F443172

General Info

Members Datasets Scaffolds Average Seq Length
434 268 868 125

Family's Representative Sequence

Representative Sequence 3300048088|Ga0495602_0042794|Ga0495602_0042794_2969_3421
Length 150
Sequence MANPGFHNATVGYAEGSVSTQSEKGDDMGQPVVHFEVIGKDGEKLQSYYAELFDWKVDAGNEMGYGLVDREANSNADGIGLGGGIGQSPEGYGGHVTFYVEVPSVEEALSRAESLGGTRVMGPETIMGRMVLGQFTDPEGNVIGLIEGGS

Samples

Sample ID Description Type Environment
1 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
157 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
158 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
159 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
160 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
161 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
162 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
168 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
179 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
180 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
181 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
184 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
185 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
202 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
205 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
209 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
210 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
215 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
216 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
219 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
220 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
233 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
252 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
255 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
256 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
266 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.61
Nodule 0
Rhizoplane 14.75
Rhizosphere 82.49
Stem 0
Stem Tuber 0
Unclassified 11.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495602_0042794 3300048088 Bacteria 4123
2 JGI24747J21853_1022969 3300001978 Unclassified 687
3 JGI25405J52794_10058350 3300003911 Bacteria 833
4 Ga0070683_100896255 3300005329 Bacteria 851
5 Ga0070683_102078660 3300005329 Bacteria 546
6 Ga0070690_100197552 3300005330 Bacteria 1398
7 Ga0070690_100599783 3300005330 Bacteria 836
8 Ga0070670_100705947 3300005331 Bacteria 907
9 Ga0070680_100599173 3300005336 Unclassified 946
10 Ga0070682_100017237 3300005337 Bacteria 4209
11 Ga0070682_100159117 3300005337 Bacteria 1558
12 Ga0068868_100000008 3300005338 Bacteria 121926
13 Ga0070660_100321726 3300005339 Bacteria 1271
14 Ga0070689_100395104 3300005340 Bacteria 1168
15 Ga0070691_10058984 3300005341 Bacteria 1843
16 Ga0070691_10067558 3300005341 Bacteria 1729
17 Ga0070691_10350427 3300005341 Unclassified 820
18 Ga0070661_101148278 3300005344 Bacteria 648
19 Ga0070692_10042483 3300005345 Bacteria 2334
20 Ga0070668_100084454 3300005347 Bacteria 2494
21 Ga0070668_100123991 3300005347 Bacteria 2068
22 Ga0070671_101168493 3300005355 Bacteria 677
23 Ga0070674_100025098 3300005356 Bacteria 3876
24 Ga0070674_100037319 3300005356 Bacteria 3268
25 Ga0070673_100050446 3300005364 Bacteria 3254
26 Ga0070673_101076016 3300005364 Bacteria 751
27 Ga0070659_100017159 3300005366 Bacteria 5442
28 Ga0070659_100079660 3300005366 Bacteria 2614
29 Ga0070709_10105840 3300005434 Bacteria 1882
30 Ga0070709_10693860 3300005434 Bacteria 791
31 Ga0070709_10856849 3300005434 Bacteria 716
32 Ga0070714_100022572 3300005435 Bacteria 5160
33 Ga0070714_102247184 3300005435 Bacteria 531
34 Ga0070713_100140569 3300005436 Bacteria 2138
35 Ga0070713_100170069 3300005436 Bacteria 1952
36 Ga0070710_10077459 3300005437 Bacteria 1932
37 Ga0070710_10153449 3300005437 Unclassified 1422
38 Ga0070710_10197760 3300005437 Bacteria 1267
39 Ga0070710_10369442 3300005437 Unclassified 954
40 Ga0070701_10259298 3300005438 Bacteria 1053
41 Ga0070701_10268761 3300005438 Bacteria 1036
42 Ga0070711_100330904 3300005439 Bacteria 1219
43 Ga0070705_100015067 3300005440 Bacteria 3989
44 Ga0070705_100166105 3300005440 Bacteria 1480
45 Ga0070705_100423286 3300005440 Bacteria 992
46 Ga0070705_101130907 3300005440 Bacteria 642
