F443162

General Info

Members Datasets Scaffolds Average Seq Length
434 237 866 251

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0000213|Ga0495606_0000213_48522_49376
Length 284
Sequence MLLGYTCVTVTFQYKVTKNNLIGLPLSLHQIIETMSKLKNKVAVITGGNSGIGFGIAEAFKNEGATGAIIGRNQETLDSAVAQLGDSFIAINADVTNVADLERVFKETAEKFGKIDVIVANAGGGAVGTVATIGEADYDKTMDLNLKSVYFTVHKALPYINDGGSIILIGSNAAHRAYPNFTLYGAAKAAVIFFAKAFSSDLLGRKIRANVITPGTTDTPAFEKFVPLEQIEAIKKHFAGEMPTGRIGQPSDIGKTAVFLASDDSSFMLGAELLVDGGMTYLAK

Samples

Sample ID Description Type Environment
1 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
88 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
90 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
91 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
134 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
135 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
136 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
150 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
157 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
165 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
168 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
169 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
170 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
171 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
172 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
173 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
178 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
179 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
180 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
184 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
193 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
194 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
195 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
196 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
197 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
198 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
199 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
200 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
201 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
202 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
203 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
204 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
205 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
206 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
207 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
208 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
209 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
210 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
211 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
212 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
214 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
215 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
216 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
217 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
218 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
219 2739367651 Pedobacter sp. OK291 Isolate Unclassified
220 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
221 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
222 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
223 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
224 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
225 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
226 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
227 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
228 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
229 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
230 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
231 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
232 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
233 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
234 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
235 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
236 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
237 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.7
Metatranscriptomes 0
Isolates 5.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.59
Nodule 0
Rhizoplane 0.69
Rhizosphere 71.43
Stem 0
Stem Tuber 0
Unclassified 0.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495606_0000213 3300046507 Bacteria 103305
2 JGI24739J22299_10027029 3300001989 Unclassified 2008
3 JGI25156J39149_1001620 3300002705 Bacteria 9181
4 JGI25162J39368_1000055 3300002737 Bacteria 147236
5 JGI25162J39368_1000210 3300002737 Bacteria 61589
6 JGI25154J39366_1006754 3300002738 Bacteria 1642
7 JGI25157J39369_1001095 3300002741 Bacteria 12117
8 JGI25164J39214_1000004 3300002772 Bacteria 350814
9 JGI25165J46597_1000271 3300003214 Bacteria 66785
10 JGI25153J46596_10040178 3300003215 Unclassified 1454
