084 | 262 |
| 357 | 3300046492 | Ga0495585_0000091 | Ga0495585_0000091_3468_4256 | 262 |
| 358 | 3300046507 | Ga0495606_0003447 | Ga0495606_0003447_8167_8955 | 262 |
| 359 | 3300046507 | Ga0495606_0005837 | Ga0495606_0005837_4234_5022 | 262 |
| 360 | 3300046512 | Ga0495610_0000959 | Ga0495610_0000959_21692_22480 | 262 |
| 361 | 3300046513 | Ga0495616_0003738 | Ga0495616_0003738_2060_2848 | 262 |
| 362 | 3300046513 | Ga0495616_0004186 | Ga0495616_0004186_6660_7448 | 262 |
| 363 | 3300046519 | Ga0495632_0096051 | Ga0495632_0096051_460_1248 | 262 |
| 364 | 3300046520 | Ga0495637_0076706 | Ga0495637_0076706_37_825 | 262 |
| 365 | 3300046524 | Ga0495648_0099288 | Ga0495648_0099288_199_987 | 262 |
| 366 | 3300046529 | Ga0495652_0338857 | Ga0495652_0338857_70_858 | 262 |
| 367 | 3300046558 | Ga0495633_0000006 | Ga0495633_0000006_311819_312607 | 262 |
| 368 | 3300046558 | Ga0495633_0004900 | Ga0495633_0004900_2995_3783 | 262 |
| 369 | 3300046616 | Ga0495668_0154775 | Ga0495668_0154775_211_999 | 262 |
| 370 | 3300046660 | Ga0495625_0000059 | Ga0495625_0000059_7926_8714 | 262 |
| 371 | 3300046660 | Ga0495625_0002083 | Ga0495625_0002083_5575_6363 | 262 |
| 372 | 3300046660 | Ga0495625_0036200 | Ga0495625_0036200_2386_3174 | 262 |
| 373 | 3300046660 | Ga0495625_0066387 | Ga0495625_0066387_419_1207 | 262 |
| 374 | 3300046660 | Ga0495625_0086825 | Ga0495625_0086825_196_984 | 262 |
| 375 | 3300046660 | Ga0495625_0184100 | Ga0495625_0184100_221_1009 | 262 |
| 376 | 3300046663 | Ga0495635_0049691 | Ga0495635_0049691_334_1122 | 262 |
| 377 | 3300046675 | Ga0495657_0191170 | Ga0495657_0191170_407_1195 | 262 |
| 378 | 3300046683 | Ga0495658_0002979 | Ga0495658_0002979_5453_6241 | 262 |
| 379 | 3300046692 | Ga0495671_0144986 | Ga0495671_0144986_334_1122 | 262 |
| 380 | 3300046694 | Ga0495649_0001008 | Ga0495649_0001008_13431_14219 | 262 |
| 381 | 3300046794 | Ga0495589_0142276 | Ga0495589_0142276_59_847 | 262 |
| 382 | 3300046810 | Ga0495660_0020260 | Ga0495660_0020260_1929_2717 | 262 |
| 383 | 3300047321 | Ga0495676_0151436 | Ga0495676_0151436_296_1084 | 262 |
| 384 | 3300047443 | Ga0495687_003426 | Ga0495687_003426_7246_8034 | 262 |
| 385 | 3300047471 | Ga0495684_0070218 | Ga0495684_0070218_1228_2016 | 262 |
| 386 | 3300047472 | Ga0495686_0001059 | Ga0495686_0001059_25057_25845 | 262 |
| 387 | 3300047472 | Ga0495686_0026024 | Ga0495686_0026024_1116_1904 | 262 |
| 388 | 3300047472 | Ga0495686_0140579 | Ga0495686_0140579_258_1046 | 262 |
| 389 | 3300047472 | Ga0495686_0206370 | Ga0495686_0206370_219_1007 | 262 |
| 390 | 3300048089 | Ga0495614_0019603 | Ga0495614_0019603_827_1615 | 262 |
| 391 | 3300048917 | Ga0496114_0478018 | Ga0496114_0478018_39_827 | 262 |
| 392 | 3300048918 | Ga0496115_0090369 | Ga0496115_0090369_1124_1912 | 262 |
| 393 | 3300049459 | Ga0495678_003800 | Ga0495678_003800_6982_7770 | 262 |
| 394 | 3300049513 | Ga0501290_007613 | Ga0501290_007613_281_1069 | 262 |
| 395 | 3300049519 | Ga0501296_008386 | Ga0501296_008386_231_1019 | 262 |
| 396 | 3300049521 | Ga0501298_000487 | Ga0501298_000487_4385_5173 | 262 |
| 397 | 3300049523 | Ga0501300_017145 | Ga0501300_017145_169_957 | 262 |
| 398 | 3300049649 | Ga0501198_000671 | Ga0501198_000671_1344_2132 | 262 |
| 399 | 3300049651 | Ga0501201_000292 | Ga0501201_000292_3465_4253 | 262 |
| 400 | 3300049652 | Ga0501202_000022 | Ga0501202_000022_101_889 | 262 |
| 401 | 3300049653 | Ga0501206_004994 | Ga0501206_004994_697_1485 | 262 |
| 402 | 3300049654 | Ga0501207_004358 | Ga0501207_004358_871_1659 | 262 |
| 403 | 3300049661 | Ga0501217_001283 | Ga0501217_001283_1215_2003 | 262 |
| 404 | 3300049662 | Ga0501222_005096 | Ga0501222_005096_242_1030 | 262 |
| 405 | 3300049663 | Ga0501223_008431 | Ga0501223_008431_1020_1808 | 262 |
| 406 | 3300049664 | Ga0501224_018034 | Ga0501224_018034_163_951 | 262 |
| 407 | 3300049668 | Ga0501233_020250 | Ga0501233_020250_153_941 | 262 |