47 Ga0070700_100290318 3300005441 Unclassified 1189
48 Ga0070708_100087938 3300005445 Bacteria 2824
49 Ga0070708_100836773 3300005445 Bacteria 865
50 Ga0070663_100257600 3300005455 Bacteria 1383
51 Ga0070678_100031124 3300005456 Bacteria 3676
52 Ga0070678_100083700 3300005456 Bacteria 2426
53 Ga0070678_100127808 3300005456 Bacteria 2014
54 Ga0070662_100085461 3300005457 Bacteria 2358
55 Ga0070681_10019928 3300005458 Bacteria 6719
56 Ga0070681_10548336 3300005458 Bacteria 1070
57 Ga0068867_100061182 3300005459 Bacteria 2795
58 Ga0068867_100877632 3300005459 Bacteria 805
59 Ga0070706_100048871 3300005467 Bacteria 3904
60 Ga0070698_100610269 3300005471 Bacteria 1031
61 Ga0070699_100039479 3300005518 Bacteria 4087
62 Ga0070679_100065195 3300005530 Bacteria 3630
63 Ga0070679_100164044 3300005530 Bacteria 2196
64 Ga0070684_100223795 3300005535 Bacteria 1717
65 Ga0070684_101327809 3300005535 Bacteria 677
66 Ga0070684_101742921 3300005535 Bacteria 588
67 Ga0068853_100200561 3300005539 Bacteria 1815
68 Ga0070695_100043429 3300005545 Bacteria 2858
69 Ga0070695_101035710 3300005545 Unclassified 669
70 Ga0070696_100045249 3300005546 Bacteria 3049
71 Ga0070696_100374199 3300005546 Bacteria 1108
72 Ga0070693_100016952 3300005547 Bacteria 3778
73 Ga0070693_100080569 3300005547 Bacteria 1940
74 Ga0070693_100249379 3300005547 Bacteria 1176
75 Ga0070665_100990091 3300005548 Bacteria 853
76 Ga0070665_101519918 3300005548 Bacteria 678
77 Ga0070704_100228548 3300005549 Bacteria 1516
78 Ga0068855_100093741 3300005563 Bacteria 3462
79 Ga0068857_100413317 3300005577 Bacteria 1257
80 Ga0068854_100050431 3300005578 Bacteria 2978
81 Ga0068856_100039808 3300005614 Bacteria 4615
82 Ga0068856_100346421 3300005614 Bacteria 1504
83 Ga0068856_100481650 3300005614 Bacteria 1262
84 Ga0068856_101215792 3300005614 Bacteria 770
85 Ga0070702_100109672 3300005615 Bacteria 1709
86 Ga0070702_101446083 3300005615 Bacteria 563
87 Ga0070702_101456345 3300005615 Bacteria 562
88 Ga0068852_100280701 3300005616 Unclassified 1605
89 Ga0068864_100519000 3300005618 Bacteria 1148
90 Ga0068866_10085591 3300005718 Bacteria 1704
91 Ga0068861_100156607 3300005719 Bacteria 1875
92 Ga0068861_100375734 3300005719 Bacteria 1254
93 Ga0081455_10002444 3300005937 Bacteria 22139
94 Ga0081455_10094874 3300005937 Bacteria 2409
95 Ga0081455_10208448 3300005937 Bacteria 1458
96 Ga0081540_1005740 3300005983 Bacteria 9200
97 Ga0081540_1006073 3300005983 Bacteria 8878
98 Ga0070717_10065445 3300006028 Bacteria 3022
99 Ga0075365_10027490 3300006038 Bacteria 3621
100 Ga0075364_10050380 3300006051 Bacteria 2718
101 Ga0075432_10027773 3300006058 Bacteria 1949
102 Ga0070715_10013812 3300006163 Bacteria 2975
103 Ga0070716_100730635 3300006173 Bacteria 759
104 Ga0070712_100029296 3300006175 Bacteria 3689
105 Ga0075367_10349056 3300006178 Bacteria 934
106 Ga0097621_100017415 3300006237 Bacteria 5455
107 Ga0068871_100175085 3300006358 Bacteria 1841
108 Ga0075428_100343113 3300006844 Bacteria 1603
109 Ga0075431_100943116 3300006847 Bacteria 831
110 Ga0075433_10000047 3300006852 Bacteria 50752
111 Ga0075433_10502159 3300006852 Bacteria 1067
112 Ga0075433_10747606 3300006852 Bacteria 855
113 Ga0075434_100808705 3300006871 Bacteria 953
114 Ga0068865_100096074 3300006881 Bacteria 2160
115 Ga0068865_100146332 3300006881 Unclassified 1787
116 Ga0068865_101877408 3300006881 Bacteria 542
117 Ga0075436_100002978 3300006914 Bacteria 11589
118 Ga0075435_100075041 3300007076 Bacteria 2768
119 Ga0075435_100635170 3300007076 Bacteria 926
120 Ga0105250_10286181 3300009092 Unclassified 710
121 Ga0105245_10203389 3300009098 Bacteria 1903
122 Ga0105245_10220765 3300009098 Bacteria 1829
123 Ga0105245_10872339 3300009098 Bacteria 941
124 Ga0105247_10000516 3300009101 Bacteria 31677
125 Ga0114129_10114316 3300009147 Bacteria 3721
126 Ga0105243_10121572 3300009148 Unclassified 2202
127 Ga0105243_10435794 3300009148 Bacteria 1226
128 Ga0105241_10051814 3300009174 Bacteria 3131
129 Ga0105241_10264634 3300009174 Bacteria 1462
130 Ga0105248_11396977 3300009177 Unclassified 792
131 Ga0105237_10778258 3300009545 Bacteria 964
132 Ga0105249_10062959 3300009553 Bacteria 3406
133 Ga0105239_10367697 3300010375 Bacteria 1625
134 Ga0105239_10538821 3300010375 Unclassified 1329
135 Ga0105239_10626821 3300010375 Unclassified 1227
136 Ga0105239_12132806 3300010375 Unclassified 651
137 Ga0105246_10697622 3300011119 Bacteria 889
138 Ga0105246_11510038 3300011119 Bacteria 631
139 Ga0157316_1001777 3300012510 Bacteria 1390
140 Ga0157371_10167629 3300013102 Bacteria 1569
141 Ga0157378_10070901 3300013297 Bacteria 3129
142 Ga0157378_11060476 3300013297 Unclassified 846
143 Ga0157378_11109106 3300013297 Unclassified 828
144 Ga0163162_10249006 3300013306 Bacteria 1909
145 Ga0163162_11340522 3300013306 Bacteria 813
146 Ga0157372_10050308 3300013307 Bacteria 4636
147 Ga0157375_10008980 3300013308 Bacteria 8747
148 Ga0157375_10195010 3300013308 Unclassified 2180
149 Ga0157375_10612812 3300013308 Bacteria 1247
150 Ga0157375_13130628 3300013308 Bacteria 552
151 Ga0163163_10085658 3300014325 Bacteria 3159
152 Ga0157380_10009946 3300014326 Bacteria 6825
153 Ga0157380_10030397 3300014326 Bacteria 4136
154 Ga0157377_10403279 3300014745 Unclassified 932
155 Ga0157376_10030574 3300014969 Bacteria 4301
156 Ga0157376_11104288 3300014969 Unclassified 819
157 Ga0182005_1274313 3300015265 Unclassified 528
158 Ga0163161_10000018 3300017792 Bacteria 228801
159 Ga0163161_10139343 3300017792 Bacteria 1836
160 Ga0206354_11111355 3300020081 Bacteria 603
161 Ga0207653_10022624 3300025885 Unclassified 1998
162 Ga0207692_10193165 3300025898 Bacteria 1193
163 Ga0207692_10222891 3300025898 Bacteria 1119
164 Ga0207692_10269555 3300025898 Unclassified 1026
165 Ga0207642_10149691 3300025899 Unclassified 1241
166 Ga0207710_10000276 3300025900 Bacteria 41913
167 Ga0207680_10193556 3300025903 Bacteria 1382
168 Ga0207685_10422425 3300025905 Bacteria 688
169 Ga0207699_10206706 3300025906 Bacteria 1333
170 Ga0207645_10108254 3300025907 Bacteria 1798
171 Ga0207684_10028474 3300025910 Bacteria 4760
172 Ga0207654_10075309 3300025911 Bacteria 2017
173 Ga0207695_11083990 3300025913 Bacteria 681
174 Ga0207693_10013159 3300025915 Bacteria 6675
175 Ga0207693_10014565 3300025915 Bacteria 6319
176 Ga0207663_10125751 3300025916 Bacteria 1763
177 Ga0207663_10129860 3300025916 Bacteria 1739
178 Ga0207660_10757386 3300025917 Unclassified 792
179 Ga0207662_10125064 3300025918 Bacteria 1616
180 Ga0207657_10029923 3300025919 Bacteria 4949
181 Ga0207681_10542563 3300025923 Unclassified 956
182 Ga0207681_10842630 3300025923 Bacteria 767
183 Ga0207687_10160451 3300025927 Bacteria 1725
184 Ga0207687_10648082 3300025927 Bacteria 893
185 Ga0207700_10038191 3300025928 Bacteria 3484
186 Ga0207700_10055555 3300025928 Bacteria 2977
187 Ga0207664_10144757 3300025929 Bacteria 2014
188 Ga0207664_10359259 3300025929 Bacteria 1290
189 Ga0207664_11956815 3300025929 Bacteria 509
190 Ga0207690_10420966 3300025932 Bacteria 1068
191 Ga0207690_10523992 3300025932 Bacteria 961
192 Ga0207706_10013953 3300025933 Bacteria 7285
193 Ga0207686_11290451 3300025934 Unclassified 599
194 Ga0207670_10376104 3300025936 Bacteria 1130
195 Ga0207669_10018029 3300025937 Bacteria 3637
196 Ga0207669_10630559 3300025937 Bacteria 874
197 Ga0207704_10490552 3300025938 Bacteria 988
198 Ga0207704_10885886 3300025938 Bacteria 750
199 Ga0207665_10001453 3300025939 Bacteria 15941
200 Ga0207691_10431207 3300025940 Bacteria 1123
201 Ga0207689_10059853 3300025942 Bacteria 3133
202 Ga0207661_10197964 3300025944 Bacteria 1765
203 Ga0207661_10555398 3300025944 Bacteria 1052
204 Ga0207679_10412810 3300025945 Bacteria 1190
205 Ga0207679_10956952 3300025945 Bacteria 784
206 Ga0207679_11942853 3300025945 Bacteria 536
207 Ga0207667_12015493 3300025949 Unclassified 537
208 Ga0207651_10196290 3300025960 Bacteria 1614
209 Ga0207712_10309874 3300025961 Bacteria 1299
210 Ga0207712_10954529 3300025961 Unclassified 759
211 Ga0207712_11436216 3300025961 Bacteria 617
212 Ga0207668_10467906 3300025972 Bacteria 1079
213 Ga0207668_10685597 3300025972 Bacteria 899
214 Ga0207640_10227718 3300025981 Bacteria 1432
215 Ga0207677_10000751 3300026023 Bacteria 18691
216 Ga0207677_10350212 3300026023 Bacteria 1237
217 Ga0207677_10588867 3300026023 Bacteria 975
218 Ga0207639_10192882 3300026041 Bacteria 1741
219 Ga0207678_10003968 3300026067 Bacteria 13313
220 Ga0207708_10979570 3300026075 Bacteria 734
221 Ga0207702_10088586 3300026078 Bacteria 2704
222 Ga0207702_10507005 3300026078 Bacteria 1177
223 Ga0207702_11329800 3300026078 Bacteria 713
224 Ga0207702_11589802 3300026078 Bacteria 647
225 Ga0207648_10011438 3300026089 Bacteria 8359
226 Ga0207648_10081966 3300026089 Bacteria 2813
227 Ga0207676_10540028 3300026095 Bacteria 1112
228 Ga0207675_100010019 3300026118 Bacteria 8881
229 Ga0207675_100435851 3300026118 Bacteria 1296
230 Ga0207683_10001817 3300026121 Bacteria 18865
231 Ga0207683_10062902 3300026121 Bacteria 3269
232 Ga0207683_10172458 3300026121 Bacteria 1959
233 Ga0207698_10250386 3300026142 Unclassified 1621
234 Ga0210000_1026647 3300027462 Bacteria 897
235 Ga0209966_1035268 3300027695 Bacteria 1026
236 Ga0209974_10183570 3300027876 Bacteria 767
237 Ga0207428_10020923 3300027907 Bacteria 5547
238 Ga0268266_10995642 3300028379 Bacteria 811
239 Ga0268266_11017499 3300028379 Unclassified 802
240 Ga0268265_10018207 3300028380 Bacteria 4865
241 Ga0268265_10774410 3300028380 Bacteria 933
242 Ga0268264_10222448 3300028381 Bacteria 1738
243 Ga0268264_10573204 3300028381 Bacteria 1109
244 Ga0307408_100530391 3300031548 Unclassified 1036
245 Ga0307405_11027460 3300031731 Bacteria 705
246 Ga0307410_11718838 3300031852 Unclassified 556
247 Ga0307406_10039171 3300031901 Bacteria 2939
248 Ga0307409_100226847 3300031995 Bacteria 1690
249 Ga0307416_100388754 3300032002 Bacteria 1428
250 Ga0307416_102190639 3300032002 Bacteria 654
251 Ga0373930_0067744 3300034816 Bacteria 807
252 Ga0373948_0210067 3300034817 Bacteria 511
253 Ga0373938_0011691 3300034957 Bacteria 1637
254 Ga0373928_0035502 3300035084 Bacteria 1124
255 Ga0373929_0022177 3300035085 Bacteria 1294
256 Ga0373944_0181228 3300035089 Bacteria 755
257 Ga0373949_0025715 3300035090 Bacteria 1375
258 Ga0373936_0247265 3300035113 Bacteria 796
259 Ga0373939_0018775 3300035114 Bacteria 1858
260 Ga0373960_0047783 3300035121 Bacteria 1260
261 Ga0373943_0549759 3300035170 Bacteria 677
262 Ga0373961_0029235 3300035241 Bacteria 1525
263 Ga0373962_0030368 3300035242 Bacteria 1478
264 Ga0373931_0170675 3300035691 Bacteria 1281
265 Ga0373931_0182893 3300035691 Bacteria 1242
266 Ga0373927_0135277 3300035695 Bacteria 1611
267 Ga0373947_0029273 3300035725 Bacteria 3231
268 Ga0373937_0066358 3300036401 Bacteria 3323
269 Ga0395899_0026828 3300037312 Bacteria 4345
270 Ga0395899_0436790 3300037312 Unclassified 860
271 Ga0395900_0041527 3300037418 Bacteria 4741
272 Ga0395898_0025354 3300037466 Bacteria 5975
273 Ga0395898_0120907 3300037466 Bacteria 2509
274 Ga0395905_0022978 3300037471 Bacteria 5893
275 Ga0395905_0676751 3300037471 Bacteria 934
276 Ga0395901_0157789 3300038443 Bacteria 2382
277 Ga0395901_0295161 3300038443 Bacteria 1681
278 Ga0242420_056277 3300038996 Bacteria 777
279 Ga0451795_0910105 3300041456 Bacteria 644
280 Ga0451802_0591098 3300041460 Bacteria 1556
281 Ga0451847_0470698 3300041503 Unclassified 925
282 Ga0451853_3950848 3300041512 Unclassified 616
283 Ga0451853_4123673 3300041512 Bacteria 610
284 Ga0439455_0190120 3300042012 Bacteria 592
285 Ga0439459_0059998 3300042438 Bacteria 857
286 Ga0439464_0174743 3300042439 Bacteria 679
287 Ga0466966_0009738 3300044684 Bacteria 6367
288 Ga0466963_0803854 3300044694 Unclassified 663
289 Ga0466964_0010898 3300044706 Bacteria 3435
290 Ga0466960_0327821 3300044901 Bacteria 869
291 Ga0466958_0076332 3300045836 Bacteria 2057
292 Ga0466967_0989999 3300045976 Bacteria 837
293 Ga0495592_0036804 3300046454 Bacteria 3685
294 Ga0495592_0867306 3300046454 Unclassified 532
295 Ga0495603_0007182 3300046455 Bacteria 6689
296 Ga0495629_0034827 3300046459 Bacteria 3559
297 Ga0495629_0198439 3300046459 Bacteria 1388
298 Ga0495641_0009370 3300046461 Bacteria 5821
299 Ga0495651_0064169 3300046462 Bacteria 2807
300 Ga0495651_0180735 3300046462 Bacteria 1493
301 Ga0495580_0520850 3300046472 Bacteria 792
302 Ga0495582_0175416 3300046473 Bacteria 1221
303 Ga0495582_0340863 3300046473 Bacteria 863
304 Ga0495605_0183567 3300046474 Bacteria 919
305 Ga0495639_0253954 3300046475 Bacteria 870
306 Ga0495662_0001166 3300046476 Bacteria 12954
307 Ga0495584_0142292 3300046491 Bacteria 1218
308 Ga0495584_0334779 3300046491 Bacteria 769
309 Ga0495584_0473243 3300046491 Bacteria 638
310 Ga0495594_0000007 3300046499 Bacteria 160047
311 Ga0495594_0021917 3300046499 Bacteria 3413
312 Ga0495596_0294588 3300046500 Bacteria 631
313 Ga0495607_0319304 3300046501 Bacteria 725
314 Ga0495618_0238167 3300046514 Bacteria 1144
315 Ga0495618_0329763 3300046514 Unclassified 944
316 Ga0495628_0118427 3300046516 Bacteria 2033
317 Ga0495628_0522910 3300046516 Bacteria 854
318 Ga0495663_0131388 3300046525 Bacteria 845
319 Ga0495666_0011812 3300046526 Bacteria 4354
320 Ga0495642_0460989 3300046528 Bacteria 562
321 Ga0495652_0000003 3300046529 Bacteria 597094
322 Ga0495640_0023618 3300046533 Bacteria 4475
323 Ga0495587_0522332 3300046536 Bacteria 656
324 Ga0495609_0237809 3300046538 Bacteria 753
325 Ga0495609_0361342 3300046538 Bacteria 585
326 Ga0495621_0056954 3300046539 Bacteria 1410
327 Ga0495622_0000050 3300046557 Bacteria 106111
328 Ga0495634_0618349 3300046642 Unclassified 628
329 Ga0495611_0362281 3300046648 Bacteria 665
330 Ga0495635_0848204 3300046663 Unclassified 587
331 Ga0495588_0002365 3300046674 Bacteria 8069
332 Ga0495657_0005385 3300046675 Bacteria 10121
333 Ga0495599_0091102 3300046678 Bacteria 1902
334 Ga0495669_0091198 3300046684 Bacteria 1407
335 Ga0495613_0410312 3300046689 Bacteria 923
336 Ga0495670_0526575 3300046691 Bacteria 643
337 Ga0495589_0316297 3300046794 Unclassified 722
338 Ga0495589_0316337 3300046794 Bacteria 722
339 Ga0495600_0317636 3300046809 Bacteria 980
340 Ga0495581_0250746 3300047315 Bacteria 1035
341 Ga0495674_0000020 3300047319 Bacteria 178465
342 Ga0495676_0013636 3300047321 Bacteria 7296
343 Ga0495676_0027331 3300047321 Bacteria 4893
344 Ga0495680_0000952 3300047322 Bacteria 32176
345 Ga0495680_0022229 3300047322 Bacteria 5290
346 Ga0495680_0100046 3300047322 Bacteria 2161
347 Ga0495675_0049003 3300047444 Bacteria 2686
348 Ga0495685_008795 3300047447 Bacteria 3363
349 Ga0495684_0130343 3300047471 Bacteria 1889
350 Ga0495684_0137169 3300047471 Bacteria 1836
351 Ga0495684_0726341 3300047471 Unclassified 656
352 Ga0495684_0811683 3300047471 Unclassified 610
353 Ga0496100_0000012 3300048903 Bacteria 182426
354 Ga0496100_0132114 3300048903 Bacteria 1760
355 Ga0496100_0222772 3300048903 Unclassified 1385
356 Ga0496100_0252219 3300048903 Bacteria 1305
357 Ga0496101_0000010 3300048904 Bacteria 281990
358 Ga0496101_0191152 3300048904 Bacteria 1580
359 Ga0496101_0377907 3300048904 Bacteria 1114
360 Ga0496102_0049806 3300048905 Bacteria 3812
361 Ga0496102_0057039 3300048905 Bacteria 3564
362 Ga0496102_0201278 3300048905 Bacteria 1877
363 Ga0496102_0404860 3300048905 Bacteria 1282
364 Ga0496102_0590016 3300048905 Bacteria 1034
365 Ga0496102_0644302 3300048905 Bacteria 983
366 Ga0496103_0056676 3300048906 Unclassified 2433
367 Ga0496103_0132766 3300048906 Bacteria 1590
368 Ga0496104_0000002 3300048907 Bacteria 686017
369 Ga0496104_0000461 3300048907 Bacteria 35063
370 Ga0496104_0001925 3300048907 Bacteria 17988
371 Ga0496104_0409349 3300048907 Bacteria 1269
372 Ga0496105_0000001 3300048908 Bacteria 1328178
373 Ga0496105_0000673 3300048908 Bacteria 22964
374 Ga0496105_0201922 3300048908 Bacteria 1622
375 Ga0496105_0233094 3300048908 Bacteria 1496
376 Ga0496105_0860614 3300048908 Bacteria 685
377 Ga0496106_0000017 3300048909 Bacteria 181561
378 Ga0496106_0644804 3300048909 Bacteria 846
379 Ga0496106_0649817 3300048909 Unclassified 843
380 Ga0496107_0000012 3300048910 Bacteria 181629
381 Ga0496107_0063673 3300048910 Bacteria 2672
382 Ga0496108_0001139 3300048911 Bacteria 20752
383 Ga0496108_0014399 3300048911 Bacteria 6457
384 Ga0496109_0007510 3300048912 Bacteria 9234
385 Ga0496109_0019323 3300048912 Bacteria 6004
386 Ga0496109_0209409 3300048912 Unclassified 1834
387 Ga0496109_0210845 3300048912 Bacteria 1827
388 Ga0496109_0576650 3300048912 Bacteria 1060
389 Ga0496110_0005455 3300048913 Bacteria 9976
390 Ga0496110_0039931 3300048913 Bacteria 4089
391 Ga0496110_0040529 3300048913 Bacteria 4058
392 Ga0496110_0102137 3300048913 Bacteria 2571
393 Ga0496110_0602507 3300048913 Bacteria 996
394 Ga0496111_0000183 3300048914 Bacteria 28637
395 Ga0496111_0061989 3300048914 Bacteria 2711
396 Ga0496111_0222245 3300048914 Bacteria 1403
397 Ga0496111_0379932 3300048914 Bacteria 1045
398 Ga0496111_0388043 3300048914 Bacteria 1032
399 Ga0496111_1150915 3300048914 Bacteria 551
400 Ga0496112_0008015 3300048915 Bacteria 9423
401 Ga0496112_0021354 3300048915 Bacteria 6156
402 Ga0496112_0185117 3300048915 Bacteria 2046
403 Ga0496112_0253127 3300048915 Bacteria 1712
404 Ga0496113_0001248 3300048916 Bacteria 13999
405 Ga0496113_0331023 3300048916 Bacteria 1221
406 Ga0496114_0000003 3300048917 Bacteria 630981
407 Ga0496114_0183598 3300048917 Bacteria 1827
408 Ga0496114_0253029 3300048917 Bacteria 1550
409 Ga0496114_0297479 3300048917 Bacteria 1425
410 Ga0496114_1404426 3300048917 Bacteria 585
411 Ga0496115_0000020 3300048918 Bacteria 171995
412 Ga0496115_0000036 3300048918 Bacteria 127774
413 Ga0496115_0160498 3300048918 Bacteria 1857
414 Ga0496115_0388827 3300048918 Bacteria 1133
415 Ga0496119_0023695 3300048922 Bacteria 4342
416 Ga0496120_0164310 3300048923 Bacteria 1103
417 Ga0501079_0392284 3300049741 Bacteria 1089
418 nmdc:mga00v17_15658_c1 3300050491 Bacteria 4259
419 nmdc:mga0yw44_140896_c1 3300050492 Bacteria 1567
420 nmdc:mga06z11_297813_c1 3300050494 Bacteria 958
421 nmdc:mga05p37_203551_c1 3300050507 Bacteria 2396
422 nmdc:mga05p37_612068_c1 3300050507 Bacteria 1227
423 nmdc:mga05p37_985782_c1 3300050507 Bacteria 897
424 nmdc:mga06r32_127446_c1 3300050510 Bacteria 2515
425 nmdc:mga08y16_109464_c1 3300050511 Bacteria 2877
426 nmdc:mga0n895_103702_c1 3300050512 Bacteria 2856
427 nmdc:mga0rr50_39280_c1 3300050513 Bacteria 3432
428 nmdc:mga08x19_6507_c1 3300050514 Bacteria 6919
429 nmdc:mga0a205_137409_c1 3300050515 Bacteria 2345
430 Ga0495601_0675053 3300053077 Bacteria 660
431 Ga0495612_0000083 3300053078 Bacteria 42444
432 Ga0495655_0133594 3300053083 Bacteria 766
433 Ga0495595_0229847 3300053084 Bacteria 927
434 Ga0500566_0240568 3300053094 Unclassified 887
435 Ga0495602_0042794
436 JGI24747J21853_1022969
437 JGI25405J52794_10058350
438 Ga0070683_100896255
439 Ga0070683_102078660
440 Ga0070690_100197552
441 Ga0070690_100599783
442 Ga0070670_100705947
443 Ga0070680_100599173
444 Ga0070682_100017237
445 Ga0070682_100159117
446 Ga0068868_100000008
447 Ga0070660_100321726
448 Ga0070689_100395104
449 Ga0070691_10058984
450 Ga0070691_10067558
451 Ga0070691_10350427
452 Ga0070661_101148278
453 Ga0070692_10042483
454 Ga0070668_100084454
455 Ga0070668_100123991
456 Ga0070671_101168493
457 Ga0070674_100025098
458 Ga0070674_100037319
459 Ga0070673_100050446
460 Ga0070673_101076016
461 Ga0070659_100017159
462 Ga0070659_100079660
463 Ga0070709_10105840
464 Ga0070709_10693860
465 Ga0070709_10856849
466 Ga0070714_100022572
467 Ga0070714_102247184
468 Ga0070713_100140569
469 Ga0070713_100170069
470 Ga0070710_10077459
471 Ga0070710_10153449
472 Ga0070710_10197760
473 Ga0070710_10369442
474 Ga0070701_10259298
475 Ga0070701_10268761
476 Ga0070711_100330904
477 Ga0070705_100015067
478 Ga0070705_100166105
479 Ga0070705_100423286
480 Ga0070705_101130907
481 Ga0070700_100290318
482 Ga0070708_100087938
483 Ga0070708_100836773
484 Ga0070663_100257600
485 Ga0070678_100031124
486 Ga0070678_100083700
487 Ga0070678_100127808
488 Ga0070662_100085461
489 Ga0070681_10019928
490 Ga0070681_10548336
491 Ga0068867_100061182
492 Ga0068867_100877632
493 Ga0070706_100048871
494 Ga0070698_100610269
495 Ga0070699_100039479
496 Ga0070679_100065195
497 Ga0070679_100164044
498 Ga0070684_100223795
499 Ga0070684_101327809
500 Ga0070684_101742921
501 Ga0068853_100200561
502 Ga0070695_100043429
503 Ga0070695_101035710
504 Ga0070696_100045249
505 Ga0070696_100374199
506 Ga0070693_100016952
507 Ga0070693_100080569
508 Ga0070693_100249379
509 Ga0070665_100990091
510 Ga0070665_101519918
511 Ga0070704_100228548
512 Ga0068855_100093741
513 Ga0068857_100413317
514 Ga0068854_100050431
515 Ga0068856_100039808
516 Ga0068856_100346421
517 Ga0068856_100481650
518 Ga0068856_101215792
519 Ga0070702_100109672
520 Ga0070702_101446083
521 Ga0070702_101456345
522 Ga0068852_100280701
523 Ga0068864_100519000
524 Ga0068866_10085591
525 Ga0068861_100156607
526 Ga0068861_100375734
527 Ga0081455_10002444
528 Ga0081455_10094874
529 Ga0081455_10208448
530 Ga0081540_1005740
531 Ga0081540_1006073
532 Ga0070717_10065445
533 Ga0075365_10027490
534 Ga0075364_10050380
535 Ga0075432_10027773
536 Ga0070715_10013812
537 Ga0070716_100730635
538 Ga0070712_100029296
539 Ga0075367_10349056
540 Ga0097621_100017415
541 Ga0068871_100175085
542 Ga0075428_100343113
543 Ga0075431_100943116
544 Ga0075433_10000047
545 Ga0075433_10502159
546 Ga0075433_10747606
547 Ga0075434_100808705
548 Ga0068865_100096074
549 Ga0068865_100146332
550 Ga0068865_101877408
551 Ga0075436_100002978
552 Ga0075435_100075041
553 Ga0075435_100635170
554 Ga0105250_10286181
555 Ga0105245_10203389
556 Ga0105245_10220765
557 Ga0105245_10872339
558 Ga0105247_10000516
559 Ga0114129_10114316
560 Ga0105243_10121572
561 Ga0105243_10435794
562 Ga0105241_10051814
563 Ga0105241_10264634
564 Ga0105248_11396977
565 Ga0105237_10778258
566 Ga0105249_10062959
567 Ga0105239_10367697
568 Ga0105239_10538821
569 Ga0105239_10626821
570 Ga0105239_12132806
571 Ga0105246_10697622
572 Ga0105246_11510038
573 Ga0157316_1001777
574 Ga0157371_10167629
575 Ga0157378_10070901
576 Ga0157378_11060476
577 Ga0157378_11109106
578 Ga0163162_10249006
579 Ga0163162_11340522
580 Ga0157372_10050308
581 Ga0157375_10008980
582 Ga0157375_10195010
583 Ga0157375_10612812
584 Ga0157375_13130628
585 Ga0163163_10085658
586 Ga0157380_10009946
587 Ga0157380_10030397
588 Ga0157377_10403279
589 Ga0157376_10030574
590 Ga0157376_11104288
591 Ga0182005_1274313
592 Ga0163161_10000018
593 Ga0163161_10139343
594 Ga0206354_11111355
595 Ga0207653_10022624
596 Ga0207692_10193165
597 Ga0207692_10222891
598 Ga0207692_10269555
599 Ga0207642_10149691
600 Ga0207710_10000276
601 Ga0207680_10193556
602 Ga0207685_10422425
603 Ga0207699_10206706
604 Ga0207645_10108254
605 Ga0207684_10028474
606 Ga0207654_10075309
607 Ga0207695_11083990
608 Ga0207693_10013159
609 Ga0207693_10014565
610 Ga0207663_10125751
611 Ga0207663_10129860
612 Ga0207660_10757386
613 Ga0207662_10125064
614 Ga0207657_10029923
615 Ga0207681_10542563
616 Ga0207681_10842630
617 Ga0207687_10160451
618 Ga0207687_10648082
619 Ga0207700_10038191
620 Ga0207700_10055555
621 Ga0207664_10144757
622 Ga0207664_10359259
623 Ga0207664_11956815
624 Ga0207690_10420966
625 Ga0207690_10523992
626 Ga0207706_10013953
627 Ga0207686_11290451
628 Ga0207670_10376104
629 Ga0207669_10018029
630 Ga0207669_10630559
631 Ga0207704_10490552
632 Ga0207704_10885886
633 Ga0207665_10001453
634 Ga0207691_10431207
635 Ga0207689_10059853
636 Ga0207661_10197964
637 Ga0207661_10555398
638 Ga0207679_10412810
639 Ga0207679_10956952
640 Ga0207679_11942853
641 Ga0207667_12015493
642 Ga0207651_10196290
643 Ga0207712_10309874
644 Ga0207712_10954529
645 Ga0207712_11436216
646 Ga0207668_10467906
647 Ga0207668_10685597
648 Ga0207640_10227718
649 Ga0207677_10000751
650 Ga0207677_10350212
651 Ga0207677_10588867
652 Ga0207639_10192882
653 Ga0207678_10003968
654 Ga0207708_10979570
655 Ga0207702_10088586
656 Ga0207702_10507005
657 Ga0207702_11329800
658 Ga0207702_11589802
659 Ga0207648_10011438
660 Ga0207648_10081966
661 Ga0207676_10540028
662 Ga0207675_100010019
663 Ga0207675_100435851
664 Ga0207683_10001817
665 Ga0207683_10062902
666 Ga0207683_10172458
667 Ga0207698_10250386
668 Ga0210000_1026647
669 Ga0209966_1035268
670 Ga0209974_10183570
671 Ga0207428_10020923
672 Ga0268266_10995642
673 Ga0268266_11017499
674 Ga0268265_10018207
675 Ga0268265_10774410
676 Ga0268264_10222448
677 Ga0268264_10573204
678 Ga0307408_100530391
679 Ga0307405_11027460
680 Ga0307410_11718838
681 Ga0307406_10039171
682 Ga0307409_100226847
683 Ga0307416_100388754
684 Ga0307416_102190639
685 Ga0373930_0067744
686 Ga0373948_0210067
687 Ga0373938_0011691
688 Ga0373928_0035502
689 Ga0373929_0022177
690 Ga0373944_0181228
691 Ga0373949_0025715
692 Ga0373936_0247265
693 Ga0373939_0018775
694 Ga0373960_0047783
695 Ga0373943_0549759
696 Ga0373961_0029235
697 Ga0373962_0030368
698 Ga0373931_0170675
699 Ga0373931_0182893
700 Ga0373927_0135277
701 Ga0373947_0029273
702 Ga0373937_0066358
703 Ga0395899_0026828
704 Ga0395899_0436790
705 Ga0395900_0041527
706 Ga0395898_0025354
707 Ga0395898_0120907
708 Ga0395905_0022978
709 Ga0395905_0676751
710 Ga0395901_0157789
711 Ga0395901_0295161
712 Ga0242420_056277
713 Ga0451795_0910105
714 Ga0451802_0591098
715 Ga0451847_0470698
716 Ga0451853_3950848
717 Ga0451853_4123673
718 Ga0439455_0190120
719 Ga0439459_0059998
720 Ga0439464_0174743
721 Ga0466966_0009738
722 Ga0466963_0803854
723 Ga0466964_0010898
724 Ga0466960_0327821
725 Ga0466958_0076332
726 Ga0466967_0989999
727 Ga0495592_0036804
728 Ga0495592_0867306
729 Ga0495603_0007182
730 Ga0495629_0034827
731 Ga0495629_0198439
732 Ga0495641_0009370
733 Ga0495651_0064169
734 Ga0495651_0180735
735 Ga0495580_0520850
736 Ga0495582_0175416
737 Ga0495582_0340863
738 Ga0495605_0183567
739 Ga0495639_0253954
740 Ga0495662_0001166
741 Ga0495584_0142292
742 Ga0495584_0334779
743 Ga0495584_0473243
744 Ga0495594_0000007
745 Ga0495594_0021917
746 Ga0495596_0294588
747 Ga0495607_0319304
748 Ga0495618_0238167
749 Ga0495618_0329763
750 Ga0495628_0118427
751 Ga0495628_0522910
752 Ga0495663_0131388
753 Ga0495666_0011812
754 Ga0495642_0460989
755 Ga0495652_0000003
756 Ga0495640_0023618
757 Ga0495587_0522332
758 Ga0495609_0237809
759 Ga0495609_0361342
760 Ga0495621_0056954
761 Ga0495622_0000050
762 Ga0495634_0618349
763 Ga0495611_0362281
764 Ga0495635_0848204
765 Ga0495588_0002365
766 Ga0495657_0005385
767 Ga0495599_0091102
768 Ga0495669_0091198
769 Ga0495613_0410312
770 Ga0495670_0526575
771 Ga0495589_0316297
772 Ga0495589_0316337
773 Ga0495600_0317636
774 Ga0495581_0250746
775 Ga0495674_0000020
776 Ga0495676_0013636
777 Ga0495676_0027331
778 Ga0495680_0000952
779 Ga0495680_0022229
780 Ga0495680_0100046
781 Ga0495675_0049003
782 Ga0495685_008795
783 Ga0495684_0130343
784 Ga0495684_0137169
785 Ga0495684_0726341
786 Ga0495684_0811683
787 Ga0496100_0000012
788 Ga0496100_0132114
789 Ga0496100_0222772
790 Ga0496100_0252219
791 Ga0496101_0000010
792 Ga0496101_0191152
793 Ga0496101_0377907
794 Ga0496102_0049806
795 Ga0496102_0057039
796 Ga0496102_0201278
797 Ga0496102_0404860
798 Ga0496102_0590016
799 Ga0496102_0644302
800 Ga0496103_0056676
801 Ga0496103_0132766
802 Ga0496104_0000002
803 Ga0496104_0000461
804 Ga0496104_0001925
805 Ga0496104_0409349
806 Ga0496105_0000001
807 Ga0496105_0000673
808 Ga0496105_0201922
809 Ga0496105_0233094
810 Ga0496105_0860614
811 Ga0496106_0000017
812 Ga0496106_0644804
813 Ga0496106_0649817
814 Ga0496107_0000012
815 Ga0496107_0063673
816 Ga0496108_0001139
817 Ga0496108_0014399
818 Ga0496109_0007510
819 Ga0496109_0019323
820 Ga0496109_0209409
821 Ga0496109_0210845
822 Ga0496109_0576650
823 Ga0496110_0005455
824 Ga0496110_0039931
825 Ga0496110_0040529
826 Ga0496110_0102137
827 Ga0496110_0602507
828 Ga0496111_0000183
829 Ga0496111_0061989
830 Ga0496111_0222245
831 Ga0496111_0379932
832 Ga0496111_0388043
833 Ga0496111_1150915
834 Ga0496112_0008015
835 Ga0496112_0021354
836 Ga0496112_0185117
837 Ga0496112_0253127
838 Ga0496113_0001248
839 Ga0496113_0331023
840 Ga0496114_0000003
841 Ga0496114_0183598
842 Ga0496114_0253029
843 Ga0496114_0297479
844 Ga0496114_1404426
845 Ga0496115_0000020
846 Ga0496115_0000036
847 Ga0496115_0160498
848 Ga0496115_0388827
849 Ga0496119_0023695
850 Ga0496120_0164310
851 Ga0501079_0392284
852 nmdc:mga00v17_15658_c1
853 nmdc:mga0yw44_140896_c1
854 nmdc:mga06z11_297813_c1
855 nmdc:mga05p37_203551_c1
856 nmdc:mga05p37_612068_c1
857 nmdc:mga05p37_985782_c1
858 nmdc:mga06r32_127446_c1
859 nmdc:mga08y16_109464_c1
860 nmdc:mga0n895_103702_c1
861 nmdc:mga0rr50_39280_c1
862 nmdc:mga08x19_6507_c1
863 nmdc:mga0a205_137409_c1
864 Ga0495601_0675053
865 Ga0495612_0000083
866 Ga0495655_0133594
867 Ga0495595_0229847
868 Ga0500566_0240568

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

32

145

0.89

PF18029

Glyoxalase_6

Glyoxalase-like domain

32

146

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.7994 2 121
2r6u-assembly2.cif.gz_B crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.7963 1 124
2r6u-assembly2.cif.gz_B crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.7904 1 124
2r6u-assembly2.cif.gz_D crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.771 1 124
2r6u-assembly2.cif.gz_D crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.7492 1 124
ID Description Score Start End Superfamily
3oxhA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8238 5 123 3.10.180.10
af_Q59ST1_26_339_3.40.50.1580 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.811 105 121 3.40.50.1580
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8064 71 127 3.30.720.110
2r6uB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8019 4 124 3.10.180.10
2r6uB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7958 4 124 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2W5XV32-F1-model_v4 Glyoxalase 0.9665 1 124
AF-A0A7V8YAP9-F1-model_v4 VOC family protein 0.9426 1 122
AF-A0A1G0SLC4-F1-model_v4 VOC domain-containing protein 0.9383 1 127
AF-A0A537KZ15-F1-model_v4 VOC domain-containing protein 0.9382 1 121
AF-A0A7V8YAP9-F1-model_v4 VOC family protein 0.9347 1 122

Map