11 rootH1_10157952 3300003316 Bacteria 1362
12 rootH2_10001891 3300003320 Bacteria 464318
13 rootH2_10086563 3300003320 Bacteria 5934
14 rootL2_10028591 3300003322 Bacteria 7998
15 rootL2_10123493 3300003322 Bacteria 3783
16 rootH1_10056276 3300003323 Bacteria 17464
17 rootH1_10149492 3300003323 Bacteria 1306
18 rootH1_10268945 3300003323 Bacteria 1894
19 rootH1_10320927 3300003323 Bacteria 1636
20 Ga0055527_1000640 3300003760 Bacteria 10706
21 Ga0055535_1001173 3300003761 Bacteria 15170
22 Ga0055542_1000380 3300003762 Bacteria 45333
23 Ga0055529_1000102 3300003763 Bacteria 129901
24 Ga0055526_1012703 3300003771 Bacteria 3642
25 Ga0055526_1014591 3300003771 Bacteria 3219
26 Ga0055528_1000391 3300003790 Bacteria 35686
27 Ga0055530_10031035 3300003791 Bacteria 1407
28 Ga0055543_1015036 3300004625 Unclassified 1496
29 Ga0065165_1000105 3300005262 Bacteria 140409
30 Ga0065714_10004922 3300005288 Bacteria 4318
31 Ga0065714_10006272 3300005288 Bacteria 4200
32 Ga0065714_10069735 3300005288 Bacteria 4108
33 Ga0070658_10021729 3300005327 Bacteria 5143
34 Ga0070683_100125441 3300005329 Bacteria 2427
35 Ga0070670_100043466 3300005331 Bacteria 3862
36 Ga0068869_100015189 3300005334 Bacteria 5159
37 Ga0070666_10000227 3300005335 Bacteria 38376
38 Ga0070666_10009847 3300005335 Bacteria 5968
39 Ga0070680_100054282 3300005336 Bacteria 3271
40 Ga0070692_10120311 3300005345 Bacteria 1464
41 Ga0070671_100259801 3300005355 Bacteria 1476
42 Ga0070673_100282917 3300005364 Bacteria 1455
43 Ga0070667_100196409 3300005367 Bacteria 1789
44 Ga0070685_10056843 3300005466 Bacteria 2276
45 Ga0070679_100089011 3300005530 Bacteria 3074
46 Ga0070679_100588985 3300005530 Bacteria 1056
47 Ga0068853_100011474 3300005539 Bacteria 7202
48 Ga0068853_100071474 3300005539 Bacteria 3022
49 Ga0070693_100240237 3300005547 Bacteria 1196
50 Ga0070665_100000002 3300005548 Bacteria 849037
51 Ga0068855_100001481 3300005563 Bacteria 29367
52 Ga0068854_100043710 3300005578 Bacteria 3177
53 Ga0068856_100030466 3300005614 Bacteria 5274
54 Ga0068852_100002150 3300005616 Bacteria 13529
55 Ga0068852_100086446 3300005616 Bacteria 2795
56 Ga0068859_100000025 3300005617 Bacteria 191679
57 Ga0068864_100016328 3300005618 Bacteria 6181
58 Ga0068864_100023718 3300005618 Bacteria 5154
59 Ga0068851_10026696 3300005834 Bacteria 2841
60 Ga0068863_100002521 3300005841 Bacteria 18175
61 Ga0068863_100038360 3300005841 Bacteria 4559
62 Ga0068863_100494530 3300005841 Bacteria 1204
63 Ga0068858_100033520 3300005842 Bacteria 4764
64 Ga0068858_100115195 3300005842 Bacteria 2511
65 Ga0068860_100007781 3300005843 Bacteria 10704
66 Ga0068860_100014670 3300005843 Bacteria 7667
67 Ga0075366_10000275 3300006195 Bacteria 22900
68 Ga0097621_100066713 3300006237 Bacteria 2964
69 Ga0097621_100101438 3300006237 Bacteria 2422
70 Ga0068871_100026828 3300006358 Bacteria 4499
71 Ga0068871_100124553 3300006358 Bacteria 2180
72 Ga0068865_100069462 3300006881 Bacteria 2493
73 Ga0097620_100000025 3300006931 Bacteria 191679
74 Ga0105251_10176583 3300009011 Bacteria 962
75 Ga0105244_10171394 3300009036 Bacteria 1032
76 Ga0105240_10000020 3300009093 Bacteria 399699
77 Ga0105240_10000039 3300009093 Bacteria 270117
78 Ga0105240_10000576 3300009093 Bacteria 68032
79 Ga0105240_10025526 3300009093 Bacteria 7763
80 Ga0105240_10060481 3300009093 Bacteria 4722
81 Ga0105240_10215431 3300009093 Bacteria 2241
82 Ga0105240_10306916 3300009093 Bacteria 1814
83 Ga0105240_10467295 3300009093 Bacteria 1408
84 Ga0105240_10702147 3300009093 Bacteria 1104
85 Ga0105245_10509172 3300009098 Bacteria 1221
86 Ga0105247_10042924 3300009101 Bacteria 2770
87 Ga0105243_10000106 3300009148 Bacteria 95432
88 Ga0105241_10002512 3300009174 Bacteria 13776
89 Ga0105241_10002757 3300009174 Bacteria 13163
90 Ga0105241_10029193 3300009174 Bacteria 4112
91 Ga0105241_10338206 3300009174 Bacteria 1303
92 Ga0105242_10026577 3300009176 Bacteria 4588
93 Ga0105237_10001824 3300009545 Bacteria 27466
94 Ga0105237_10008413 3300009545 Bacteria 11176
95 Ga0105237_10010367 3300009545 Bacteria 9922
96 Ga0105237_10011407 3300009545 Bacteria 9401
97 Ga0105237_10048619 3300009545 Bacteria 4263
98 Ga0105237_10278764 3300009545 Bacteria 1674
99 Ga0105237_10406091 3300009545 Bacteria 1367
100 Ga0105238_10038275 3300009551 Bacteria 4870
101 Ga0105238_10117486 3300009551 Bacteria 2640
102 Ga0105238_10588685 3300009551 Bacteria 1119
103 Ga0105249_10036891 3300009553 Bacteria 4435
104 Ga0105239_10000327 3300010375 Bacteria 70423
105 Ga0105239_10001551 3300010375 Bacteria 30359
106 Ga0105239_10004235 3300010375 Bacteria 17232
107 Ga0105239_10040903 3300010375 Bacteria 5080
108 Ga0105239_10451736 3300010375 Bacteria 1458
109 Ga0105239_10552410 3300010375 Bacteria 1311
110 Ga0105246_10010971 3300011119 Bacteria 5617
111 Ga0105246_10021367 3300011119 Bacteria 4165
112 Ga0157373_10013752 3300013100 Bacteria 5933
113 Ga0157373_10022368 3300013100 Bacteria 4587
114 Ga0157373_10115029 3300013100 Bacteria 1891
115 Ga0157373_10536098 3300013100 Bacteria 848
116 Ga0157371_10000027 3300013102 Bacteria 269243
117 Ga0157371_10026500 3300013102 Bacteria 4213
118 Ga0157371_10119749 3300013102 Bacteria 1871
119 Ga0157371_10286533 3300013102 Bacteria 1191
120 Ga0157370_10000018 3300013104 Bacteria 169223
121 Ga0157370_10000463 3300013104 Bacteria 50658
122 Ga0157370_10007731 3300013104 Bacteria 11656
123 Ga0157370_10027024 3300013104 Bacteria 5660
124 Ga0157370_10052595 3300013104 Bacteria 3888
125 Ga0157370_10063029 3300013104 Bacteria 3514
126 Ga0157370_10510155 3300013104 Bacteria 1104
127 Ga0157370_10680710 3300013104 Bacteria 939
128 Ga0157369_10000117 3300013105 Bacteria 111900
129 Ga0157369_10028212 3300013105 Bacteria 6214
130 Ga0157369_10245159 3300013105 Bacteria 1871
131 Ga0157374_10560096 3300013296 Bacteria 1151
132 Ga0157378_10028996 3300013297 Bacteria 4886
133 Ga0157378_10050064 3300013297 Bacteria 3717
134 Ga0157378_10135269 3300013297 Bacteria 2285
135 Ga0157378_10617764 3300013297 Bacteria 1097
136 Ga0163162_10000223 3300013306 Bacteria 51991
137 Ga0163162_10007860 3300013306 Bacteria 10391
138 Ga0163162_10021145 3300013306 Bacteria 6401
139 Ga0163162_10032157 3300013306 Bacteria 5209
140 Ga0163162_10109180 3300013306 Bacteria 2863
141 Ga0157372_10012300 3300013307 Bacteria 9119
142 Ga0157372_10241485 3300013307 Bacteria 2096
143 Ga0157372_10425652 3300013307 Bacteria 1547
144 Ga0157372_10620678 3300013307 Bacteria 1260
145 Ga0157372_10813898 3300013307 Bacteria 1085
146 Ga0157372_10838585 3300013307 Bacteria 1067
147 Ga0157375_10031268 3300013308 Bacteria 5029
148 Ga0157375_10175023 3300013308 Bacteria 2295
149 Ga0163163_10053200 3300014325 Bacteria 3996
150 Ga0163163_10454314 3300014325 Bacteria 1341
151 Ga0157380_10518482 3300014326 Bacteria 1162
152 Ga0182008_10000791 3300014497 Bacteria 22182
153 Ga0157379_10073497 3300014968 Bacteria 3060
154 Ga0157376_10014068 3300014969 Bacteria 5991
155 Ga0182006_1000110 3300015261 Bacteria 88392
156 Ga0182007_10000007 3300015262 Bacteria 376596
157 Ga0163161_10164601 3300017792 Bacteria 1693
158 Ga0209672_100084 3300025228 Bacteria 129975
159 Ga0209563_105966 3300025230 Bacteria 2141
160 Ga0207427_100031 3300025231 Bacteria 350866
161 Ga0209437_100061 3300025233 Bacteria 350866
162 Ga0209437_100130 3300025233 Bacteria 183731
163 Ga0209258_100188 3300025242 Bacteria 130022
164 Ga0209646_1000628 3300025246 Bacteria 13369
165 Ga0209026_1000766 3300025250 Bacteria 17997
166 Ga0209148_1000063 3300025254 Bacteria 346881
167 Ga0209759_1000137 3300025256 Bacteria 125216
168 Ga0209233_1000076 3300025261 Bacteria 350866
169 Ga0209455_1000165 3300025272 Bacteria 113465
170 Ga0209455_1003239 3300025272 Bacteria 5870
171 Ga0209673_1000034 3300025273 Bacteria 328788
172 Ga0209564_1002305 3300025295 Bacteria 15500
173 Ga0209564_1002330 3300025295 Bacteria 15368
174 Ga0209758_1002092 3300025297 Bacteria 21216
175 Ga0209758_1002518 3300025297 Bacteria 18568
176 Ga0209050_1001344 3300025298 Bacteria 27243
177 Ga0207426_1038921 3300025302 Unclassified 1494
178 Ga0209051_1054474 3300025303 Bacteria 1305
179 Ga0209257_1001454 3300025304 Bacteria 27999
180 Ga0207656_10156746 3300025321 Bacteria 1081
181 Ga0207680_10000086 3300025903 Bacteria 42622
182 Ga0207680_10018151 3300025903 Bacteria 3733
183 Ga0207647_10011984 3300025904 Bacteria 6053
184 Ga0207647_10138971 3300025904 Bacteria 1424
185 Ga0207647_10219041 3300025904 Bacteria 1097
186 Ga0207705_10016064 3300025909 Bacteria 5373
187 Ga0207654_10001544 3300025911 Bacteria 12096
188 Ga0207654_10047062 3300025911 Bacteria 2463
189 Ga0207654_10331778 3300025911 Bacteria 1043
190 Ga0207707_10001086 3300025912 Bacteria 25962
191 Ga0207695_10000020 3300025913 Bacteria 723025
192 Ga0207695_10000058 3300025913 Bacteria 366582
193 Ga0207695_10000659 3300025913 Bacteria 68040
194 Ga0207695_10002235 3300025913 Bacteria 29044
195 Ga0207695_10034959 3300025913 Bacteria 5456
196 Ga0207695_10063167 3300025913 Bacteria 3818
197 Ga0207695_10075696 3300025913 Bacteria 3424
198 Ga0207695_10220032 3300025913 Bacteria 1806
199 Ga0207695_10330897 3300025913 Bacteria 1412
200 Ga0207695_10450271 3300025913 Bacteria 1170
201 Ga0207671_10000661 3300025914 Bacteria 44970
202 Ga0207671_10000803 3300025914 Bacteria 39858
203 Ga0207671_10001393 3300025914 Bacteria 28100
204 Ga0207671_10001892 3300025914 Bacteria 23269
205 Ga0207671_10005056 3300025914 Bacteria 12320
206 Ga0207671_10006990 3300025914 Bacteria 9900
207 Ga0207671_10014233 3300025914 Bacteria 6296
208 Ga0207660_10203240 3300025917 Bacteria 1548
209 Ga0207660_10265205 3300025917 Bacteria 1359
210 Ga0207657_10546286 3300025919 Bacteria 906
211 Ga0207652_10002241 3300025921 Bacteria 16465
212 Ga0207652_10002817 3300025921 Bacteria 14595
213 Ga0207652_10006423 3300025921 Bacteria 9479
214 Ga0207652_10636524 3300025921 Bacteria 954
215 Ga0207694_10193945 3300025924 Bacteria 1651
216 Ga0207650_10047591 3300025925 Bacteria 3160
217 Ga0207650_10224073 3300025925 Bacteria 1514
218 Ga0207650_10247282 3300025925 Bacteria 1443
219 Ga0207644_10070639 3300025931 Bacteria 2553
220 Ga0207709_10000077 3300025935 Bacteria 169923
221 Ga0207704_10091793 3300025938 Bacteria 1997
222 Ga0207689_10009286 3300025942 Bacteria 8502
223 Ga0207689_10142936 3300025942 Bacteria 1971
224 Ga0207661_10641830 3300025944 Bacteria 976
225 Ga0207667_10000770 3300025949 Bacteria 41675
226 Ga0207667_10303353 3300025949 Bacteria 1632
227 Ga0207651_10420704 3300025960 Bacteria 1141
228 Ga0207640_10032756 3300025981 Bacteria 3225
229 Ga0207658_10204880 3300025986 Bacteria 1649
230 Ga0207703_10001669 3300026035 Bacteria 19954
231 Ga0207639_10081650 3300026041 Bacteria 2561
232 Ga0207639_10243027 3300026041 Bacteria 1566
233 Ga0207641_10000132 3300026088 Bacteria 109247
234 Ga0207676_10031059 3300026095 Bacteria 4015
235 Ga0207676_10133473 3300026095 Bacteria 2115
236 Ga0207698_10000907 3300026142 Bacteria 17255
237 Ga0207698_10931334 3300026142 Bacteria 877
238 Ga0268266_10000022 3300028379 Bacteria 508060
239 Ga0268264_10000019 3300028381 Bacteria 488112
240 Ga0268264_10008648 3300028381 Bacteria 8458
241 Ga0307517_10020980 3300028786 Bacteria 8286
242 Ga0307517_10164093 3300028786 Bacteria 1481
243 Ga0307517_10242577 3300028786 Bacteria 1067
244 Ga0307515_10000076 3300028794 Bacteria 228736
245 Ga0307515_10000250 3300028794 Bacteria 133055
246 Ga0307515_10001092 3300028794 Bacteria 62178
247 Ga0307515_10004328 3300028794 Bacteria 29443
248 Ga0307515_10127864 3300028794 Bacteria 2823
249 Ga0307515_10150318 3300028794 Bacteria 2438
250 Ga0307515_10345081 3300028794 Bacteria 1139
251 Ga0316176_1200440 3300030732 Bacteria 21087
252 Ga0316183_1049060 3300030742 Bacteria 42044
253 Ga0316181_1185690 3300030744 Bacteria 1326
254 Ga0316182_1440262 3300030745 Bacteria 1808
255 Ga0265327_10055278 3300031251 Bacteria 2051
256 Ga0307513_10393412 3300031456 Bacteria 1122
257 Ga0307509_10138114 3300031507 Bacteria 2379
258 Ga0307509_10202993 3300031507 Bacteria 1817
259 Ga0307514_10097642 3300031649 Bacteria 2119
260 Ga0307405_10000047 3300031731 Bacteria 68371
261 Ga0307413_10005190 3300031824 Bacteria 5778
262 Ga0307407_10000007 3300031903 Bacteria 210716
263 Ga0307412_10000009 3300031911 Bacteria 445987
264 Ga0307412_10000485 3300031911 Bacteria 23781
265 Ga0307412_10046316 3300031911 Bacteria 2849
266 Ga0307409_100035038 3300031995 Bacteria 3674
267 Ga0307416_100000015 3300032002 Bacteria 210716
268 Ga0307414_10000468 3300032004 Bacteria 21171
269 Ga0307414_10000724 3300032004 Bacteria 16907
270 Ga0307414_10009621 3300032004 Bacteria 5563
271 Ga0307414_10010699 3300032004 Bacteria 5341
272 Ga0307411_10000011 3300032005 Bacteria 204666
273 Ga0307510_10008124 3300033180 Bacteria 12498
274 Ga0307510_10019189 3300033180 Bacteria 8023
275 Ga0373941_0001645 3300035115 Bacteria 4770
276 Ga0395899_0028497 3300037312 Bacteria 4205
277 Ga0395900_0019433 3300037418 Bacteria 6926
278 Ga0395900_0379280 3300037418 Bacteria 1382
279 Ga0395898_0009232 3300037466 Bacteria 10375
280 Ga0395898_0010842 3300037466 Bacteria 9521
281 Ga0395898_0056080 3300037466 Bacteria 3842
282 Ga0395901_0004445 3300038443 Bacteria 14139
283 Ga0451807_0425338 3300041486 Bacteria 1145
284 Ga0439445_0000394 3300042004 Bacteria 8835
285 Ga0466972_0000019 3300044658 Bacteria 198523
286 Ga0466970_0003287 3300044765 Bacteria 7855
287 Ga0495638_0155190 3300046460 Bacteria 1325
288 Ga0495651_0118657 3300046462 Bacteria 1946
289 Ga0495650_0000036 3300046471 Bacteria 400633
290 Ga0495650_0000050 3300046471 Bacteria 318894
291 Ga0495650_0126896 3300046471 Bacteria 934
292 Ga0495605_0201838 3300046474 Bacteria 866
293 Ga0495585_0000198 3300046492 Bacteria 62640
294 Ga0495585_0013061 3300046492 Bacteria 4871
295 Ga0495596_0052332 3300046500 Bacteria 1598
296 Ga0495583_0010021 3300046506 Bacteria 5583
297 Ga0495606_0004976 3300046507 Bacteria 12959
298 Ga0495606_0005183 3300046507 Bacteria 12606
299 Ga0495606_0012394 3300046507 Bacteria 6840
300 Ga0495606_0019677 3300046507 Bacteria 5010
301 Ga0495606_0050757 3300046507 Bacteria 2711
302 Ga0495606_0057850 3300046507 Bacteria 2495
303 Ga0495606_0062785 3300046507 Bacteria 2370
304 Ga0495606_0071636 3300046507 Bacteria 2181
305 Ga0495606_0086105 3300046507 Bacteria 1943
306 Ga0495606_0131154 3300046507 Bacteria 1490
307 Ga0495610_0000001 3300046512 Bacteria 1620061
308 Ga0495610_0000270 3300046512 Bacteria 54119
309 Ga0495610_0005278 3300046512 Bacteria 9242
310 Ga0495616_0002714 3300046513 Bacteria 11592
311 Ga0495616_0005722 3300046513 Bacteria 7611
312 Ga0495631_0008541 3300046518 Bacteria 5156
313 Ga0495632_0004364 3300046519 Bacteria 9625
314 Ga0495632_0031545 3300046519 Bacteria 2738
315 Ga0495632_0051226 3300046519 Bacteria 2033
316 Ga0495643_0009897 3300046522 Bacteria 5895
317 Ga0495643_0013032 3300046522 Bacteria 4995
318 Ga0495648_0055728 3300046524 Bacteria 2382
319 Ga0495609_0001316 3300046538 Bacteria 16887
320 Ga0495633_0000027 3300046558 Bacteria 204613
321 Ga0495633_0000989 3300046558 Bacteria 23337
322 Ga0495668_0000010 3300046616 Bacteria 487308
323 Ga0495668_0000868 3300046616 Bacteria 34090
324 Ga0495668_0001302 3300046616 Bacteria 24603
325 Ga0495668_0002482 3300046616 Bacteria 15145
326 Ga0495668_0049902 3300046616 Bacteria 2321
327 Ga0495611_0000367 3300046648 Bacteria 29199
328 Ga0495611_0002844 3300046648 Bacteria 7735
329 Ga0495625_0000105 3300046660 Bacteria 126078
330 Ga0495625_0000336 3300046660 Bacteria 71606
331 Ga0495625_0000576 3300046660 Bacteria 53723
332 Ga0495625_0001723 3300046660 Bacteria 25395
333 Ga0495625_0002615 3300046660 Bacteria 19267
334 Ga0495625_0015147 3300046660 Bacteria 6119
335 Ga0495625_0021529 3300046660 Bacteria 4963
336 Ga0495625_0049036 3300046660 Bacteria 3037
337 Ga0495625_0070968 3300046660 Bacteria 2445
338 Ga0495661_0010423 3300046665 Bacteria 6341
339 Ga0495661_0011915 3300046665 Bacteria 5886
340 Ga0495661_0012118 3300046665 Bacteria 5828
341 Ga0495661_0066423 3300046665 Bacteria 2123
342 Ga0495671_0249217 3300046692 Bacteria 857
343 Ga0495649_0000011 3300046694 Bacteria 416695
344 Ga0495649_0018051 3300046694 Bacteria 3975
345 Ga0495660_0099070 3300046810 Bacteria 1503
346 Ga0495672_0010459 3300047320 Bacteria 6607
347 Ga0495672_0169917 3300047320 Bacteria 1113
348 Ga0495687_000119 3300047443 Bacteria 121587
349 Ga0495687_014055 3300047443 Bacteria 4141
350 Ga0495687_040764 3300047443 Bacteria 2043
351 Ga0495679_047103 3300047446 Bacteria 1309
352 Ga0495673_0064575 3300047469 Bacteria 1556
353 Ga0495686_0000022 3300047472 Bacteria 403456
354 Ga0495686_0000040 3300047472 Bacteria 301210
355 Ga0495686_0000436 3300047472 Bacteria 64423
356 Ga0495686_0042448 3300047472 Bacteria 2892
357 Ga0495686_0050475 3300047472 Bacteria 2614
358 Ga0495686_0071290 3300047472 Bacteria 2139
359 Ga0495686_0090271 3300047472 Bacteria 1861
360 Ga0495686_0200620 3300047472 Bacteria 1145
361 Ga0496115_0011831 3300048918 Bacteria 6554
362 Ga0496115_0082250 3300048918 Bacteria 2623
363 Ga0496121_0033049 3300048924 Bacteria 4690
364 Ga0496123_0005589 3300048926 Bacteria 12567
365 Ga0496125_0038126 3300048928 Bacteria 4166
366 Ga0495678_018291 3300049459 Bacteria 3154
367 Ga0495678_036720 3300049459 Bacteria 1997
368 Ga0501034_0202451 3300049571 Bacteria 1943
369 Ga0501217_011844 3300049661 Bacteria 1935
370 Ga0501249_070965 3300049679 Bacteria 814
371 Ga0501241_000016 3300049758 Bacteria 99183
372 Ga0501241_019001 3300049758 Bacteria 1260
373 Ga0501266_000006 3300049763 Bacteria 312183
374 nmdc:mga0k408_166_c1 3300050493 Bacteria 34700
375 nmdc:mga0k408_230160_c1 3300050493 Bacteria 1106
376 Ga0500635_0000259 3300053080 Bacteria 21533
377 Ga0500578_0000003 3300053086 Bacteria 266033
378 Ga0500646_0009837 3300053090 Bacteria 2448
379 Ga0500583_0059932 3300053092 Bacteria 1793
380 Ga0500651_0150849 3300053093 Bacteria 1396
381 Ga0500641_0000014 3300053096 Bacteria 150696
382 Ga0500641_0000194 3300053096 Bacteria 22870
383 Ga0500650_0151538 3300053098 Bacteria 1072
384 Ga0500556_0040033 3300053104 Bacteria 1646
385 Ga0500556_0131829 3300053104 Bacteria 980
386 Ga0500607_108275 3300053121 Bacteria 1367
387 Ga0500618_000050 3300053125 Bacteria 105238
388 Ga0500618_008404 3300053125 Bacteria 2882
389 Ga0500618_042531 3300053125 Bacteria 1040
390 Ga0500642_0031296 3300053130 Bacteria 2222
391 Ga0500642_0061993 3300053130 Bacteria 1682
392 Ga0500652_010533 3300053131 Bacteria 3172
393 Ga0500658_0000007 3300053134 Bacteria 284115
394 Ga0500658_0001696 3300053134 Bacteria 8727
395 Ga0500568_0025004 3300053139 Bacteria 2523
396 Ga0500568_0034953 3300053139 Bacteria 2053
397 Ga0500577_0002919 3300053142 Bacteria 4400
398 Ga0500604_0098621 3300053151 Bacteria 961
399 Ga0500616_0000004 3300053153 Bacteria 1002714
400 Ga0500616_0000445 3300053153 Bacteria 54193
401 Ga0500616_0006531 3300053153 Bacteria 7620
402 Ga0500622_0000003 3300053156 Bacteria 613483
403 Ga0500622_0000008 3300053156 Bacteria 423636
404 Ga0500622_0000072 3300053156 Bacteria 112062
405 Ga0500622_0000340 3300053156 Bacteria 45986
406 Ga0500622_0000519 3300053156 Bacteria 35764
407 Ga0500622_0001283 3300053156 Bacteria 20459
408 Ga0500622_0002440 3300053156 Bacteria 13425
409 Ga0500622_0076451 3300053156 Bacteria 1683
410 Ga0500661_002591 3300055283 Bacteria 3414
411 2588234428 2585428187 Bacteria 4629388
412 2644013193 2643221600 Bacteria 5530138
413 2644373494 2643221667 Bacteria 5627472
414 2739589207 2739367651 Bacteria 6359826
415 2740003908 2739367857 Bacteria 5433684
416 2740008725 2739367858 Bacteria 5432813
417 2842087975 2842083920 Bacteria 4857652
418 2842727822 2842722452 Bacteria 6263924
419 2842905709 2842903701 Bacteria 6986368
420 2842906463 2842903701 Bacteria 6986368
421 2842914772 2842909656 Bacteria 6185908
422 2857620678 2857618242 Bacteria 5635925
423 2884795875 2884791551 Bacteria 8511252
424 2919438390 2919437846 Bacteria 6199444
425 2929158391 2929154850 Bacteria 6753285
426 2929182088 2929177148 Bacteria 7883697
427 2929245089 2929239360 Bacteria 7745570
428 2929925837 2929921140 Bacteria 8649150
429 2945928303 2945924605 Bacteria 4296724
430 2945978019 2945977869 Bacteria 7777518
431 2946002617 2945997725 Bacteria 6404843
432 2946016127 2946013367 Bacteria 7766675
433 2954019517 2954016120 Bacteria 6446024
434 Ga0495606_0000213
435 JGI24739J22299_10027029
436 JGI25156J39149_1001620
437 JGI25162J39368_1000055
438 JGI25162J39368_1000210
439 JGI25154J39366_1006754
440 JGI25157J39369_1001095
441 JGI25164J39214_1000004
442 JGI25165J46597_1000271
443 JGI25153J46596_10040178
444 rootH1_10157952
445 rootH2_10001891
446 rootH2_10086563
447 rootL2_10028591
448 rootL2_10123493
449 rootH1_10056276
450 rootH1_10149492
451 rootH1_10268945
452 rootH1_10320927
453 Ga0055527_1000640
454 Ga0055535_1001173
455 Ga0055542_1000380
456 Ga0055529_1000102
457 Ga0055526_1012703
458 Ga0055526_1014591
459 Ga0055528_1000391
460 Ga0055530_10031035
461 Ga0055543_1015036
462 Ga0065165_1000105
463 Ga0065714_10004922
464 Ga0065714_10006272
465 Ga0065714_10069735
466 Ga0070658_10021729
467 Ga0070683_100125441
468 Ga0070670_100043466
469 Ga0068869_100015189
470 Ga0070666_10000227
471 Ga0070666_10009847
472 Ga0070680_100054282
473 Ga0070692_10120311
474 Ga0070671_100259801
475 Ga0070673_100282917
476 Ga0070667_100196409
477 Ga0070685_10056843
478 Ga0070679_100089011
479 Ga0070679_100588985
480 Ga0068853_100011474
481 Ga0068853_100071474
482 Ga0070693_100240237
483 Ga0070665_100000002
484 Ga0068855_100001481
485 Ga0068854_100043710
486 Ga0068856_100030466
487 Ga0068852_100002150
488 Ga0068852_100086446
489 Ga0068859_100000025
490 Ga0068864_100016328
491 Ga0068864_100023718
492 Ga0068851_10026696
493 Ga0068863_100002521
494 Ga0068863_100038360
495 Ga0068863_100494530
496 Ga0068858_100033520
497 Ga0068858_100115195
498 Ga0068860_100007781
499 Ga0068860_100014670
500 Ga0075366_10000275
501 Ga0097621_100066713
502 Ga0097621_100101438
503 Ga0068871_100026828
504 Ga0068871_100124553
505 Ga0068865_100069462
506 Ga0097620_100000025
507 Ga0105251_10176583
508 Ga0105244_10171394
509 Ga0105240_10000020
510 Ga0105240_10000039
511 Ga0105240_10000576
512 Ga0105240_10025526
513 Ga0105240_10060481
514 Ga0105240_10215431
515 Ga0105240_10306916
516 Ga0105240_10467295
517 Ga0105240_10702147
518 Ga0105245_10509172
519 Ga0105247_10042924
520 Ga0105243_10000106
521 Ga0105241_10002512
522 Ga0105241_10002757
523 Ga0105241_10029193
524 Ga0105241_10338206
525 Ga0105242_10026577
526 Ga0105237_10001824
527 Ga0105237_10008413
528 Ga0105237_10010367
529 Ga0105237_10011407
530 Ga0105237_10048619
531 Ga0105237_10278764
532 Ga0105237_10406091
533 Ga0105238_10038275
534 Ga0105238_10117486
535 Ga0105238_10588685
536 Ga0105249_10036891
537 Ga0105239_10000327
538 Ga0105239_10001551
539 Ga0105239_10004235
540 Ga0105239_10040903
541 Ga0105239_10451736
542 Ga0105239_10552410
543 Ga0105246_10010971
544 Ga0105246_10021367
545 Ga0157373_10013752
546 Ga0157373_10022368
547 Ga0157373_10115029
548 Ga0157373_10536098
549 Ga0157371_10000027
550 Ga0157371_10026500
551 Ga0157371_10119749
552 Ga0157371_10286533
553 Ga0157370_10000018
554 Ga0157370_10000463
555 Ga0157370_10007731
556 Ga0157370_10027024
557 Ga0157370_10052595
558 Ga0157370_10063029
559 Ga0157370_10510155
560 Ga0157370_10680710
561 Ga0157369_10000117
562 Ga0157369_10028212
563 Ga0157369_10245159
564 Ga0157374_10560096
565 Ga0157378_10028996
566 Ga0157378_10050064
567 Ga0157378_10135269
568 Ga0157378_10617764
569 Ga0163162_10000223
570 Ga0163162_10007860
571 Ga0163162_10021145
572 Ga0163162_10032157
573 Ga0163162_10109180
574 Ga0157372_10012300
575 Ga0157372_10241485
576 Ga0157372_10425652
577 Ga0157372_10620678
578 Ga0157372_10813898
579 Ga0157372_10838585
580 Ga0157375_10031268
581 Ga0157375_10175023
582 Ga0163163_10053200
583 Ga0163163_10454314
584 Ga0157380_10518482
585 Ga0182008_10000791
586 Ga0157379_10073497
587 Ga0157376_10014068
588 Ga0182006_1000110
589 Ga0182007_10000007
590 Ga0163161_10164601
591 Ga0209672_100084
592 Ga0209563_105966
593 Ga0207427_100031
594 Ga0209437_100061
595 Ga0209437_100130
596 Ga0209258_100188
597 Ga0209646_1000628
598 Ga0209026_1000766
599 Ga0209148_1000063
600 Ga0209759_1000137
601 Ga0209233_1000076
602 Ga0209455_1000165
603 Ga0209455_1003239
604 Ga0209673_1000034
605 Ga0209564_1002305
606 Ga0209564_1002330
607 Ga0209758_1002092
608 Ga0209758_1002518
609 Ga0209050_1001344
610 Ga0207426_1038921
611 Ga0209051_1054474
612 Ga0209257_1001454
613 Ga0207656_10156746
614 Ga0207680_10000086
615 Ga0207680_10018151
616 Ga0207647_10011984
617 Ga0207647_10138971
618 Ga0207647_10219041
619 Ga0207705_10016064
620 Ga0207654_10001544
621 Ga0207654_10047062
622 Ga0207654_10331778
623 Ga0207707_10001086
624 Ga0207695_10000020
625 Ga0207695_10000058
626 Ga0207695_10000659
627 Ga0207695_10002235
628 Ga0207695_10034959
629 Ga0207695_10063167
630 Ga0207695_10075696
631 Ga0207695_10220032
632 Ga0207695_10330897
633 Ga0207695_10450271
634 Ga0207671_10000661
635 Ga0207671_10000803
636 Ga0207671_10001393
637 Ga0207671_10001892
638 Ga0207671_10005056
639 Ga0207671_10006990
640 Ga0207671_10014233
641 Ga0207660_10203240
642 Ga0207660_10265205
643 Ga0207657_10546286
644 Ga0207652_10002241
645 Ga0207652_10002817
646 Ga0207652_10006423
647 Ga0207652_10636524
648 Ga0207694_10193945
649 Ga0207650_10047591
650 Ga0207650_10224073
651 Ga0207650_10247282
652 Ga0207644_10070639
653 Ga0207709_10000077
654 Ga0207704_10091793
655 Ga0207689_10009286
656 Ga0207689_10142936
657 Ga0207661_10641830
658 Ga0207667_10000770
659 Ga0207667_10303353
660 Ga0207651_10420704
661 Ga0207640_10032756
662 Ga0207658_10204880
663 Ga0207703_10001669
664 Ga0207639_10081650
665 Ga0207639_10243027
666 Ga0207641_10000132
667 Ga0207676_10031059
668 Ga0207676_10133473
669 Ga0207698_10000907
670 Ga0207698_10931334
671 Ga0268266_10000022
672 Ga0268264_10000019
673 Ga0268264_10008648
674 Ga0307517_10020980
675 Ga0307517_10164093
676 Ga0307517_10242577
677 Ga0307515_10000076
678 Ga0307515_10000250
679 Ga0307515_10001092
680 Ga0307515_10004328
681 Ga0307515_10127864
682 Ga0307515_10150318
683 Ga0307515_10345081
684 Ga0316176_1200440
685 Ga0316183_1049060
686 Ga0316181_1185690
687 Ga0316182_1440262
688 Ga0265327_10055278
689 Ga0307513_10393412
690 Ga0307509_10138114
691 Ga0307509_10202993
692 Ga0307514_10097642
693 Ga0307405_10000047
694 Ga0307413_10005190
695 Ga0307407_10000007
696 Ga0307412_10000009
697 Ga0307412_10000485
698 Ga0307412_10046316
699 Ga0307409_100035038
700 Ga0307416_100000015
701 Ga0307414_10000468
702 Ga0307414_10000724
703 Ga0307414_10009621
704 Ga0307414_10010699
705 Ga0307411_10000011
706 Ga0307510_10008124
707 Ga0307510_10019189
708 Ga0373941_0001645
709 Ga0395899_0028497
710 Ga0395900_0019433
711 Ga0395900_0379280
712 Ga0395898_0009232
713 Ga0395898_0010842
714 Ga0395898_0056080
715 Ga0395901_0004445
716 Ga0451807_0425338
717 Ga0439445_0000394
718 Ga0466972_0000019
719 Ga0466970_0003287
720 Ga0495638_0155190
721 Ga0495651_0118657
722 Ga0495650_0000036
723 Ga0495650_0000050
724 Ga0495650_0126896
725 Ga0495605_0201838
726 Ga0495585_0000198
727 Ga0495585_0013061
728 Ga0495596_0052332
729 Ga0495583_0010021
730 Ga0495606_0004976
731 Ga0495606_0005183
732 Ga0495606_0012394
733 Ga0495606_0019677
734 Ga0495606_0050757
735 Ga0495606_0057850
736 Ga0495606_0062785
737 Ga0495606_0071636
738 Ga0495606_0086105
739 Ga0495606_0131154
740 Ga0495610_0000001
741 Ga0495610_0000270
742 Ga0495610_0005278
743 Ga0495616_0002714
744 Ga0495616_0005722
745 Ga0495631_0008541
746 Ga0495632_0004364
747 Ga0495632_0031545
748 Ga0495632_0051226
749 Ga0495643_0009897
750 Ga0495643_0013032
751 Ga0495648_0055728
752 Ga0495609_0001316
753 Ga0495633_0000027
754 Ga0495633_0000989
755 Ga0495668_0000010
756 Ga0495668_0000868
757 Ga0495668_0001302
758 Ga0495668_0002482
759 Ga0495668_0049902
760 Ga0495611_0000367
761 Ga0495611_0002844
762 Ga0495625_0000105
763 Ga0495625_0000336
764 Ga0495625_0000576
765 Ga0495625_0001723
766 Ga0495625_0002615
767 Ga0495625_0015147
768 Ga0495625_0021529
769 Ga0495625_0049036
770 Ga0495625_0070968
771 Ga0495661_0010423
772 Ga0495661_0011915
773 Ga0495661_0012118
774 Ga0495661_0066423
775 Ga0495671_0249217
776 Ga0495649_0000011
777 Ga0495649_0018051
778 Ga0495660_0099070
779 Ga0495672_0010459
780 Ga0495672_0169917
781 Ga0495687_000119
782 Ga0495687_014055
783 Ga0495687_040764
784 Ga0495679_047103
785 Ga0495673_0064575
786 Ga0495686_0000022
787 Ga0495686_0000040
788 Ga0495686_0000436
789 Ga0495686_0042448
790 Ga0495686_0050475
791 Ga0495686_0071290
792 Ga0495686_0090271
793 Ga0495686_0200620
794 Ga0496115_0011831
795 Ga0496115_0082250
796 Ga0496121_0033049
797 Ga0496123_0005589
798 Ga0496125_0038126
799 Ga0495678_018291
800 Ga0495678_036720
801 Ga0501034_0202451
802 Ga0501217_011844
803 Ga0501249_070965
804 Ga0501241_000016
805 Ga0501241_019001
806 Ga0501266_000006
807 nmdc:mga0k408_166_c1
808 nmdc:mga0k408_230160_c1
809 Ga0500635_0000259
810 Ga0500578_0000003
811 Ga0500646_0009837
812 Ga0500583_0059932
813 Ga0500651_0150849
814 Ga0500641_0000014
815 Ga0500641_0000194
816 Ga0500650_0151538
817 Ga0500556_0040033
818 Ga0500556_0131829
819 Ga0500607_108275
820 Ga0500618_000050
821 Ga0500618_008404
822 Ga0500618_042531
823 Ga0500642_0031296
824 Ga0500642_0061993
825 Ga0500652_010533
826 Ga0500658_0000007
827 Ga0500658_0001696
828 Ga0500568_0025004
829 Ga0500568_0034953
830 Ga0500577_0002919
831 Ga0500604_0098621
832 Ga0500616_0000004
833 Ga0500616_0000445
834 Ga0500616_0006531
835 Ga0500622_0000003
836 Ga0500622_0000008
837 Ga0500622_0000072
838 Ga0500622_0000340
839 Ga0500622_0000519
840 Ga0500622_0001283
841 Ga0500622_0002440
842 Ga0500622_0076451
843 Ga0500661_002591
844 2588234428
845 2644013193
846 2644373494
847 2739589207
848 2740003908
849 2740008725
850 2842087975
851 2842727822
852 2842905709
853 2842906463
854 2842914772
855 2857620678
856 2884795875
857 2919438390
858 2929158391
859 2929182088
860 2929245089
861 2929925837
862 2945928303
863 2945978019
864 2946002617
865 2946016127
866 2954019517

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

41

229

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

47

280

0.95

PF08659

KR

KR domain

42

212

0.89

PF23441

34

282

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bmn-assembly1.cif.gz_B apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9833 2 251
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.981 2 251
4bms-assembly1.cif.gz_B short chain alcohol dehydrogenase from ralstonia sp. dsm 6428 in complex with nadph 0.9787 2 251
4bms-assembly1.cif.gz_A short chain alcohol dehydrogenase from ralstonia sp. dsm 6428 in complex with nadph 0.9787 2 251
4bms-assembly1.cif.gz_C short chain alcohol dehydrogenase from ralstonia sp. dsm 6428 in complex with nadph 0.9775 2 251
ID Description Score Start End Superfamily
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9564 2 83 3.40.50.720
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9538 2 251 3.40.50.720
af_I6YEB6_2_251_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9484 1 249 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9473 3 182 3.40.50.720
4mowD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9443 1 248 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2P8GI34-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9989 2 255 GO:0016491
AF-A0A2P8GI34-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9911 2 255 GO:0016491
AF-A0A4V1V1J7-F1-model_v4 SDR family oxidoreductase 0.9892 64 253 GO:0016491
AF-A0A1T5HJW0-F1-model_v4 Enoyl-(Acyl carrier protein) reductase 0.9854 99 253 GO:0016616
AF-A0A5B8VSS9-F1-model_v4 Glucose 1-dehydrogenase (EC 1.1.1.47) 0.985 2 253 GO:0047936

Map