| 408 | 3300049669 | Ga0501235_003884 | Ga0501235_003884_380_1168 | 262 |
| 409 | 3300049673 | Ga0501240_001027 | Ga0501240_001027_685_1473 | 262 |
| 410 | 3300049675 | Ga0501243_004826 | Ga0501243_004826_561_1349 | 262 |
| 411 | 3300049681 | Ga0501251_015843 | Ga0501251_015843_63_851 | 262 |
| 412 | 3300049682 | Ga0501252_019175 | Ga0501252_019175_54_842 | 262 |
| 413 | 3300049683 | Ga0501253_005186 | Ga0501253_005186_740_1528 | 262 |
| 414 | 3300049686 | Ga0501257_003705 | Ga0501257_003705_2039_2827 | 262 |
| 415 | 3300049688 | Ga0501259_002575 | Ga0501259_002575_942_1730 | 262 |
| 416 | 3300049688 | Ga0501259_027308 | Ga0501259_027308_162_950 | 262 |
| 417 | 3300049690 | Ga0501261_000251 | Ga0501261_000251_340_1128 | 262 |
| 418 | 3300049704 | Ga0501221_008138 | Ga0501221_008138_239_1027 | 262 |
| 419 | 3300049705 | Ga0501225_0012343 | Ga0501225_0012343_82_870 | 262 |
| 420 | 3300049707 | Ga0501234_000168 | Ga0501234_000168_3265_4053 | 262 |
| 421 | 3300049708 | Ga0501245_001736 | Ga0501245_001736_155_943 | 262 |
| 422 | 3300049757 | Ga0501232_001540 | Ga0501232_001540_873_1661 | 262 |
| 423 | 3300049765 | Ga0501268_024277 | Ga0501268_024277_95_883 | 262 |
| 424 | 3300049775 | Ga0501279_008877 | Ga0501279_008877_446_1234 | 262 |
| 425 | 3300049776 | Ga0501280_008061 | Ga0501280_008061_556_1344 | 262 |
| 426 | 3300049851 | Ga0501212_005826 | Ga0501212_005826_519_1307 | 262 |
| 427 | 3300050493 | nmdc:mga0k408_105645_c1 | nmdc:mga0k408_105645_c1_599_1387 | 262 |
| 428 | 3300050493 | nmdc:mga0k408_9670_c1 | nmdc:mga0k408_9670_c1_4195_4983 | 262 |
| 429 | 3300053104 | Ga0500556_0016763 | Ga0500556_0016763_363_1151 | 262 |
| 430 | 3300053125 | Ga0500618_000010 | Ga0500618_000010_10229_11017 | 262 |
| 431 | 3300053153 | Ga0500616_0000853 | Ga0500616_0000853_21585_22373 | 262 |
| 432 | 3300053153 | Ga0500616_0142589 | Ga0500616_0142589_262_1050 | 262 |
| 433 | 3300053156 | Ga0500622_0000417 | Ga0500622_0000417_35627_36415 | 262 |
| 434 | 3300053727 | Ga0500611_000008 | Ga0500611_000008_189541_190329 | 262 |
| 435 | 3300061719 | Ga0466962_0038765 | Ga0466962_0038765_1377_2165 | 262 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6h0m-assembly1.cif.gz_A | 17beta-hydroxysteroid dehydrogenase type 14 mutant k158a in complex with nicotinamide adenine dinucleotide | 0.9617 | 5 | 251 |
| 2d1y-assembly1.cif.gz_C | crystal structure of tt0321 from thermus thermophilus hb8 | 0.9611 | 5 | 251 |
| 2d1y-assembly1.cif.gz_A | crystal structure of tt0321 from thermus thermophilus hb8 | 0.9592 | 5 | 251 |
| 2d1y-assembly1.cif.gz_D | crystal structure of tt0321 from thermus thermophilus hb8 | 0.9586 | 5 | 251 |
| 3ai3-assembly1.cif.gz_G | the crystal structure of l-sorbose reductase from gluconobacter frateurii complexed with nadph and l-sorbose | 0.958 | 1 | 251 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2d1yC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9611 | 5 | 251 | 3.40.50.720 |
| af_A0A0P0Y501_3_211_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9596 | 5 | 196 | 3.40.50.720 |
| 3ai1A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9565 | 1 | 251 | 3.40.50.720 |
| af_A0A0N7KIR0_69_250_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9541 | 5 | 163 | 3.40.50.720 |
| af_Q6PKH6_18_219_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9521 | 2 | 185 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1TIR6-F1-model_v4 | Short chain dehydrogenase | 0.9927 | 1 | 232 |
|
| AF-A0A2V7WVV5-F1-model_v4 | Short chain dehydrogenase | 0.9919 | 1 | 224 |
GO:0016491
|
| AF-A0A2W0ARM4-F1-model_v4 | Short chain dehydrogenase | 0.9889 | 1 | 248 |
GO:0016020
|
| AF-A0A3C1TIR6-F1-model_v4 | Short chain dehydrogenase | 0.9842 | 1 | 232 |
|
| AF-A0A2N2PXS5-F1-model_v4 | Short-chain dehydrogenase | 0.9799 | 4 | 250 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar