F443161

General Info

Members Datasets Scaffolds Average Seq Length
434 267 868 506

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0000109|Ga0495606_0000109_53809_55554
Length 581
Sequence MTPVIFIDNVLPRAVSRSSVAFNRTDIAVADHSGASFVFAIDAIATNDWMVRRHPFTMRSAPAGCIRQEQTLNKTTLRRLAFALASAFVGATLAQETHLTTDGGAPVGDNQNSQTAGGAGPVLLQDSHLIEKLQRFDRERIPERVVHARGTGAFGTFTPTGDVGDLTRAKVFAAGTSTPVFVRFSTVMGYRGSPEQARDPRGFAIKFYTKDGNWDMVGINWPIFFIRDAIKFPDFVHANKPSAETGVQDPELAFDFFGHTPEATNMLTHLYTVEGMPDSYRHMDGFAVHAFKFVNAAGDVHYVKFHWKSLQGIHGFHPNDIGPSIGKDWNLMTNDLYGAIKRGDDPKWELYVQVLTPAEVASKFDFDALDDTKVWTGVPERKIGTMTLNRVPDNYFETTEESAFAPSRLVPGIEPSEDRMLQGRLFAYADTQMYRIGANYNSLPINRTMVEVNNEDQDGAMNSSGRKGETNYEPSGVHEVSQDVSAKSVRMPLTGTTQQEATTKPRNFFQAGEYYRSLSAQDKSDLVTALSGDLSHVRTQDNLYRMLSYFYRADHDYGERLTKAVHGEIARVKTMSDALQD

Samples

Sample ID Description Type Environment
1 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
15 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
26 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
27 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
28 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
29 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
30 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
38 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
39 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
40 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
45 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
46 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
48 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
49 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
51 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
52 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
72 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
75 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
76 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
77 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
78 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
79 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
80 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
83 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
86 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
87 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
88 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
89 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
90 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
91 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
94 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
95 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
96 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
97 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
98 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
99 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
100 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
103 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
104 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
105 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
106 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
109 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
110 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
120 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
121 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
122 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
123 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
126 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
127 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
128 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
132 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
135 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
138 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
143 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
152 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
153 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
154 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
155 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
158 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
163 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
164 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
165 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
166 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
167 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
168 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
169 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
170 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
171 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
172 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
173 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
174 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
175 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
176 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
177 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
178 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
179 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
180 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
181 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
182 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
183 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
184 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
185 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
186 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
187 2643221729 Bacillus sp. Root11 Isolate Unclassified
188 2643221730 Bacillus sp. Root131 Isolate Unclassified
189 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
190 2671180694 Paenibacillus sp. A3 Isolate Unclassified
191 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
192 2684622632 Bacillus cereus 905 Isolate Unclassified
193 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
194 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
195 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
196 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
197 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
198 2738541358 Bacillus sp. OV752 Isolate Unclassified
199 2738543006 Bacillus sp. OK077 Isolate Unclassified
200 2738543017 Bacillus sp. OV186 Isolate Unclassified
201 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
202 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
203 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
204 2765235841 Pseudomonas putida AA7 Isolate Unclassified
205 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
206 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
207 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
208 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
209 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
210 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
211 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
212 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
213 2818991452 Burkholderia cepacia 561 Isolate Unclassified
214 2818991459 Paenibacillus sp. 597 Isolate Unclassified
215 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
216 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
217 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
218 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
219 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
220 2857586860 Bacillus sp. R-71935 Isolate Unclassified
221 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
222 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
223 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
224 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
225 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
226 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
227 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
228 2904564687 Burkholderia sp. 571 Isolate Unclassified
229 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
230 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
231 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
232 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
233 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
234 2919476304 Duganella sp. 3397 Isolate Unclassified
235 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
236 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
237 2928170801 Burkholderia sp. 572 Isolate Unclassified
238 2928536128 Burkholderia sola 565 Isolate Unclassified
239 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
240 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
241 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
242 2938917290 Bacillus sp. CR71 Isolate Unclassified
243 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
244 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
245 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
246 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
247 2965761152 Bacillus sp. COPE52 Isolate Unclassified
248 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
249 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
250 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
251 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
252 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
253 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
254 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
255 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
256 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
257 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
258 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
259 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
260 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
261 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
262 8022792930 Bacillus sp. Xin Isolate Rhizosphere
263 8023438354 Bacillus sp. BH2 Isolate Unclassified
264 8023444577 Bacillus sp. BH32 Isolate Unclassified
265 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
266 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
267 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.35
Metatranscriptomes 0
Isolates 24.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.21
Nodule 1.15
Rhizoplane 3.92
Rhizosphere 58.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495606_0000109 3300046507 Bacteria 139572
2 JGI25156J39149_1000788 3300002705 Bacteria 16328
3 JGI25162J39368_1001258 3300002737 Bacteria 14480
4 JGI25154J39366_1004080 3300002738 Bacteria 2759
5 JGI25157J39369_1000195 3300002741 Bacteria 51278
6 JGI25164J39214_1000024 3300002772 Bacteria 165608
7 JGI25159J45721_1001389 3300002987 Bacteria 10070
8 JGI25151J46595_10002982 3300003187 Bacteria 9658
9 JGI25151J46595_10007798 3300003187 Bacteria 5206
10 JGI25151J46595_10010931 3300003187 Bacteria 4195
11 JGI25151J46595_10012138 3300003187 Bacteria 3927
12 JGI25151J46595_10032541 3300003187 Bacteria 2020
13 JGI25165J46597_1000394 3300003214 Bacteria 46232
14 rootH2_10044766 3300003320 Bacteria 10811
15 rootL2_10182964 3300003322 Bacteria 4130
16 rootH1_10054039 3300003323 Bacteria 2849
17 rootH1_10158736 3300003323 Bacteria 5254
18 Ga0055538_1000163 3300003751 Bacteria 43881
19 Ga0055532_1000223 3300003758 Bacteria 42993
20 Ga0055532_1000503 3300003758 Bacteria 17081
21 Ga0055527_1001482 3300003760 Bacteria 4898
22 Ga0055535_1000573 3300003761 Bacteria 30989
23 Ga0055535_1001072 3300003761 Bacteria 16843
24 Ga0055542_1000596 3300003762 Bacteria 30989
25 Ga0055542_1001359 3300003762 Bacteria 12575
26 Ga0055529_1000387 3300003763 Bacteria 47628
27 Ga0055529_1000560 3300003763 Bacteria 30989
28 Ga0055528_1006101 3300003790 Bacteria 5507
29 Ga0058692_1006574 3300003856 Bacteria 3170
30 Ga0070682_100000265 3300005337 Bacteria 37628
31 Ga0070660_100064467 3300005339 Bacteria 2850
32 Ga0070659_100059908 3300005366 Bacteria 3006
33 Ga0070662_100159974 3300005457 Bacteria 1761
34 Ga0075432_10026526 3300006058 Bacteria 1991
35 Ga0079104_1009191 3300006946 Bacteria 3369
36 Ga0099795_10004445 3300007788 Bacteria 3617
37 Ga0105251_10005566 3300009011 Bacteria 8194
38 Ga0105251_10008068 3300009011 Bacteria 6380
39 Ga0105251_10021046 3300009011 Bacteria 3413
40 Ga0105251_10040883 3300009011 Bacteria 2259
41 Ga0105244_10003415 3300009036 Bacteria 11324
42 Ga0105244_10006167 3300009036 Bacteria 7821
43 Ga0105244_10051765 3300009036 Bacteria 2092
44 Ga0105250_10002522 3300009092 Bacteria 9177
45 Ga0105250_10003581 3300009092 Bacteria 7316
46 Ga0105250_10034970 3300009092 Bacteria 2016
47 Ga0105240_10004281 3300009093 Bacteria 21805
48 Ga0105240_10007158 3300009093 Bacteria 16255
49 Ga0105240_10007791 3300009093 Bacteria 15478
50 Ga0105249_10144247 3300009553 Bacteria 2286
51 Ga0099796_10000063 3300010159 Bacteria 19147
52 Ga0105239_10000405 3300010375 Bacteria 63265
53 Ga0105239_10142654 3300010375 Bacteria 2670
54 Ga0105246_10000142 3300011119 Bacteria 33547
55 Ga0105246_10040997 3300011119 Bacteria 3128
56 Ga0157370_10033964 3300013104 Bacteria 4969
57 Ga0182006_1006623 3300015261 Bacteria 5365
58 Ga0182007_10000578 3300015262 Bacteria 21520
59 Ga0213872_10005419 3300021361 Bacteria 6571
60 Ga0209566_100769 3300025225 Bacteria 17231
61 Ga0209674_100865 3300025226 Bacteria 9943
62 Ga0209672_100050 3300025228 Bacteria 238103
63 Ga0209672_100168 3300025228 Bacteria 55336
64 Ga0209147_100021 3300025229 Bacteria 464719
65 Ga0209147_100028 3300025229 Bacteria 383994
66 Ga0209147_100075 3300025229 Bacteria 208215
67 Ga0209147_104291 3300025229 Bacteria 2426
68 Ga0207427_100058 3300025231 Bacteria 192979
69 Ga0209437_100142 3300025233 Bacteria 165628
70 Ga0209258_100307 3300025242 Bacteria 77305
71 Ga0209258_100394 3300025242 Bacteria 55089
72 Ga0209646_1000431 3300025246 Bacteria 23248
73 Ga0209026_1000568 3300025250 Bacteria 24797
74 Ga0209148_1000231 3300025254 Bacteria 91560
75 Ga0209148_1000371 3300025254 Bacteria 55165
76 Ga0209759_1001237 3300025256 Bacteria 15586
77 Ga0209233_1000141 3300025261 Bacteria 192978
78 Ga0209565_1010205 3300025263 Bacteria 2339
79 Ga0209455_1000040 3300025272 Bacteria 430197
80 Ga0209455_1000139 3300025272 Bacteria 138993
81 Ga0209455_1000296 3300025272 Bacteria 51780
82 Ga0209673_1000028 3300025273 Bacteria 358901
83 Ga0209673_1001007 3300025273 Bacteria 34141
84 Ga0209130_1000999 3300025284 Bacteria 22040
85 Ga0209130_1001538 3300025284 Bacteria 14745
86 Ga0209675_1010554 3300025291 Bacteria 3141
87 Ga0209675_1016395 3300025291 Bacteria 2159
88 Ga0209676_1001534 3300025292 Bacteria 20949
89 Ga0209025_1000209 3300025294 Bacteria 140401
90 Ga0209025_1000352 3300025294 Bacteria 99568
91 Ga0209025_1000599 3300025294 Bacteria 65048
92 Ga0209025_1002246 3300025294 Bacteria 21254
93 Ga0209025_1003899 3300025294 Bacteria 13449
94 Ga0209025_1004150 3300025294 Bacteria 12848
95 Ga0209025_1004746 3300025294 Bacteria 11568
96 Ga0209025_1005006 3300025294 Bacteria 11068
97 Ga0209025_1007320 3300025294 Bacteria 8272
98 Ga0209025_1007459 3300025294 Bacteria 8138
99 Ga0209025_1007642 3300025294 Bacteria 7994
100 Ga0209025_1008071 3300025294 Bacteria 7664
101 Ga0209025_1024702 3300025294 Bacteria 3092
102 Ga0209025_1024768 3300025294 Bacteria 3085
103 Ga0209025_1029040 3300025294 Bacteria 2690
104 Ga0209564_1004648 3300025295 Bacteria 8254
105 Ga0209564_1008614 3300025295 Bacteria 5000
106 Ga0207696_1001847 3300025711 Bacteria 10883
107 Ga0207696_1004049 3300025711 Bacteria 6424
108 Ga0207696_1007350 3300025711 Bacteria 4323
109 Ga0207655_1031141 3300025728 Bacteria 2465
110 Ga0207713_1015746 3300025735 Bacteria 3865
111 Ga0207705_10075277 3300025909 Bacteria 2452
112 Ga0207695_10000203 3300025913 Bacteria 163681
113 Ga0207695_10000273 3300025913 Bacteria 129404
114 Ga0207695_10000649 3300025913 Bacteria 69041
115 Ga0207695_10001466 3300025913 Bacteria 39517
116 Ga0207657_10033886 3300025919 Bacteria 4598
117 Ga0207690_10028257 3300025932 Bacteria 3554
118 Ga0207706_10118643 3300025933 Bacteria 2326
119 Ga0209371_1000172 3300027312 Bacteria 96352
120 Ga0209371_1000359 3300027312 Bacteria 49211
121 Ga0209371_1007194 3300027312 Bacteria 3931
122 Ga0209371_1007415 3300027312 Bacteria 3830
123 Ga0209179_1003131 3300027512 Bacteria 2343
124 Ga0209588_1012173 3300027671 Bacteria 2609
125 Ga0237817_10129 3300030083 Bacteria 22974
126 Ga0237817_10278 3300030083 Bacteria 11628
127 Ga0268256_1000144 3300030500 Bacteria 96352
128 Ga0268256_1000305 3300030500 Bacteria 49210
129 Ga0268256_1000957 3300030500 Bacteria 19653
130 Ga0268256_1007514 3300030500 Bacteria 3868
131 Ga0307408_100001913 3300031548 Bacteria 15131
132 Ga0307408_100045697 3300031548 Bacteria 3129
133 Ga0237819_00064 3300038705 Bacteria 37828
134 Ga0237819_00563 3300038705 Bacteria 12490
135 Ga0436361_1141444 3300039447 Bacteria 7187
136 Ga0439436_0004422 3300041404 Bacteria 4303
137 Ga0439456_000030 3300042013 Bacteria 53580
138 Ga0466966_0068463 3300044684 Bacteria 2228
139 Ga0466961_0015198 3300044693 Bacteria 4943
140 Ga0466964_0000053 3300044706 Bacteria 24809
141 Ga0466967_0003845 3300045976 Bacteria 9948
142 Ga0495603_0000336 3300046455 Bacteria 25211
143 Ga0495603_0005810 3300046455 Bacteria 7380
144 Ga0495590_0012964 3300046457 Bacteria 3076
145 Ga0495629_0000047 3300046459 Bacteria 109814
146 Ga0495629_0005780 3300046459 Bacteria 9224
147 Ga0495629_0009285 3300046459 Bacteria 7195
148 Ga0495638_0032916 3300046460 Bacteria 3318
149 Ga0495641_0037953 3300046461 Bacteria 2253
150 Ga0495653_0000049 3300046463 Bacteria 108478
151 Ga0495653_0057624 3300046463 Bacteria 2956
152 Ga0495653_0080076 3300046463 Bacteria 2417
153 Ga0495653_0099539 3300046463 Bacteria 2109
154 Ga0495650_0001242 3300046471 Bacteria 26455
155 Ga0495580_0002668 3300046472 Bacteria 15482
156 Ga0495580_0003082 3300046472 Bacteria 14280
157 Ga0495580_0005155 3300046472 Bacteria 10871
158 Ga0495580_0008504 3300046472 Bacteria 8160
159 Ga0495580_0009729 3300046472 Bacteria 7541
160 Ga0495580_0014184 3300046472 Bacteria 6052
161 Ga0495582_0002543 3300046473 Bacteria 10154
162 Ga0495582_0103105 3300046473 Bacteria 1598
163 Ga0495605_0006252 3300046474 Bacteria 6866
164 Ga0495605_0035488 3300046474 Bacteria 2520
165 Ga0495664_0105116 3300046477 Bacteria 1702
166 Ga0495594_0081577 3300046499 Bacteria 1806
167 Ga0495596_0002968 3300046500 Bacteria 8799
168 Ga0495607_0000065 3300046501 Bacteria 104510
169 Ga0495607_0003754 3300046501 Bacteria 11487
170 Ga0495583_0001017 3300046506 Bacteria 31984
171 Ga0495583_0005648 3300046506 Bacteria 8424
172 Ga0495606_0000295 3300046507 Bacteria 85796
173 Ga0495606_0001501 3300046507 Bacteria 31006
174 Ga0495606_0014956 3300046507 Bacteria 6018
175 Ga0495606_0049779 3300046507 Bacteria 2745
176 Ga0495608_0086403 3300046511 Bacteria 2032
177 Ga0495610_0000080 3300046512 Bacteria 114528
178 Ga0495618_0002925 3300046514 Bacteria 10821
179 Ga0495620_0000067 3300046515 Bacteria 87838
180 Ga0495620_0000149 3300046515 Bacteria 57195
181 Ga0495620_0000483 3300046515 Bacteria 25857
182 Ga0495620_0008064 3300046515 Bacteria 5669
183 Ga0495620_0018312 3300046515 Bacteria 3470
184 Ga0495620_0038407 3300046515 Bacteria 2125
185 Ga0495628_0001283 3300046516 Bacteria 23003
186 Ga0495628_0006105 3300046516 Bacteria 10536
187 Ga0495628_0097068 3300046516 Bacteria 2276
188 Ga0495630_0024445 3300046517 Bacteria 4467
189 Ga0495630_0030385 3300046517 Bacteria 4018
190 Ga0495630_0082211 3300046517 Bacteria 2431
191 Ga0495631_0000312 3300046518 Bacteria 33630
192 Ga0495631_0000701 3300046518 Bacteria 21664
193 Ga0495632_0000011 3300046519 Bacteria 266804
194 Ga0495632_0004197 3300046519 Bacteria 9851
195 Ga0495648_0000085 3300046524 Bacteria 119901
196 Ga0495648_0004499 3300046524 Bacteria 11897
197 Ga0495648_0007702 3300046524 Bacteria 8587
198 Ga0495648_0024645 3300046524 Bacteria 4090
199 Ga0495648_0046943 3300046524 Bacteria 2674
200 Ga0495648_0071294 3300046524 Bacteria 2015
201 Ga0495666_0006141 3300046526 Bacteria 6045
202 Ga0495666_0025751 3300046526 Bacteria 2904
203 Ga0495666_0029711 3300046526 Bacteria 2688
204 Ga0495652_0001537 3300046529 Bacteria 25329
205 Ga0495652_0015142 3300046529 Bacteria 6906
206 Ga0495654_0001848 3300046530 Bacteria 14113
207 Ga0495654_0004688 3300046530 Bacteria 8055
208 Ga0495665_0000289 3300046531 Bacteria 25499
209 Ga0495640_0003082 3300046533 Bacteria 13435
210 Ga0495586_0000513 3300046535 Bacteria 22869
211 Ga0495586_0021584 3300046535 Bacteria 3433
212 Ga0495587_0016083 3300046536 Bacteria 4657
213 Ga0495587_0016727 3300046536 Bacteria 4561
214 Ga0495645_0016418 3300046543 Bacteria 5285
215 Ga0495645_0144052 3300046543 Bacteria 1660
216 Ga0495622_0010302 3300046557 Bacteria 4322
217 Ga0495668_0003007 3300046616 Bacteria 13158
218 Ga0495668_0022579 3300046616 Bacteria 3596
219 Ga0495634_0014069 3300046642 Bacteria 5777
220 Ga0495634_0101296 3300046642 Bacteria 1860
221 Ga0495611_0000007 3300046648 Bacteria 224144
222 Ga0495635_0002414 3300046663 Bacteria 12734
223 Ga0495635_0051925 3300046663 Bacteria 2824
224 Ga0495661_0001770 3300046665 Bacteria 17370
225 Ga0495661_0008641 3300046665 Bacteria 7038
226 Ga0495661_0017694 3300046665 Bacteria 4701
227 Ga0495588_0071283 3300046674 Bacteria 1807
228 Ga0495599_0005792 3300046678 Bacteria 7416
229 Ga0495599_0066435 3300046678 Bacteria 2252
230 Ga0495623_0002748 3300046679 Bacteria 11626
231 Ga0495623_0004580 3300046679 Bacteria 9082
232 Ga0495646_0000625 3300046680 Bacteria 19306
233 Ga0495646_0001027 3300046680 Bacteria 16130
234 Ga0495613_0001717 3300046689 Bacteria 16677
235 Ga0495613_0011797 3300046689 Bacteria 6490
236 Ga0495613_0058036 3300046689 Bacteria 2841
237 Ga0495624_0000496 3300046690 Bacteria 30665
238 Ga0495624_0010851 3300046690 Bacteria 6279
239 Ga0495589_0000524 3300046794 Bacteria 26992
240 Ga0495589_0005118 3300046794 Bacteria 6937
241 Ga0495660_0006987 3300046810 Bacteria 6654
242 Ga0495581_0103147 3300047315 Bacteria 1657
243 Ga0495604_0007992 3300047317 Bacteria 8379
244 Ga0495604_0025588 3300047317 Bacteria 4701
245 Ga0495674_0001539 3300047319 Bacteria 22535
246 Ga0495674_0001583 3300047319 Bacteria 22294
247 Ga0495674_0019852 3300047319 Bacteria 6228
248 Ga0495674_0045262 3300047319 Bacteria 3907
249 Ga0495672_0000014 3300047320 Bacteria 505636
250 Ga0495672_0028870 3300047320 Bacteria 3502
251 Ga0495676_0016984 3300047321 Bacteria 6444
252 Ga0495676_0053842 3300047321 Bacteria 3203
253 Ga0495676_0103799 3300047321 Bacteria 2098
254 Ga0495680_0017919 3300047322 Bacteria 6026
255 Ga0495680_0028376 3300047322 Bacteria 4588
256 Ga0495680_0111846 3300047322 Bacteria 2023
257 Ga0495683_0001492 3300047323 Bacteria 15259
258 Ga0495683_0003962 3300047323 Bacteria 8518
259 Ga0495687_006215 3300047443 Bacteria 7372
260 Ga0495675_0024063 3300047444 Bacteria 3880
261 Ga0495679_000008 3300047446 Bacteria 367186
262 Ga0495679_001194 3300047446 Bacteria 15434
263 Ga0495679_002757 3300047446 Bacteria 8744
264 Ga0495679_004252 3300047446 Bacteria 6648
265 Ga0495673_0000197 3300047469 Bacteria 94703
266 Ga0495673_0000224 3300047469 Bacteria 83846
267 Ga0495673_0001409 3300047469 Bacteria 19281
268 Ga0495673_0008882 3300047469 Bacteria 5603
269 Ga0495686_0001906 3300047472 Bacteria 20827
270 Ga0495593_0005917 3300047673 Bacteria 7203
271 Ga0495602_0009309 3300048088 Bacteria 10222
272 Ga0495602_0024530 3300048088 Bacteria 5850
273 Ga0495602_0028114 3300048088 Bacteria 5387
274 Ga0495602_0081832 3300048088 Bacteria 2712
275 Ga0495614_0004491 3300048089 Bacteria 6294
276 Ga0495614_0006727 3300048089 Bacteria 5144
277 Ga0495626_0024988 3300048091 Bacteria 2924
278 Ga0496101_0028125 3300048904 Bacteria 3923
279 Ga0496104_0007654 3300048907 Bacteria 9564
280 Ga0496105_0000667 3300048908 Bacteria 23039
281 Ga0496105_0009074 3300048908 Bacteria 7758
282 Ga0496106_0001489 3300048909 Bacteria 17603
283 Ga0496110_0082090 3300048913 Bacteria 2874
284 Ga0496111_0088262 3300048914 Bacteria 2271
285 Ga0496115_0015014 3300048918 Bacteria 5870
286 Ga0496116_0011201 3300048919 Bacteria 7450
287 Ga0496117_0002727 3300048920 Bacteria 21678
288 Ga0496117_0017589 3300048920 Bacteria 5966
289 Ga0496118_0008642 3300048921 Bacteria 10480
290 Ga0496118_0009526 3300048921 Bacteria 9785
291 Ga0496118_0060385 3300048921 Bacteria 2815
292 Ga0496118_0087923 3300048921 Bacteria 2152
293 Ga0496119_0000029 3300048922 Bacteria 243194
294 Ga0496119_0004060 3300048922 Bacteria 14770
295 Ga0496119_0009654 3300048922 Bacteria 8226
296 Ga0496120_0000039 3300048923 Bacteria 202237
297 Ga0496120_0001639 3300048923 Bacteria 25945
298 Ga0496121_0000862 3300048924 Bacteria 54859
299 Ga0496121_0000879 3300048924 Bacteria 54392
300 Ga0496121_0006179 3300048924 Bacteria 15024
301 Ga0496121_0029604 3300048924 Bacteria 5057
302 Ga0496121_0115842 3300048924 Bacteria 2034
303 Ga0496122_0009268 3300048925 Bacteria 10409
304 Ga0496122_0096694 3300048925 Bacteria 1990
305 Ga0496123_0030834 3300048926 Bacteria 3916
306 Ga0496123_0036858 3300048926 Bacteria 3460
307 Ga0496123_0126079 3300048926 Bacteria 1429
308 Ga0496124_0007539 3300048927 Bacteria 11545
309 Ga0496124_0015002 3300048927 Bacteria 7458
310 Ga0496124_0065479 3300048927 Bacteria 3030
311 Ga0496124_0106853 3300048927 Bacteria 2259
312 Ga0496124_0179760 3300048927 Bacteria 1629
313 Ga0496125_0035224 3300048928 Bacteria 4397
314 Ga0496126_0000708 3300048929 Bacteria 60934
315 Ga0496126_0000716 3300048929 Bacteria 60249
316 Ga0496126_0002212 3300048929 Bacteria 26941
317 Ga0496126_0068501 3300048929 Bacteria 3168
318 Ga0495678_000119 3300049459 Bacteria 92516
319 Ga0495678_005336 3300049459 Bacteria 7128
320 Ga0495678_042089 3300049459 Bacteria 1823
321 Ga0495682_0005172 3300049460 Bacteria 5454
322 Ga0495682_0009428 3300049460 Bacteria 3809
323 Ga0495682_0031825 3300049460 Bacteria 1949
324 Ga0501222_000046 3300049662 Bacteria 45836
325 Ga0500618_001336 3300053125 Bacteria 11271
326 Ga0500622_0024585 3300053156 Bacteria 3185
327 Ga0500633_0010336 3300053160 Bacteria 2491
328 2501070502 2501025501 Bacteria 7768574
329 2501411447 2501025504 Bacteria 8008976
330 2511099425 2510917014 Bacteria 8296963
331 2511108888 2510917015 Bacteria 7950052
332 2513233217 2513020052 Bacteria 5120511
333 2547372390 2547132103 Bacteria 5115736
334 2553391845 2551306519 Bacteria 5465154
335 2553397345 2551306519 Bacteria 5465154
336 2563062767 2562617112 Bacteria 10918404
337 2563930514 2563366752 Bacteria 4961801
338 2585145079 2582581278 Bacteria 5296881
339 2587740607 2585428059 Bacteria 8696589
340 2588218609 2585428184 Bacteria 4978681
341 2588225713 2585428185 Bacteria 4969476
342 2595090410 2593339131 Bacteria 5116855
343 2599737504 2599185239 Bacteria 8686614
344 2599742300 2599185240 Bacteria 7968121
345 2599749133 2599185240 Bacteria 7968121
346 2600204418 2599185355 Bacteria 7968906
347 2600211256 2599185355 Bacteria 7968906
348 2601624215 2600255283 Bacteria 6061572
349 2644421859 2643221676 Bacteria 8119172
350 2644707774 2643221729 Bacteria 6621700
351 2644712194 2643221730 Bacteria 6523787
352 2673166876 2671180531 Bacteria 9045424
353 2673819934 2671180694 Bacteria 7506943
354 2676746325 2675903129 Bacteria 7964495
355 2676747414 2675903129 Bacteria 7964495
356 2685149080 2684622632 Bacteria 5380049
357 2698324102 2695420987 Bacteria 6152737
358 2705992938 2703719227 Bacteria 5631989
359 2705993116 2703719227 Bacteria 5631989
360 2713477003 2711768613 Bacteria 11048459
361 2721504462 2718218445 Bacteria 5113413
362 2738838065 2738541299 Bacteria 4020721
363 2739156597 2738541358 Bacteria 5932299
364 2739210198 2738543006 Bacteria 5904091
365 2739269608 2738543017 Bacteria 4271950
366 2745168391 2744054657 Bacteria 5016802
367 2757567162 2757320391 Bacteria 4746095
368 2765573160 2765235839 Bacteria 5314748
369 2765584583 2765235841 Bacteria 6137024
370 2777761664 2775507177 Bacteria 4384303
371 2808869939 2808606364 Bacteria 4465927
372 2808973556 2808606384 Bacteria 8474373
373 2809008405 2808606390 Bacteria 8476311
374 2809015257 2808606391 Bacteria 8308166
375 2817620886 2816332336 Bacteria 5207640
376 2819566333 2818991440 Bacteria 4774720
377 2819582890 2818991443 Bacteria 6598732
378 2819636655 2818991452 Bacteria 8442785
379 2819675814 2818991459 Bacteria 8736032
380 2842325684 2842324504 Bacteria 9364110
381 2842349963 2842348783 Bacteria 9002918
382 2842454843 2842454564 Bacteria 8730687
383 2843695734 2843690924 Bacteria 5169057
384 2852677026 2852673933 Bacteria 3347676
385 2857588765 2857586860 Bacteria 4354574
386 2863426016 2863421361 Bacteria 7300805
387 2864734659 2864733723 Bacteria 6770668
388 2870074965 2870068957 Bacteria 8925310
389 2889048284 2889042446 Bacteria 7618936
390 2889299087 2889295896 Bacteria 4704906
391 2904466609 2904463128 Bacteria 4775606
392 2904494541 2904490793 Bacteria 7046938
393 2904565388 2904564687 Bacteria 7609577
394 2904571916 2904571731 Bacteria 7608790
395 2904756124 2904755435 Bacteria 7986759
396 2907206582 2907202186 Bacteria 6632024
397 2919164309 2919160200 Bacteria 6929020
398 2919431464 2919425241 Bacteria 8055701
399 2919480054 2919476304 Bacteria 5888696
400 2919684974 2919683626 Bacteria 5534354
401 2921648102 2921643360 Bacteria 11448031
402 2928177706 2928170801 Bacteria 8785406
403 2928178272 2928170801 Bacteria 8785406
404 2928537234 2928536128 Bacteria 7657547
405 2929234351 2929233124 Bacteria 5948380
406 2931385401 2931384279 Bacteria 7299545
407 2936344638 2936340661 Bacteria 5139038
408 2938918522 2938917290 Bacteria 5914775
409 2939680425 2939679117 Bacteria 6921672
410 2945995958 2945991243 Bacteria 7008369
411 2946058663 2946053406 Bacteria 6978655
412 2947427865 2947426588 Bacteria 5357194
413 2965762371 2965761152 Bacteria 5806513
414 2979084781 2979083700 Bacteria 5894929
415 2979089599 2979083700 Bacteria 5894929
416 2981288523 2981284811 Bacteria 4641497
417 2981293344 2981289755 Bacteria 4641509
418 2981983971 2981980479 Bacteria 4641628
419 2981988894 2981985349 Bacteria 4641497
420 3006831898 3006826541 Bacteria 4678913
421 3007318071 3007315729 Bacteria 5076637
422 640489510 640427133 Bacteria 4567418
423 651177537 651053060 Bacteria 4689946
424 8018851240 8018845410 Bacteria 8933938
425 8020943960 8020938398 Bacteria 7472757
426 8020956065 8020953355 Bacteria 7439080
427 8021124542 8021120328 Bacteria 8782274
428 8022622296 8022621104 Bacteria 5241040
429 8022793471 8022792930 Bacteria 5693794
430 8023443325 8023438354 Bacteria 5779374
431 8023449373 8023444577 Bacteria 5661597
432 8054932914 8054929484 Bacteria 5599761
433 8055636021 8055632911 Bacteria 5283357
434 8057583868 8057582654 Bacteria 5218944
435 Ga0495606_0000109
436 JGI25156J39149_1000788
437 JGI25162J39368_1001258
438 JGI25154J39366_1004080
439 JGI25157J39369_1000195
440 JGI25164J39214_1000024
441 JGI25159J45721_1001389
442 JGI25151J46595_10002982
443 JGI25151J46595_10007798
444 JGI25151J46595_10010931
445 JGI25151J46595_10012138
446 JGI25151J46595_10032541
447 JGI25165J46597_1000394
448 rootH2_10044766
449 rootL2_10182964
450 rootH1_10054039
451 rootH1_10158736
452 Ga0055538_1000163
453 Ga0055532_1000223
454 Ga0055532_1000503
455 Ga0055527_1001482
456 Ga0055535_1000573
457 Ga0055535_1001072
458 Ga0055542_1000596
459 Ga0055542_1001359
460 Ga0055529_1000387
461 Ga0055529_1000560
462 Ga0055528_1006101
463 Ga0058692_1006574
464 Ga0070682_100000265
465 Ga0070660_100064467
466 Ga0070659_100059908
467 Ga0070662_100159974
468 Ga0075432_10026526
469 Ga0079104_1009191
470 Ga0099795_10004445
471 Ga0105251_10005566
472 Ga0105251_10008068
473 Ga0105251_10021046
474 Ga0105251_10040883
475 Ga0105244_10003415
476 Ga0105244_10006167
477 Ga0105244_10051765
478 Ga0105250_10002522
479 Ga0105250_10003581
480 Ga0105250_10034970
481 Ga0105240_10004281
482 Ga0105240_10007158
483 Ga0105240_10007791
484 Ga0105249_10144247
485 Ga0099796_10000063
486 Ga0105239_10000405
487 Ga0105239_10142654
488 Ga0105246_10000142
489 Ga0105246_10040997
490 Ga0157370_10033964
491 Ga0182006_1006623
492 Ga0182007_10000578
493 Ga0213872_10005419
494 Ga0209566_100769
495 Ga0209674_100865
496 Ga0209672_100050
497 Ga0209672_100168
498 Ga0209147_100021
499 Ga0209147_100028
500 Ga0209147_100075
501 Ga0209147_104291
502 Ga0207427_100058
503 Ga0209437_100142
504 Ga0209258_100307
505 Ga0209258_100394
506 Ga0209646_1000431
507 Ga0209026_1000568
508 Ga0209148_1000231
509 Ga0209148_1000371
510 Ga0209759_1001237
511 Ga0209233_1000141
512 Ga0209565_1010205
513 Ga0209455_1000040
514 Ga0209455_1000139
515 Ga0209455_1000296
516 Ga0209673_1000028
517 Ga0209673_1001007
518 Ga0209130_1000999
519 Ga0209130_1001538
520 Ga0209675_1010554
521 Ga0209675_1016395
522 Ga0209676_1001534
523 Ga0209025_1000209
524 Ga0209025_1000352
525 Ga0209025_1000599
526 Ga0209025_1002246
527 Ga0209025_1003899
528 Ga0209025_1004150
529 Ga0209025_1004746
530 Ga0209025_1005006
531 Ga0209025_1007320
532 Ga0209025_1007459
533 Ga0209025_1007642
534 Ga0209025_1008071
535 Ga0209025_1024702
536 Ga0209025_1024768
537 Ga0209025_1029040
538 Ga0209564_1004648
539 Ga0209564_1008614
540 Ga0207696_1001847
541 Ga0207696_1004049
542 Ga0207696_1007350
543 Ga0207655_1031141
544 Ga0207713_1015746
545 Ga0207705_10075277
546 Ga0207695_10000203
547 Ga0207695_10000273
548 Ga0207695_10000649
549 Ga0207695_10001466
550 Ga0207657_10033886
551 Ga0207690_10028257
552 Ga0207706_10118643
553 Ga0209371_1000172
554 Ga0209371_1000359
555 Ga0209371_1007194
556 Ga0209371_1007415
557 Ga0209179_1003131
558 Ga0209588_1012173
559 Ga0237817_10129
560 Ga0237817_10278
561 Ga0268256_1000144
562 Ga0268256_1000305
563 Ga0268256_1000957
564 Ga0268256_1007514
565 Ga0307408_100001913
566 Ga0307408_100045697
567 Ga0237819_00064
568 Ga0237819_00563
569 Ga0436361_1141444
570 Ga0439436_0004422
571 Ga0439456_000030
572 Ga0466966_0068463
573 Ga0466961_0015198
574 Ga0466964_0000053
575 Ga0466967_0003845
576 Ga0495603_0000336
577 Ga0495603_0005810
578 Ga0495590_0012964
579 Ga0495629_0000047
580 Ga0495629_0005780
581 Ga0495629_0009285
582 Ga0495638_0032916
583 Ga0495641_0037953
584 Ga0495653_0000049
585 Ga0495653_0057624
586 Ga0495653_0080076
587 Ga0495653_0099539
588 Ga0495650_0001242
589 Ga0495580_0002668
590 Ga0495580_0003082
591 Ga0495580_0005155
592 Ga0495580_0008504
593 Ga0495580_0009729
594 Ga0495580_0014184
595 Ga0495582_0002543
596 Ga0495582_0103105
597 Ga0495605_0006252
598 Ga0495605_0035488
599 Ga0495664_0105116
600 Ga0495594_0081577
601 Ga0495596_0002968
602 Ga0495607_0000065
603 Ga0495607_0003754
604 Ga0495583_0001017
605 Ga0495583_0005648
606 Ga0495606_0000295
607 Ga0495606_0001501
608 Ga0495606_0014956
609 Ga0495606_0049779
610 Ga0495608_0086403
611 Ga0495610_0000080
612 Ga0495618_0002925
613 Ga0495620_0000067
614 Ga0495620_0000149
615 Ga0495620_0000483
616 Ga0495620_0008064
617 Ga0495620_0018312
618 Ga0495620_0038407
619 Ga0495628_0001283
620 Ga0495628_0006105
621 Ga0495628_0097068
622 Ga0495630_0024445
623 Ga0495630_0030385
624 Ga0495630_0082211
625 Ga0495631_0000312
626 Ga0495631_0000701
627 Ga0495632_0000011
628 Ga0495632_0004197
629 Ga0495648_0000085
630 Ga0495648_0004499
631 Ga0495648_0007702
632 Ga0495648_0024645
633 Ga0495648_0046943
634 Ga0495648_0071294
635 Ga0495666_0006141
636 Ga0495666_0025751
637 Ga0495666_0029711
638 Ga0495652_0001537
639 Ga0495652_0015142
640 Ga0495654_0001848
641 Ga0495654_0004688
642 Ga0495665_0000289
643 Ga0495640_0003082
644 Ga0495586_0000513
645 Ga0495586_0021584
646 Ga0495587_0016083
647 Ga0495587_0016727
648 Ga0495645_0016418
649 Ga0495645_0144052
650 Ga0495622_0010302
651 Ga0495668_0003007
652 Ga0495668_0022579
653 Ga0495634_0014069
654 Ga0495634_0101296
655 Ga0495611_0000007
656 Ga0495635_0002414
657 Ga0495635_0051925
658 Ga0495661_0001770
659 Ga0495661_0008641
660 Ga0495661_0017694
661 Ga0495588_0071283
662 Ga0495599_0005792
663 Ga0495599_0066435
664 Ga0495623_0002748
665 Ga0495623_0004580
666 Ga0495646_0000625
667 Ga0495646_0001027
668 Ga0495613_0001717
669 Ga0495613_0011797
670 Ga0495613_0058036
671 Ga0495624_0000496
672 Ga0495624_0010851
673 Ga0495589_0000524
674 Ga0495589_0005118
675 Ga0495660_0006987
676 Ga0495581_0103147
677 Ga0495604_0007992
678 Ga0495604_0025588
679 Ga0495674_0001539
680 Ga0495674_0001583
681 Ga0495674_0019852
682 Ga0495674_0045262
683 Ga0495672_0000014
684 Ga0495672_0028870
685 Ga0495676_0016984
686 Ga0495676_0053842
687 Ga0495676_0103799
688 Ga0495680_0017919
689 Ga0495680_0028376
690 Ga0495680_0111846
691 Ga0495683_0001492
692 Ga0495683_0003962
693 Ga0495687_006215
694 Ga0495675_0024063
695 Ga0495679_000008
696 Ga0495679_001194
697 Ga0495679_002757
698 Ga0495679_004252
699 Ga0495673_0000197
700 Ga0495673_0000224
701 Ga0495673_0001409
702 Ga0495673_0008882
703 Ga0495686_0001906
704 Ga0495593_0005917
705 Ga0495602_0009309
706 Ga0495602_0024530
707 Ga0495602_0028114
708 Ga0495602_0081832
709 Ga0495614_0004491
710 Ga0495614_0006727
711 Ga0495626_0024988
712 Ga0496101_0028125
713 Ga0496104_0007654
714 Ga0496105_0000667
715 Ga0496105_0009074
716 Ga0496106_0001489
717 Ga0496110_0082090
718 Ga0496111_0088262
719 Ga0496115_0015014
720 Ga0496116_0011201
721 Ga0496117_0002727
722 Ga0496117_0017589
723 Ga0496118_0008642
724 Ga0496118_0009526
725 Ga0496118_0060385
726 Ga0496118_0087923
727 Ga0496119_0000029
728 Ga0496119_0004060
729 Ga0496119_0009654
730 Ga0496120_0000039
731 Ga0496120_0001639
732 Ga0496121_0000862
733 Ga0496121_0000879
734 Ga0496121_0006179
735 Ga0496121_0029604
736 Ga0496121_0115842
737 Ga0496122_0009268
738 Ga0496122_0096694
739 Ga0496123_0030834
740 Ga0496123_0036858
741 Ga0496123_0126079
742 Ga0496124_0007539
743 Ga0496124_0015002
744 Ga0496124_0065479
745 Ga0496124_0106853
746 Ga0496124_0179760
747 Ga0496125_0035224
748 Ga0496126_0000708
749 Ga0496126_0000716
750 Ga0496126_0002212
751 Ga0496126_0068501
752 Ga0495678_000119
753 Ga0495678_005336
754 Ga0495678_042089
755 Ga0495682_0005172
756 Ga0495682_0009428
757 Ga0495682_0031825
758 Ga0501222_000046
759 Ga0500618_001336
760 Ga0500622_0024585
761 Ga0500633_0010336
762 2501070502
763 2501411447
764 2511099425
765 2511108888
766 2513233217
767 2547372390
768 2553391845
769 2553397345
770 2563062767
771 2563930514
772 2585145079
773 2587740607
774 2588218609
775 2588225713
776 2595090410
777 2599737504
778 2599742300
779 2599749133
780 2600204418
781 2600211256
782 2601624215
783 2644421859
784 2644707774
785 2644712194
786 2673166876
787 2673819934
788 2676746325
789 2676747414
790 2685149080
791 2698324102
792 2705992938
793 2705993116
794 2713477003
795 2721504462
796 2738838065
797 2739156597
798 2739210198
799 2739269608
800 2745168391
801 2757567162
802 2765573160
803 2765584583
804 2777761664
805 2808869939
806 2808973556
807 2809008405
808 2809015257
809 2817620886
810 2819566333
811 2819582890
812 2819636655
813 2819675814
814 2842325684
815 2842349963
816 2842454843
817 2843695734
818 2852677026
819 2857588765
820 2863426016
821 2864734659
822 2870074965
823 2889048284
824 2889299087
825 2904466609
826 2904494541
827 2904565388
828 2904571916
829 2904756124
830 2907206582
831 2919164309
832 2919431464
833 2919480054
834 2919684974
835 2921648102
836 2928177706
837 2928178272
838 2928537234
839 2929234351
840 2931385401
841 2936344638
842 2938918522
843 2939680425
844 2945995958
845 2946058663
846 2947427865
847 2965762371
848 2979084781
849 2979089599
850 2981288523
851 2981293344
852 2981983971
853 2981988894
854 3006831898
855 3007318071
856 640489510
857 651177537
858 8018851240
859 8020943960
860 8020956065
861 8021124542
862 8022622296
863 8022793471
864 8023443325
865 8023449373
866 8054932914
867 8055636021
868 8057583868

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00199

Catalase

Catalase

100

479

0.98

PF06628

Catalase-rel

Catalase-related immune-responsive

501

565

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1m7s-assembly1.cif.gz_C crystal structure analysis of catalase catf of pseudomonas syringae 0.8484 29 508
1ye9-assembly2.cif.gz_P crystal structure of proteolytically truncated catalase hpii from e. coli 0.844 256 492
1m7s-assembly1.cif.gz_C crystal structure analysis of catalase catf of pseudomonas syringae 0.8417 29 508
2j2m-assembly1.cif.gz_D crystal structure analysis of catalase from exiguobacterium oxidotolerans 0.8386 28 497
4qoq-assembly1.cif.gz_B structure of bacillus pumilus catalase with guaiacol bound 0.8369 28 496
ID Description Score Start End Superfamily
1cf9A02 Mainly Alpha;Up-down Bundle;Hemocyanin, N-terminal domain;Catalase, four-helical domain 0.9319 436 496 1.20.1370.20
2iufE02 Mainly Alpha;Up-down Bundle;Hemocyanin, N-terminal domain;Catalase, four-helical domain 0.9316 435 497 1.20.1370.20
1ye9B02 Mainly Beta;Beta Barrel;catalase hpii fold;catalase hpii domain 0.9277 76 239 2.40.470.10
6nsyA02 Mainly Alpha;Up-down Bundle;Hemocyanin, N-terminal domain;Catalase, four-helical domain 0.9263 436 497 1.20.1370.20
4bimD02 Mainly Alpha;Up-down Bundle;Hemocyanin, N-terminal domain;Catalase, four-helical domain 0.9207 436 496 1.20.1370.20
ID Description Score Start End GO Terms
AF-A0A1X0MM95-F1-model_v4 Catalase (EC 1.11.1.6) 0.9735 160 330 GO:0004096
GO:0005737
GO:0020037
GO:0042542
GO:0042744
AF-A0A7S0VC05-F1-model_v4 catalase (EC 1.11.1.6) 0.9729 126 307 GO:0004096
GO:0005737
GO:0020037
GO:0042542
GO:0042744
AF-C8CBC5-F1-model_v4 catalase (EC 1.11.1.6) 0.9726 143 301 GO:0004096
GO:0005777
GO:0005886
GO:0020037
GO:0042542
GO:0042744
AF-F5BWI5-F1-model_v4 Catalase (EC 1.11.1.6) 0.9724 162 284 GO:0004096
GO:0005737
GO:0020037
GO:0042542
GO:0042744
AF-A0A6A2XR19-F1-model_v4 Catalase core domain-containing protein 0.9696 186 314 GO:0004096
GO:0005737
GO:0020037
GO:0042542
GO:0042744

Map