F443160

General Info

Members Datasets Scaffolds Average Seq Length
434 241 433 144

Family's Representative Sequence

Representative Sequence 3300046499|Ga0495594_0062288|Ga0495594_0062288_1294_1821
Length 175
Sequence MHGQASAVGAAWRLRKQCDNETVLVRLPDGESMNPLPNWVVFALGSAFFAALTALFGKLGVAGINSNMATLIRTVVIMLVTAGILSLRSEWQKPANISAYSWLFLVLSGIATGLSWLCYYRALQLGPVSKVAPVDKLSVAIAIVLGIVFAGEQLTWQVALGGALIVAGSVVIILF

Samples

Sample ID Description Type Environment
1 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
120 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
121 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
124 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
135 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
152 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
155 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
156 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
159 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
162 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
163 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
166 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
173 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
181 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
182 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
200 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
201 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
202 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
203 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
204 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
205 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
208 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
209 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
216 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
220 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
236 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0.46
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0.23
Rhizoplane 0.92
Rhizosphere 93.09
Stem 0
Stem Tuber 0
Unclassified 5.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10001494 3300001990 Bacteria 8337
2 JGI25153J46596_10048900 3300003215 Bacteria 1231
3 rootH2_10004658 3300003320 Bacteria 42523
4 Ga0070690_100130730 3300005330 Unclassified 1695
5 Ga0068869_100599282 3300005334 Bacteria 930
6 Ga0070666_10694455 3300005335 Unclassified 746
7 Ga0070680_100040143 3300005336 Unclassified 3788
8 Ga0070682_100240357 3300005337 Bacteria 1300
9 Ga0070660_100054802 3300005339 Bacteria 3080
10 Ga0070660_100132528 3300005339 Unclassified 1995
11 Ga0070689_100868720 3300005340 Bacteria 796
12 Ga0070691_10004926 3300005341 Bacteria 6075
13 Ga0070687_100138898 3300005343 Bacteria 1412
14 Ga0070661_100073230 3300005344 Bacteria 2522
15 Ga0070661_100243217 3300005344 Unclassified 1386
16 Ga0070692_10059701 3300005345 Bacteria 2005
17 Ga0070692_10316994 3300005345 Bacteria 957
18 Ga0070673_101168445 3300005364 Bacteria 720
19 Ga0070659_100081745 3300005366 Unclassified 2580
20 Ga0070667_100023595 3300005367 Bacteria 5106
21 Ga0070703_10032631 3300005406 Bacteria 1582
22 Ga0070701_10008573 3300005438 Unclassified 4431
23 Ga0070705_100010258 3300005440 Bacteria 4683
24 Ga0070700_100018644 3300005441 Unclassified 3993
25 Ga0070708_100035226 3300005445 Unclassified 4360
26 Ga0070663_100000074 3300005455 Bacteria 43680
27 Ga0070678_100127598 3300005456 Unclassified 2016
28 Ga0070681_10254994 3300005458 Bacteria 1666
29 Ga0070681_10525831 3300005458 Bacteria 1096
30 Ga0068867_100298878 3300005459 Bacteria 1326
31 Ga0070685_10016244 3300005466 Bacteria 3964
32 Ga0070697_101048330 3300005536 Bacteria 725
33 Ga0068853_100006667 3300005539 Bacteria 9196
34 Ga0068853_101858943 3300005539 Bacteria 584
35 Ga0070672_100006429 3300005543 Bacteria 7900
36 Ga0070686_100002805 3300005544 Bacteria 9594
37 Ga0070695_100005912 3300005545 Bacteria 7220
38 Ga0070696_100001100 3300005546 Bacteria 17501
39 Ga0070696_100006952 3300005546 Bacteria 7555
40 Ga0070693_100007917 3300005547 Bacteria 5215
41 Ga0070704_100005577 3300005549 Bacteria 7343
42 Ga0068855_100059860 3300005563 Unclassified 4455
43 Ga0068855_100114959 3300005563 Bacteria 3085
44 Ga0068855_100975747 3300005563 Bacteria 891
45 Ga0070664_100150797 3300005564 Unclassified 2052
46 Ga0070664_100191166 3300005564 Bacteria 1824
47 Ga0068857_100001117 3300005577 Bacteria 20875
48 Ga0068854_100003905 3300005578 Bacteria 9345
49 Ga0068854_100090495 3300005578 Bacteria 2275
50 Ga0068856_100070045 3300005614 Unclassified 3469
51 Ga0068856_100963819 3300005614 Bacteria 871
52 Ga0070702_100002844 3300005615 Bacteria 7597
53 Ga0068852_100044227 3300005616 Bacteria 3781
54 Ga0068852_100341444 3300005616 Bacteria 1460
55 Ga0068852_100548230 3300005616 Unclassified 1156
56 Ga0068866_10005566 3300005718 Bacteria 5208
57 Ga0068861_101079551 3300005719 Bacteria 770
58 Ga0068870_10079945 3300005840 Bacteria 1805
59 Ga0068863_101918451 3300005841 Bacteria 602
60 Ga0068858_100003181 3300005842 Bacteria 16410
61 Ga0068858_100004630 3300005842 Bacteria 13469
62 Ga0068858_100055502 3300005842 Unclassified 3662
63 Ga0068858_100078740 3300005842 Bacteria 3062
64 Ga0068860_100007062 3300005843 Bacteria 11242
65 Ga0068860_101168856 3300005843 Bacteria 789
66 Ga0068862_100031595 3300005844 Bacteria 4471
67 Ga0070717_10052481 3300006028 Bacteria 3359
68 Ga0097621_100041947 3300006237 Bacteria 3685
69 Ga0068871_100009870 3300006358 Bacteria 6931
70 Ga0068865_100014419 3300006881 Bacteria 5021
71 Ga0068865_100401810 3300006881 Bacteria 1122
72 Ga0099794_10031181 3300007265 Bacteria 2494
73 Ga0105240_10004796 3300009093 Bacteria 20386
74 Ga0105240_10008556 3300009093 Bacteria 14624
75 Ga0105240_10010277 3300009093 Bacteria 13176
76 Ga0105240_10058828 3300009093 Bacteria 4798
77 Ga0105240_10252791 3300009093 Unclassified 2037
78 Ga0105240_10361696 3300009093 Bacteria 1643
79 Ga0105240_10957090 3300009093 Bacteria 918
80 Ga0105245_10043124 3300009098 Bacteria 4025
81 Ga0105245_11713466 3300009098 Unclassified 681
82 Ga0105247_11052405 3300009101 Unclassified 639
83 Ga0105243_10294281 3300009148 Bacteria 1468
84 Ga0105243_11556378 3300009148 Bacteria 686
85 Ga0105241_10109995 3300009174 Bacteria 2204
86 Ga0105241_11493286 3300009174 Bacteria 650
87 Ga0105242_11068313 3300009176 Bacteria 819
88 Ga0105248_10033086 3300009177 Bacteria 5775
89 Ga0105237_10000058 3300009545 Bacteria 146943
90 Ga0105237_10130323 3300009545 Bacteria 2509
91 Ga0105237_12075905 3300009545 Bacteria 577
92 Ga0105238_11667354 3300009551 Bacteria 668
93 Ga0099796_10077688 3300010159 Bacteria 1211
94 Ga0105239_10000354 3300010375 Bacteria 67059
95 Ga0105239_10064042 3300010375 Bacteria 4036
96 Ga0105246_10674632 3300011119 Bacteria 903
97 Ga0157314_1000328 3300012500 Bacteria 5005
98 Ga0157369_10235041 3300013105 Bacteria 1915
99 Ga0157378_10404173 3300013297 Bacteria 1346
100 Ga0163162_10075603 3300013306 Unclassified 3429
101 Ga0157372_10185769 3300013307 Bacteria 2407
102 Ga0157372_10810341 3300013307 Bacteria 1088
103 Ga0157375_10008717 3300013308 Bacteria 8885
104 Ga0157375_10022625 3300013308 Bacteria 5787
105 Ga0157380_10041793 3300014326 Bacteria 3580
106 Ga0157379_10002557 3300014968 Bacteria 15259
107 Ga0157379_10088190 3300014968 Bacteria 2782
108 Ga0157376_10023462 3300014969 Unclassified 4828
109 Ga0213872_10005836 3300021361 Bacteria 6249
110 Ga0209758_1000698 3300025297 Bacteria 49793
111 Ga0207653_10008790 3300025885 Unclassified 3149
112 Ga0207642_10070771 3300025899 Bacteria 1659
113 Ga0207705_10194862 3300025909 Bacteria 1534
114 Ga0207705_10646412 3300025909 Bacteria 822
115 Ga0207654_10117035 3300025911 Bacteria 1667
116 Ga0207707_10062224 3300025912 Bacteria 3247
117 Ga0207707_10381468 3300025912 Bacteria 1211
118 Ga0207695_10000520 3300025913 Bacteria 81547
119 Ga0207695_10000639 3300025913 Bacteria 69783
120 Ga0207695_10018800 3300025913 Bacteria 7973
121 Ga0207695_10033890 3300025913 Bacteria 5560
122 Ga0207695_10256128 3300025913 Bacteria 1649
123 Ga0207695_10318440 3300025913 Bacteria 1445
124 Ga0207695_10637224 3300025913 Bacteria 947
125 Ga0207695_11061523 3300025913 Bacteria 690
126 Ga0207671_10000026 3300025914 Bacteria 268845
127 Ga0207671_10438517 3300025914 Bacteria 1040
128 Ga0207663_10009605 3300025916 Bacteria 5120
129 Ga0207660_10026489 3300025917 Unclassified 3949
130 Ga0207662_10000674 3300025918 Bacteria 15520
131 Ga0207657_10058597 3300025919 Bacteria 3313
132 Ga0207657_10128554 3300025919 Unclassified 2079
133 Ga0207649_10034905 3300025920 Unclassified 3017
134 Ga0207649_10176864 3300025920 Unclassified 1491
135 Ga0207694_10650302 3300025924 Bacteria 888
136 Ga0207687_10016110 3300025927 Bacteria 4907
137 Ga0207687_10046080 3300025927 Unclassified 3017
138 Ga0207687_10059954 3300025927 Bacteria 2682
139 Ga0207686_10049209 3300025934 Unclassified 2615
140 Ga0207709_10003632 3300025935 Bacteria 9105
141 Ga0207670_10060071 3300025936 Unclassified 2588
142 Ga0207704_10001876 3300025938 Bacteria 9406
143 Ga0207704_11043699 3300025938 Bacteria 693
144 Ga0207691_10046906 3300025940 Bacteria 3968
145 Ga0207711_10023261 3300025941 Bacteria 5186
146 Ga0207689_10004659 3300025942 Bacteria 12401
147 Ga0207689_10132451 3300025942 Bacteria 2052
148 Ga0207679_10042103 3300025945 Bacteria 3280
149 Ga0207667_10001569 3300025949 Bacteria 28787
150 Ga0207667_10015471 3300025949 Bacteria 8665
151 Ga0207667_10078382 3300025949 Bacteria 3424
152 Ga0207667_11571020 3300025949 Bacteria 627
153 Ga0207712_10021396 3300025961 Unclassified 4247
154 Ga0207640_10003307 3300025981 Bacteria 8694
155 Ga0207640_10016454 3300025981 Unclassified 4303
156 Ga0207658_10080334 3300025986 Bacteria 2497
157 Ga0207677_11681808 3300026023 Bacteria 588
158 Ga0207703_10003323 3300026035 Bacteria 13506
159 Ga0207703_10006640 3300026035 Bacteria 9228
160 Ga0207703_10012692 3300026035 Bacteria 6568
161 Ga0207639_10006440 3300026041 Bacteria 7984
162 Ga0207639_10102320 3300026041 Bacteria 2318
163 Ga0207639_11264494 3300026041 Unclassified 693
164 Ga0207639_11278894 3300026041 Bacteria 688
165 Ga0207678_10001151 3300026067 Bacteria 24178
166 Ga0207678_10002340 3300026067 Bacteria 17182
167 Ga0207708_10002185 3300026075 Bacteria 14437
168 Ga0207641_10001174 3300026088 Bacteria 26309
169 Ga0207648_11011800 3300026089 Bacteria 778
170 Ga0207648_11014289 3300026089 Bacteria 777
171 Ga0207674_10001628 3300026116 Bacteria 28884
172 Ga0207675_100000353 3300026118 Bacteria 43874
173 Ga0207683_10193280 3300026121 Unclassified 1848
174 Ga0207698_10046394 3300026142 Bacteria 3281
175 Ga0207698_10540933 3300026142 Unclassified 1140
176 Ga0207698_10934903 3300026142 Bacteria 875
177 Ga0268266_10000157 3300028379 Bacteria 128419
178 Ga0268265_10037328 3300028380 Unclassified 3565
179 Ga0268264_10009177 3300028381 Bacteria 8194
180 Ga0268264_10122417 3300028381 Unclassified 2294
181 Ga0265323_10001308 3300028653 Bacteria 12427
182 Ga0265322_10000662 3300028654 Bacteria 12858
183 Ga0265336_10000658 3300028666 Bacteria 18814
184 Ga0265336_10008014 3300028666 Bacteria 3728
185 Ga0265338_10000033 3300028800 Bacteria 251901
186 Ga0265338_10130258 3300028800 Bacteria 1988
187 Ga0265324_10041573 3300029957 Bacteria 1590
188 Ga0265770_1007281 3300030878 Bacteria 1554
189 Ga0265760_10003567 3300031090 Bacteria 4513
190 Ga0265320_10165320 3300031240 Unclassified 995
191 Ga0265327_10129887 3300031251 Bacteria 1186
192 Ga0265342_10259356 3300031712 Bacteria 925
193 Ga0373931_0014187 3300035691 Unclassified 3891
194 Ga0373925_1088219 3300037068 Unclassified 658
195 Ga0395900_0217393 3300037418 Bacteria 1928
196 Ga0395905_0633209 3300037471 Bacteria 971
197 Ga0395901_0661768 3300038443 Unclassified 1046
198 Ga0436361_0854352 3300039447 Bacteria 15512
199 Ga0451835_0243530 3300041492 Bacteria 678
200 Ga0451853_3072234 3300041512 Bacteria 930
201 Ga0466977_0018648 3300044666 Bacteria 4234
202 Ga0466963_1205356 3300044694 Unclassified 532
203 Ga0466964_0095288 3300044706 Unclassified 1302
204 Ga0466957_0074634 3300044842 Bacteria 2103
205 Ga0466957_0204116 3300044842 Unclassified 1299
206 Ga0451576_0057629 3300045051 Bacteria 4061
207 Ga0466958_0539308 3300045836 Unclassified 758
208 Ga0466967_0051248 3300045976 Bacteria 3616
209 Ga0466967_0296460 3300045976 Bacteria 1555
210 Ga0495627_011030 3300046453 Bacteria 3256
211 Ga0495603_0039004 3300046455 Bacteria 2847
212 Ga0495603_0602165 3300046455 Bacteria 629
213 Ga0495629_0023998 3300046459 Bacteria 4344
214 Ga0495629_0040977 3300046459 Bacteria 3258
215 Ga0495638_0000986 3300046460 Bacteria 28631
216 Ga0495582_0052497 3300046473 Bacteria 2248
217 Ga0495582_0093281 3300046473 Bacteria 1680
218 Ga0495582_0137467 3300046473 Bacteria 1383
219 Ga0495605_0000023 3300046474 Bacteria 236732
220 Ga0495639_0622217 3300046475 Bacteria 556
221 Ga0495584_0000002 3300046491 Bacteria 512179
222 Ga0495584_0000147 3300046491 Bacteria 48786
223 Ga0495584_0005785 3300046491 Bacteria 6521
224 Ga0495584_0007291 3300046491 Bacteria 5769
225 Ga0495584_0093472 3300046491 Bacteria 1517
226 Ga0495584_0197077 3300046491 Bacteria 1024
227 Ga0495584_0269908 3300046491 Bacteria 865
228 Ga0495584_0343560 3300046491 Bacteria 758
229 Ga0495584_0650567 3300046491 Bacteria 537
230 Ga0495585_0000002 3300046492 Bacteria 529316
231 Ga0495585_0000039 3300046492 Bacteria 131202
232 Ga0495585_0000252 3300046492 Bacteria 55555
233 Ga0495585_0000547 3300046492 Bacteria 35540
234 Ga0495585_0000913 3300046492 Bacteria 25029
235 Ga0495585_0002739 3300046492 Bacteria 12300
236 Ga0495585_0009533 3300046492 Bacteria 5814
237 Ga0495585_0013387 3300046492 Bacteria 4802
238 Ga0495585_0020670 3300046492 Bacteria 3784
239 Ga0495585_0088123 3300046492 Bacteria 1674
240 Ga0495585_0167825 3300046492 Bacteria 1135
241 Ga0495585_0274873 3300046492 Bacteria 834
242 Ga0495594_0000959 3300046499 Bacteria 14991
243 Ga0495594_0062288 3300046499 Bacteria 2065
244 Ga0495594_0171728 3300046499 Bacteria 1233
245 Ga0495594_0328517 3300046499 Bacteria 871
246 Ga0495596_0000111 3300046500 Bacteria 56505
247 Ga0495596_0001907 3300046500 Bacteria 11581
248 Ga0495607_0024385 3300046501 Bacteria 3772
249 Ga0495607_0082932 3300046501 Bacteria 1757
250 Ga0495583_0000243 3300046506 Bacteria 89875
251 Ga0495583_0047190 3300046506 Bacteria 1982
252 Ga0495583_0063357 3300046506 Bacteria 1643
253 Ga0495583_0113374 3300046506 Bacteria 1147
254 Ga0495583_0350981 3300046506 Bacteria 582
255 Ga0495606_0000007 3300046507 Bacteria 323713
256 Ga0495606_0002422 3300046507 Bacteria 21747
257 Ga0495606_0007080 3300046507 Bacteria 10143
258 Ga0495606_0130584 3300046507 Bacteria 1494
259 Ga0495606_0312474 3300046507 Bacteria 847
260 Ga0495606_0386191 3300046507 Bacteria 733
261 Ga0495606_0482466 3300046507 Bacteria 629
262 Ga0495616_0001965 3300046513 Bacteria 13843
263 Ga0495616_0003136 3300046513 Bacteria 10682
264 Ga0495616_0016747 3300046513 Bacteria 4050
265 Ga0495620_0013452 3300046515 Bacteria 4188
266 Ga0495630_0124497 3300046517 Bacteria 1956
267 Ga0495631_0016809 3300046518 Bacteria 3477
268 Ga0495631_0036239 3300046518 Bacteria 2203
269 Ga0495631_0086786 3300046518 Bacteria 1347
270 Ga0495632_0008938 3300046519 Bacteria 6080
271 Ga0495644_0005607 3300046523 Bacteria 4897
272 Ga0495644_0014170 3300046523 Bacteria 3054
273 Ga0495644_0017126 3300046523 Bacteria 2772
274 Ga0495648_0000027 3300046524 Bacteria 228881
275 Ga0495648_0352822 3300046524 Bacteria 671
276 Ga0495663_0009529 3300046525 Bacteria 2695
277 Ga0495666_0054089 3300046526 Bacteria 1926
278 Ga0495642_0014298 3300046528 Bacteria 3075
279 Ga0495642_0016837 3300046528 Bacteria 2851
280 Ga0495642_0018263 3300046528 Bacteria 2744
281 Ga0495642_0022804 3300046528 Bacteria 2468
282 Ga0495642_0035876 3300046528 Bacteria 2003
283 Ga0495642_0040375 3300046528 Bacteria 1895
284 Ga0495652_0164610 3300046529 Bacteria 1718
285 Ga0495652_0181462 3300046529 Bacteria 1615
286 Ga0495665_0030952 3300046531 Bacteria 2863
287 Ga0495586_0003444 3300046535 Bacteria 8480
288 Ga0495586_0222584 3300046535 Bacteria 1072
289 Ga0495587_0016122 3300046536 Bacteria 4651
290 Ga0495587_0203009 3300046536 Unclassified 1121
291 Ga0495609_0013964 3300046538 Bacteria 3785
292 Ga0495609_0020752 3300046538 Bacteria 3033
293 Ga0495609_0046995 3300046538 Bacteria 1932
294 Ga0495597_0002529 3300046542 Bacteria 11475
295 Ga0495597_0014460 3300046542 Bacteria 3757
296 Ga0495597_0020178 3300046542 Bacteria 3108
297 Ga0495597_0133827 3300046542 Bacteria 1026
298 Ga0495633_0001149 3300046558 Bacteria 21247
299 Ga0495633_0002223 3300046558 Bacteria 13875
300 Ga0495633_0006006 3300046558 Bacteria 7296
301 Ga0495633_0011306 3300046558 Bacteria 4818
302 Ga0495633_0102471 3300046558 Bacteria 1328
303 Ga0495633_0104564 3300046558 Bacteria 1313
304 Ga0495633_0141866 3300046558 Bacteria 1111
305 Ga0495667_0302650 3300046559 Bacteria 1013
306 Ga0495668_0001158 3300046616 Bacteria 26970
307 Ga0495668_0013245 3300046616 Bacteria 4873
308 Ga0495668_0167213 3300046616 Bacteria 1204
309 Ga0495634_0256493 3300046642 Bacteria 1068
310 Ga0495611_0008688 3300046648 Bacteria 4296
311 Ga0495611_0010419 3300046648 Bacteria 3933
312 Ga0495611_0074392 3300046648 Bacteria 1556
313 Ga0495611_0283063 3300046648 Bacteria 766
314 Ga0495625_0004536 3300046660 Bacteria 13088
315 Ga0495625_0333550 3300046660 Bacteria 963
316 Ga0495659_0000073 3300046664 Bacteria 42850
317 Ga0495661_0003466 3300046665 Bacteria 11644
318 Ga0495661_0004136 3300046665 Bacteria 10565
319 Ga0495661_0012195 3300046665 Bacteria 5804
320 Ga0495661_0595537 3300046665 Unclassified 520
321 Ga0495588_0010291 3300046674 Bacteria 4345
322 Ga0495588_0058716 3300046674 Bacteria 1988
323 Ga0495646_0197506 3300046680 Bacteria 1097
324 Ga0495669_0001061 3300046684 Bacteria 11459
325 Ga0495669_0162978 3300046684 Bacteria 1059
326 Ga0495613_0621854 3300046689 Bacteria 717
327 Ga0495613_0703903 3300046689 Bacteria 665
328 Ga0495670_0001340 3300046691 Bacteria 12018
329 Ga0495670_0007060 3300046691 Bacteria 5529
330 Ga0495670_0018487 3300046691 Bacteria 3431
331 Ga0495670_0033609 3300046691 Bacteria 2551
332 Ga0495670_0148087 3300046691 Bacteria 1230
333 Ga0495670_0148463 3300046691 Bacteria 1228
334 Ga0495671_0000309 3300046692 Bacteria 41290
335 Ga0495671_0255589 3300046692 Bacteria 845
336 Ga0495649_0260155 3300046694 Bacteria 890
337 Ga0495589_0016792 3300046794 Bacteria 3759
338 Ga0495600_0011618 3300046809 Bacteria 5491
339 Ga0495660_0038771 3300046810 Bacteria 2648
340 Ga0495581_0007398 3300047315 Bacteria 6351
341 Ga0495581_0293039 3300047315 Bacteria 951
342 Ga0495604_0612053 3300047317 Bacteria 697
343 Ga0495636_0006381 3300047318 Bacteria 4633
344 Ga0495636_0155287 3300047318 Bacteria 1029
345 Ga0495674_0004869 3300047319 Bacteria 12909
346 Ga0495672_0003403 3300047320 Bacteria 13652
347 Ga0495676_0024471 3300047321 Bacteria 5227
348 Ga0495676_0094874 3300047321 Bacteria 2221
349 Ga0495676_0175449 3300047321 Bacteria 1505
350 Ga0495676_0245992 3300047321 Bacteria 1222
351 Ga0495680_0593723 3300047322 Bacteria 742
352 Ga0495683_0001075 3300047323 Bacteria 18894
353 Ga0495683_0031854 3300047323 Bacteria 2686
354 Ga0495683_0054664 3300047323 Bacteria 1989
355 Ga0495687_078702 3300047443 Bacteria 1298
356 Ga0495675_0055692 3300047444 Bacteria 2508
357 Ga0495675_0224116 3300047444 Bacteria 1136
358 Ga0495677_0003862 3300047445 Bacteria 5794
359 Ga0495677_0005249 3300047445 Bacteria 4926
360 Ga0495685_008678 3300047447 Bacteria 3382
361 Ga0495681_0009074 3300047470 Bacteria 6164
362 Ga0495681_0102498 3300047470 Unclassified 1249
363 Ga0495681_0124813 3300047470 Bacteria 1101
364 Ga0495686_0012569 3300047472 Bacteria 5918
365 Ga0495686_0126349 3300047472 Bacteria 1520
366 Ga0495593_0003662 3300047673 Bacteria 9177
367 Ga0495593_0038742 3300047673 Bacteria 2573
368 Ga0495602_0268792 3300048088 Bacteria 1261
369 Ga0495614_0051543 3300048089 Bacteria 1764
370 Ga0495626_0001690 3300048091 Bacteria 16964
371 Ga0495626_0012242 3300048091 Plasmid 4503
372 Ga0495626_0018066 3300048091 Bacteria 3549
373 Ga0495626_0096005 3300048091 Bacteria 1297
374 Ga0495626_0111824 3300048091 Bacteria 1182
375 Ga0495626_0207607 3300048091 Unclassified 800
376 Ga0495626_0406487 3300048091 Bacteria 526
377 Ga0496104_0063741 3300048907 Bacteria 3496
378 Ga0496105_0008341 3300048908 Bacteria 8050
379 Ga0496115_0049883 3300048918 Bacteria 3352
380 Ga0496115_0193775 3300048918 Bacteria 1679
381 Ga0496117_0003585 3300048920 Bacteria 17909
382 Ga0496117_0021335 3300048920 Bacteria 5244
383 Ga0496117_0035225 3300048920 Bacteria 3759
384 Ga0496117_0123691 3300048920 Bacteria 1583
385 Ga0496118_0000065 3300048921 Bacteria 211750
386 Ga0496118_0002920 3300048921 Bacteria 22207
387 Ga0496118_0009252 3300048921 Bacteria 10000
388 Ga0496118_0015155 3300048921 Bacteria 7157
389 Ga0496119_0002015 3300048922 Bacteria 22992
390 Ga0496119_0057543 3300048922 Bacteria 2348
391 Ga0496120_0000505 3300048923 Bacteria 60875
392 Ga0496120_0002370 3300048923 Bacteria 19236
393 Ga0496121_0000550 3300048924 Bacteria 70775
394 Ga0496121_0064903 3300048924 Bacteria 2974
395 Ga0496121_0262171 3300048924 Bacteria 1192
396 Ga0496121_0415042 3300048924 Bacteria 877
397 Ga0496126_0013046 3300048929 Bacteria 8479
398 Ga0496126_0194317 3300048929 Bacteria 1717
399 Ga0495678_192470 3300049459 Bacteria 633
400 Ga0495682_0017962 3300049460 Bacteria 2664
401 Ga0495682_0022141 3300049460 Bacteria 2379
402 Ga0501031_0030289 3300049568 Bacteria 3529
403 Ga0501032_0041546 3300049569 Bacteria 3121
404 Ga0501033_0095897 3300049570 Bacteria 2167
405 Ga0501033_0435139 3300049570 Bacteria 912
406 Ga0501034_0291624 3300049571 Bacteria 1569
407 Ga0501037_0039383 3300049573 Bacteria 3479
408 Ga0501037_0141226 3300049573 Bacteria 1723
409 Ga0501038_0222674 3300049574 Bacteria 1504
410 Ga0501039_0169133 3300049575 Bacteria 1718
411 Ga0501040_0070832 3300049576 Bacteria 2407
412 Ga0501042_0627309 3300049578 Bacteria 781
413 Ga0501043_0072147 3300049579 Bacteria 2712
414 Ga0501043_0079720 3300049579 Bacteria 2572
415 Ga0501043_0141974 3300049579 Bacteria 1880
416 Ga0501043_0915618 3300049579 Unclassified 628
417 Ga0501046_0128790 3300049580 Bacteria 1920
418 Ga0501047_0050453 3300049581 Bacteria 4018
419 Ga0501047_0121118 3300049581 Bacteria 2498
420 Ga0501048_0042083 3300049582 Bacteria 3272
421 Ga0501048_1405833 3300049582 Bacteria 501
422 Ga0501070_0018622 3300049586 Bacteria 5825
423 Ga0501073_0063896 3300049589 Bacteria 2567
424 Ga0501074_0312157 3300049590 Bacteria 1117
425 Ga0501080_0079225 3300049742 Bacteria 3054
426 Ga0501035_0090095 3300049822 Bacteria 2700
427 Ga0501035_0289522 3300049822 Bacteria 1382
428 Ga0501044_0093446 3300049823 Bacteria 3032
429 Ga0501044_0102111 3300049823 Bacteria 2884
430 Ga0501044_0114757 3300049823 Bacteria 2699
431 Ga0501044_0402322 3300049823 Bacteria 1281
432 Ga0501045_0092308 3300049824 Bacteria 2239
433 Ga0500573_0318609 3300053140 Bacteria 769

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005546 Ga0070696_100001100 Ga0070696_1000011004 140
2 3300007265 Ga0099794_10031181 Ga0099794_100311811 140
3 3300009093 Ga0105240_10008556 Ga0105240_100085565 140
4 3300010159 Ga0099796_10077688 Ga0099796_100776882 140
5 3300010375 Ga0105239_10064042 Ga0105239_100640423 140
6 3300025916 Ga0207663_10009605 Ga0207663_100096053 140
7 3300030878 Ga0265770_1007281 Ga0265770_10072812 140
8 3300031090 Ga0265760_10003567 Ga0265760_100035673 140
9 3300031240 Ga0265320_10165320 Ga0265320_101653201 140
10 3300037068 Ga0373925_1088219 Ga0373925_1088219_159_581 140
11 3300044666 Ga0466977_0018648 Ga0466977_0018648_987_1409 140
12 3300044694 Ga0466963_1205356 Ga0466963_1205356_82_504 140
13 3300044706 Ga0466964_0095288 Ga0466964_0095288_514_936 140
14 3300044842 Ga0466957_0204116 Ga0466957_0204116_433_855 140
15 3300045836 Ga0466958_0539308 Ga0466958_0539308_60_482 140
16 3300045976 Ga0466967_0051248 Ga0466967_0051248_43_465 140
17 3300046529 Ga0495652_0164610 Ga0495652_0164610_424_846 140
18 3300046536 Ga0495587_0203009 Ga0495587_0203009_222_644 140
19 3300053140 Ga0500573_0318609 Ga0500573_0318609_164_589 140
20 iso_pu_bacteria 2728368998 2728752038 140
21 3300009093 Ga0105240_10004796 Ga0105240_1000479610 141
22 3300025913 Ga0207695_10033890 Ga0207695_100338902 141
23 3300026041 Ga0207639_11264494 Ga0207639_112644942 141
24 3300026088 Ga0207641_10001174 Ga0207641_1000117423 141
25 3300026142 Ga0207698_10934903 Ga0207698_109349032 141
26 3300028379 Ga0268266_10000157 Ga0268266_1000015746 141
27 3300025909 Ga0207705_10646412 Ga0207705_106464121 142
28 3300029957 Ga0265324_10041573 Ga0265324_100415732 142
29 3300031251 Ga0265327_10129887 Ga0265327_101298871 142
30 3300049573 Ga0501037_0141226 Ga0501037_0141226_141_569 142
31 3300049579 Ga0501043_0915618 Ga0501043_0915618_180_611 142
32 3300001990 JGI24737J22298_10001494 JGI24737J22298_100014945 143
33 3300003215 JGI25153J46596_10048900 JGI25153J46596_100489002 143
34 3300003320 rootH2_10004658 rootH2_1000465832 143
35 3300005330 Ga0070690_100130730 Ga0070690_1001307303 143
36 3300005334 Ga0068869_100599282 Ga0068869_1005992822 143
37 3300005335 Ga0070666_10694455 Ga0070666_106944551 143
38 3300005336 Ga0070680_100040143 Ga0070680_1000401435 143
39 3300005337 Ga0070682_100240357 Ga0070682_1002403571 143
40 3300005339 Ga0070660_100054802 Ga0070660_1000548022 143
41 3300005339 Ga0070660_100132528 Ga0070660_1001325282 143
42 3300005340 Ga0070689_100868720 Ga0070689_1008687202 143
43 3300005341 Ga0070691_10004926 Ga0070691_100049265 143
44 3300005343 Ga0070687_100138898 Ga0070687_1001388982 143
45 3300005344 Ga0070661_100073230 Ga0070661_1000732302 143
46 3300005344 Ga0070661_100243217 Ga0070661_1002432172 143
47 3300005345 Ga0070692_10059701 Ga0070692_100597011 143
48 3300005345 Ga0070692_10316994 Ga0070692_103169942 143
49 3300005364 Ga0070673_101168445 Ga0070673_1011684451 143
50 3300005366 Ga0070659_100081745 Ga0070659_1000817452 143
51 3300005367 Ga0070667_100023595 Ga0070667_1000235956 143
52 3300005406 Ga0070703_10032631 Ga0070703_100326312 143
53 3300005438 Ga0070701_10008573 Ga0070701_100085733 143
54 3300005440 Ga0070705_100010258 Ga0070705_1000102581 143
55 3300005441 Ga0070700_100018644 Ga0070700_1000186442 143
56 3300005445 Ga0070708_100035226 Ga0070708_1000352264 143
57 3300005455 Ga0070663_100000074 Ga0070663_10000007413 143
58 3300005456 Ga0070678_100127598 Ga0070678_1001275983 143
59 3300005458 Ga0070681_10254994 Ga0070681_102549942 143
60 3300005458 Ga0070681_10525831 Ga0070681_105258312 143
61 3300005459 Ga0068867_100298878 Ga0068867_1002988781 143
62 3300005466 Ga0070685_10016244 Ga0070685_100162443 143
63 3300005536 Ga0070697_101048330 Ga0070697_1010483302 143
64 3300005539 Ga0068853_100006667 Ga0068853_10000666711 143
65 3300005539 Ga0068853_101858943 Ga0068853_1018589431 143
66 3300005543 Ga0070672_100006429 Ga0070672_1000064293 143
67 3300005544 Ga0070686_100002805 Ga0070686_1000028055 143
68 3300005545 Ga0070695_100005912 Ga0070695_1000059125 143
69 3300005546 Ga0070696_100006952 Ga0070696_1000069525 143
70 3300005547 Ga0070693_100007917 Ga0070693_1000079173 143
71 3300005549 Ga0070704_100005577 Ga0070704_1000055779 143
72 3300005563 Ga0068855_100059860 Ga0068855_1000598603 143
73 3300005563 Ga0068855_100114959 Ga0068855_1001149591 143
74 3300005563 Ga0068855_100975747 Ga0068855_1009757472 143
75 3300005564 Ga0070664_100150797 Ga0070664_1001507973 143
76 3300005564 Ga0070664_100191166 Ga0070664_1001911664 143
77 3300005577 Ga0068857_100001117 Ga0068857_1000011173 143
78 3300005578 Ga0068854_100003905 Ga0068854_1000039053 143
79 3300005578 Ga0068854_100090495 Ga0068854_1000904953 143
80 3300005614 Ga0068856_100070045 Ga0068856_1000700451 143
81 3300005614 Ga0068856_100963819 Ga0068856_1009638192 143
82 3300005615 Ga0070702_100002844 Ga0070702_1000028445 143
83 3300005616 Ga0068852_100044227 Ga0068852_1000442273 143
84 3300005616 Ga0068852_100341444 Ga0068852_1003414442 143
85 3300005616 Ga0068852_100548230 Ga0068852_1005482302 143
86 3300005718 Ga0068866_10005566 Ga0068866_100055667 143
87 3300005719 Ga0068861_101079551 Ga0068861_1010795512 143
88 3300005840 Ga0068870_10079945 Ga0068870_100799452 143
89 3300005841 Ga0068863_101918451 Ga0068863_1019184511 143
90 3300005842 Ga0068858_100003181 Ga0068858_1000031811 143
91 3300005842 Ga0068858_100004630 Ga0068858_1000046303 143
92 3300005842 Ga0068858_100055502 Ga0068858_1000555022 143
93 3300005842 Ga0068858_100078740 Ga0068858_1000787403 143
94 3300005843 Ga0068860_100007062 Ga0068860_1000070626 143
95 3300005843 Ga0068860_101168856 Ga0068860_1011688562 143
96 3300005844 Ga0068862_100031595 Ga0068862_1000315955 143
97 3300006028 Ga0070717_10052481 Ga0070717_100524812 143
98 3300006237 Ga0097621_100041947 Ga0097621_1000419474 143
99 3300006358 Ga0068871_100009870 Ga0068871_1000098705 143
100 3300006881 Ga0068865_100014419 Ga0068865_1000144193 143
101 3300006881 Ga0068865_100401810 Ga0068865_1004018101 143
102 3300009093 Ga0105240_10010277 Ga0105240_100102776 143
103 3300009093 Ga0105240_10058828 Ga0105240_100588282 143
104 3300009093 Ga0105240_10252791 Ga0105240_102527912 143
105 3300009093 Ga0105240_10361696 Ga0105240_103616962 143
106 3300009093 Ga0105240_10957090 Ga0105240_109570902 143
107 3300009098 Ga0105245_10043124 Ga0105245_100431241 143
108 3300009098 Ga0105245_11713466 Ga0105245_117134661 143
109 3300009101 Ga0105247_11052405 Ga0105247_110524051 143
110 3300009148 Ga0105243_10294281 Ga0105243_102942812 143
111 3300009148 Ga0105243_11556378 Ga0105243_115563782 143
112 3300009174 Ga0105241_10109995 Ga0105241_101099953 143
113 3300009174 Ga0105241_11493286 Ga0105241_114932861 143
114 3300009176 Ga0105242_11068313 Ga0105242_110683132 143
115 3300009177 Ga0105248_10033086 Ga0105248_100330864 143
116 3300009545 Ga0105237_10000058 Ga0105237_1000005882 143
117 3300009545 Ga0105237_10130323 Ga0105237_101303232 143
118 3300009545 Ga0105237_12075905 Ga0105237_120759051 143
119 3300009551 Ga0105238_11667354 Ga0105238_116673541 143
120 3300010375 Ga0105239_10000354 Ga0105239_1000035448 143
121 3300011119 Ga0105246_10674632 Ga0105246_106746321 143
122 3300012500 Ga0157314_1000328 Ga0157314_10003283 143
123 3300013105 Ga0157369_10235041 Ga0157369_102350413 143
124 3300013297 Ga0157378_10404173 Ga0157378_104041732 143
125 3300013306 Ga0163162_10075603 Ga0163162_100756031 143
126 3300013307 Ga0157372_10185769 Ga0157372_101857691 143
127 3300013307 Ga0157372_10810341 Ga0157372_108103412 143
128 3300013308 Ga0157375_10008717 Ga0157375_100087177 143
129 3300013308 Ga0157375_10022625 Ga0157375_100226252 143
130 3300014326 Ga0157380_10041793 Ga0157380_100417934 143
131 3300014968 Ga0157379_10002557 Ga0157379_100025578 143
132 3300014968 Ga0157379_10088190 Ga0157379_100881904 143
133 3300014969 Ga0157376_10023462 Ga0157376_100234625 143
134 3300021361 Ga0213872_10005836 Ga0213872_100058364 143
135 3300025297 Ga0209758_1000698 Ga0209758_100069822 143
136 3300025885 Ga0207653_10008790 Ga0207653_100087904 143
137 3300025899 Ga0207642_10070771 Ga0207642_100707712 143
138 3300025909 Ga0207705_10194862 Ga0207705_101948622 143
139 3300025911 Ga0207654_10117035 Ga0207654_101170352 143
140 3300025912 Ga0207707_10062224 Ga0207707_100622244 143
141 3300025912 Ga0207707_10381468 Ga0207707_103814682 143
142 3300025913 Ga0207695_10000520 Ga0207695_1000052046 143
143 3300025913 Ga0207695_10000639 Ga0207695_1000063910 143
144 3300025913 Ga0207695_10018800 Ga0207695_100188003 143
145 3300025913 Ga0207695_10256128 Ga0207695_102561281 143
146 3300025913 Ga0207695_10318440 Ga0207695_103184401 143
147 3300025913 Ga0207695_10637224 Ga0207695_106372242 143
148 3300025913 Ga0207695_11061523 Ga0207695_110615232 143
149 3300025914 Ga0207671_10000026 Ga0207671_10000026168 143
150 3300025914 Ga0207671_10438517 Ga0207671_104385172 143
151 3300025917 Ga0207660_10026489 Ga0207660_100264895 143
152 3300025918 Ga0207662_10000674 Ga0207662_100006745 143
153 3300025919 Ga0207657_10058597 Ga0207657_100585974 143
154 3300025919 Ga0207657_10128554 Ga0207657_101285542 143
155 3300025920 Ga0207649_10034905 Ga0207649_100349053 143
156 3300025920 Ga0207649_10176864 Ga0207649_101768643 143
157 3300025924 Ga0207694_10650302 Ga0207694_106503022 143
158 3300025927 Ga0207687_10016110 Ga0207687_100161101 143
159 3300025927 Ga0207687_10046080 Ga0207687_100460804 143
160 3300025927 Ga0207687_10059954 Ga0207687_100599542 143
161 3300025934 Ga0207686_10049209 Ga0207686_100492093 143
162 3300025935 Ga0207709_10003632 Ga0207709_100036328 143
163 3300025936 Ga0207670_10060071 Ga0207670_100600713 143
164 3300025938 Ga0207704_10001876 Ga0207704_1000187610 143
165 3300025938 Ga0207704_11043699 Ga0207704_110436991 143
166 3300025940 Ga0207691_10046906 Ga0207691_100469062 143
167 3300025941 Ga0207711_10023261 Ga0207711_100232612 143
168 3300025942 Ga0207689_10004659 Ga0207689_1000465911 143
169 3300025942 Ga0207689_10132451 Ga0207689_101324512 143
170 3300025945 Ga0207679_10042103 Ga0207679_100421032 143
171 3300025949 Ga0207667_10001569 Ga0207667_1000156912 143
172 3300025949 Ga0207667_10015471 Ga0207667_100154718 143
173 3300025949 Ga0207667_10078382 Ga0207667_100783824 143
174 3300025949 Ga0207667_11571020 Ga0207667_115710201 143
175 3300025961 Ga0207712_10021396 Ga0207712_100213961 143
176 3300025981 Ga0207640_10003307 Ga0207640_100033072 143
177 3300025981 Ga0207640_10016454 Ga0207640_100164542 143
178 3300025986 Ga0207658_10080334 Ga0207658_100803342 143
179 3300026023 Ga0207677_11681808 Ga0207677_116818081 143
180 3300026035 Ga0207703_10003323 Ga0207703_1000332316 143
181 3300026035 Ga0207703_10006640 Ga0207703_100066406 143
182 3300026035 Ga0207703_10012692 Ga0207703_100126921 143
183 3300026041 Ga0207639_10006440 Ga0207639_100064407 143
184 3300026041 Ga0207639_10102320 Ga0207639_101023202 143
185 3300026041 Ga0207639_11278894 Ga0207639_112788941 143
186 3300026067 Ga0207678_10001151 Ga0207678_100011512 143
187 3300026067 Ga0207678_10002340 Ga0207678_1000234012 143
188 3300026075 Ga0207708_10002185 Ga0207708_1000218512 143
189 3300026089 Ga0207648_11011800 Ga0207648_110118002 143
190 3300026089 Ga0207648_11014289 Ga0207648_110142892 143
191 3300026116 Ga0207674_10001628 Ga0207674_1000162812 143
192 3300026118 Ga0207675_100000353 Ga0207675_10000035345 143
193 3300026121 Ga0207683_10193280 Ga0207683_101932802 143
194 3300026142 Ga0207698_10046394 Ga0207698_100463941 143
195 3300026142 Ga0207698_10540933 Ga0207698_105409332 143
196 3300028380 Ga0268265_10037328 Ga0268265_100373285 143
197 3300028381 Ga0268264_10009177 Ga0268264_100091772 143
198 3300028381 Ga0268264_10122417 Ga0268264_101224171 143
199 3300028653 Ga0265323_10001308 Ga0265323_1000130815 143
200 3300028654 Ga0265322_10000662 Ga0265322_100006622 143
201 3300028666 Ga0265336_10000658 Ga0265336_1000065810 143
202 3300028666 Ga0265336_10008014 Ga0265336_100080143 143
203 3300028800 Ga0265338_10000033 Ga0265338_10000033204 143
204 3300028800 Ga0265338_10130258 Ga0265338_101302582 143
205 3300031712 Ga0265342_10259356 Ga0265342_102593562 143
206 3300035691 Ga0373931_0014187 Ga0373931_0014187_3092_3523 143
207 3300037418 Ga0395900_0217393 Ga0395900_0217393_1010_1441 143
208 3300037471 Ga0395905_0633209 Ga0395905_0633209_311_742 143
209 3300038443 Ga0395901_0661768 Ga0395901_0661768_70_504 143
210 3300039447 Ga0436361_0854352 Ga0436361_0854352_12501_12932 143
211 3300041492 Ga0451835_0243530 Ga0451835_0243530_33_464 143
212 3300041512 Ga0451853_3072234 Ga0451853_3072234_63_494 143
213 3300044842 Ga0466957_0074634 Ga0466957_0074634_1399_1830 143
214 3300045051 Ga0451576_0057629 Ga0451576_0057629_1609_2085 143
215 3300045976 Ga0466967_0296460 Ga0466967_0296460_792_1223 143
216 3300046453 Ga0495627_011030 Ga0495627_011030_1388_1819 143
217 3300046455 Ga0495603_0039004 Ga0495603_0039004_480_911 143
218 3300046455 Ga0495603_0602165 Ga0495603_0602165_178_609 143
219 3300046459 Ga0495629_0023998 Ga0495629_0023998_2717_3148 143
220 3300046459 Ga0495629_0040977 Ga0495629_0040977_747_1178 143
221 3300046460 Ga0495638_0000986 Ga0495638_0000986_26770_27201 143
222 3300046473 Ga0495582_0052497 Ga0495582_0052497_1185_1616 143
223 3300046473 Ga0495582_0093281 Ga0495582_0093281_1202_1633 143
224 3300046473 Ga0495582_0137467 Ga0495582_0137467_282_713 143
225 3300046474 Ga0495605_0000023 Ga0495605_0000023_128044_128475 143
226 3300046475 Ga0495639_0622217 Ga0495639_0622217_12_443 143
227 3300046491 Ga0495584_0000002 Ga0495584_0000002_318259_318690 143
228 3300046491 Ga0495584_0000147 Ga0495584_0000147_10574_11005 143
229 3300046491 Ga0495584_0005785 Ga0495584_0005785_5266_5697 143
230 3300046491 Ga0495584_0007291 Ga0495584_0007291_2077_2508 143
231 3300046491 Ga0495584_0093472 Ga0495584_0093472_910_1341 143
232 3300046491 Ga0495584_0197077 Ga0495584_0197077_275_706 143
233 3300046491 Ga0495584_0269908 Ga0495584_0269908_346_777 143
234 3300046491 Ga0495584_0343560 Ga0495584_0343560_297_728 143
235 3300046491 Ga0495584_0650567 Ga0495584_0650567_14_445 143
236 3300046492 Ga0495585_0000002 Ga0495585_0000002_33372_33803 143
237 3300046492 Ga0495585_0000039 Ga0495585_0000039_24221_24652 143
238 3300046492 Ga0495585_0000252 Ga0495585_0000252_34573_35004 143
239 3300046492 Ga0495585_0000547 Ga0495585_0000547_34858_35289 143
240 3300046492 Ga0495585_0000913 Ga0495585_0000913_9746_10177 143
241 3300046492 Ga0495585_0002739 Ga0495585_0002739_7840_8271 143
242 3300046492 Ga0495585_0009533 Ga0495585_0009533_631_1062 143
243 3300046492 Ga0495585_0013387 Ga0495585_0013387_3093_3524 143
244 3300046492 Ga0495585_0020670 Ga0495585_0020670_559_990 143
245 3300046492 Ga0495585_0088123 Ga0495585_0088123_68_499 143
246 3300046492 Ga0495585_0167825 Ga0495585_0167825_417_848 143
247 3300046492 Ga0495585_0274873 Ga0495585_0274873_391_822 143
248 3300046499 Ga0495594_0000959 Ga0495594_0000959_7404_7835 143
249 3300046499 Ga0495594_0062288 Ga0495594_0062288_1294_1821 143
250 3300046499 Ga0495594_0171728 Ga0495594_0171728_414_845 143
251 3300046499 Ga0495594_0328517 Ga0495594_0328517_43_474 143
252 3300046500 Ga0495596_0000111 Ga0495596_0000111_25585_26016 143
253 3300046500 Ga0495596_0001907 Ga0495596_0001907_6759_7190 143
254 3300046501 Ga0495607_0024385 Ga0495607_0024385_1948_2379 143
255 3300046501 Ga0495607_0082932 Ga0495607_0082932_370_801 143
256 3300046506 Ga0495583_0000243 Ga0495583_0000243_70606_71037 143
257 3300046506 Ga0495583_0047190 Ga0495583_0047190_646_1077 143
258 3300046506 Ga0495583_0063357 Ga0495583_0063357_245_676 143
259 3300046506 Ga0495583_0113374 Ga0495583_0113374_44_475 143
260 3300046506 Ga0495583_0350981 Ga0495583_0350981_132_563 143
261 3300046507 Ga0495606_0000007 Ga0495606_0000007_7469_7900 143
262 3300046507 Ga0495606_0002422 Ga0495606_0002422_6734_7165 143
263 3300046507 Ga0495606_0007080 Ga0495606_0007080_6835_7266 143
264 3300046507 Ga0495606_0130584 Ga0495606_0130584_927_1358 143
265 3300046507 Ga0495606_0312474 Ga0495606_0312474_69_500 143
266 3300046507 Ga0495606_0386191 Ga0495606_0386191_221_652 143
267 3300046507 Ga0495606_0482466 Ga0495606_0482466_12_443 143
268 3300046513 Ga0495616_0001965 Ga0495616_0001965_6256_6687 143
269 3300046513 Ga0495616_0003136 Ga0495616_0003136_573_1004 143
270 3300046513 Ga0495616_0016747 Ga0495616_0016747_2284_2715 143
271 3300046515 Ga0495620_0013452 Ga0495620_0013452_3073_3504 143
272 3300046517 Ga0495630_0124497 Ga0495630_0124497_459_890 143
273 3300046518 Ga0495631_0016809 Ga0495631_0016809_2899_3330 143
274 3300046518 Ga0495631_0036239 Ga0495631_0036239_512_943 143
275 3300046518 Ga0495631_0086786 Ga0495631_0086786_12_443 143
276 3300046519 Ga0495632_0008938 Ga0495632_0008938_2951_3382 143
277 3300046523 Ga0495644_0005607 Ga0495644_0005607_2325_2756 143
278 3300046523 Ga0495644_0014170 Ga0495644_0014170_1151_1582 143
279 3300046523 Ga0495644_0017126 Ga0495644_0017126_1187_1618 143
280 3300046524 Ga0495648_0000027 Ga0495648_0000027_33372_33803 143
281 3300046524 Ga0495648_0352822 Ga0495648_0352822_74_505 143
282 3300046525 Ga0495663_0009529 Ga0495663_0009529_1060_1491 143
283 3300046526 Ga0495666_0054089 Ga0495666_0054089_446_910 143
284 3300046528 Ga0495642_0014298 Ga0495642_0014298_1371_1802 143
285 3300046528 Ga0495642_0016837 Ga0495642_0016837_1256_1687 143
286 3300046528 Ga0495642_0018263 Ga0495642_0018263_400_831 143
287 3300046528 Ga0495642_0022804 Ga0495642_0022804_1975_2406 143
288 3300046528 Ga0495642_0035876 Ga0495642_0035876_810_1241 143
289 3300046528 Ga0495642_0040375 Ga0495642_0040375_159_590 143
290 3300046529 Ga0495652_0181462 Ga0495652_0181462_792_1223 143
291 3300046531 Ga0495665_0030952 Ga0495665_0030952_1041_1568 143
292 3300046535 Ga0495586_0003444 Ga0495586_0003444_7068_7499 143
293 3300046535 Ga0495586_0222584 Ga0495586_0222584_176_607 143
294 3300046536 Ga0495587_0016122 Ga0495587_0016122_3141_3572 143
295 3300046538 Ga0495609_0013964 Ga0495609_0013964_2519_2950 143
296 3300046538 Ga0495609_0020752 Ga0495609_0020752_1633_2064 143
297 3300046538 Ga0495609_0046995 Ga0495609_0046995_1468_1899 143
298 3300046542 Ga0495597_0002529 Ga0495597_0002529_9222_9656 143
299 3300046542 Ga0495597_0014460 Ga0495597_0014460_2293_2724 143
300 3300046542 Ga0495597_0020178 Ga0495597_0020178_1471_1902 143
301 3300046542 Ga0495597_0133827 Ga0495597_0133827_262_693 143
302 3300046558 Ga0495633_0001149 Ga0495633_0001149_17194_17625 143
303 3300046558 Ga0495633_0002223 Ga0495633_0002223_5536_5967 143
304 3300046558 Ga0495633_0006006 Ga0495633_0006006_5896_6327 143
305 3300046558 Ga0495633_0011306 Ga0495633_0011306_4201_4632 143
306 3300046558 Ga0495633_0102471 Ga0495633_0102471_800_1231 143
307 3300046558 Ga0495633_0104564 Ga0495633_0104564_322_753 143
308 3300046558 Ga0495633_0141866 Ga0495633_0141866_90_521 143
309 3300046559 Ga0495667_0302650 Ga0495667_0302650_12_443 143
310 3300046616 Ga0495668_0001158 Ga0495668_0001158_8607_9038 143
311 3300046616 Ga0495668_0013245 Ga0495668_0013245_3821_4252 143
312 3300046616 Ga0495668_0167213 Ga0495668_0167213_344_775 143
313 3300046642 Ga0495634_0256493 Ga0495634_0256493_606_1037 143
314 3300046648 Ga0495611_0008688 Ga0495611_0008688_3657_4088 143
315 3300046648 Ga0495611_0010419 Ga0495611_0010419_1594_2025 143
316 3300046648 Ga0495611_0074392 Ga0495611_0074392_532_963 143
317 3300046648 Ga0495611_0283063 Ga0495611_0283063_281_712 143
318 3300046660 Ga0495625_0004536 Ga0495625_0004536_969_1400 143
319 3300046660 Ga0495625_0333550 Ga0495625_0333550_436_867 143
320 3300046664 Ga0495659_0000073 Ga0495659_0000073_30202_30636 143
321 3300046665 Ga0495661_0003466 Ga0495661_0003466_1098_1529 143
322 3300046665 Ga0495661_0004136 Ga0495661_0004136_1925_2356 143
323 3300046665 Ga0495661_0012195 Ga0495661_0012195_2749_3180 143
324 3300046665 Ga0495661_0595537 Ga0495661_0595537_32_463 143
325 3300046674 Ga0495588_0010291 Ga0495588_0010291_2774_3205 143
326 3300046674 Ga0495588_0058716 Ga0495588_0058716_885_1412 143
327 3300046680 Ga0495646_0197506 Ga0495646_0197506_464_895 143
328 3300046684 Ga0495669_0001061 Ga0495669_0001061_2163_2594 143
329 3300046684 Ga0495669_0162978 Ga0495669_0162978_460_891 143
330 3300046689 Ga0495613_0621854 Ga0495613_0621854_262_693 143
331 3300046689 Ga0495613_0703903 Ga0495613_0703903_19_450 143
332 3300046691 Ga0495670_0001340 Ga0495670_0001340_9785_10216 143
333 3300046691 Ga0495670_0007060 Ga0495670_0007060_2239_2670 143
334 3300046691 Ga0495670_0018487 Ga0495670_0018487_898_1329 143
335 3300046691 Ga0495670_0033609 Ga0495670_0033609_718_1149 143
336 3300046691 Ga0495670_0148087 Ga0495670_0148087_367_798 143
337 3300046691 Ga0495670_0148463 Ga0495670_0148463_328_759 143
338 3300046692 Ga0495671_0000309 Ga0495671_0000309_6735_7169 143
339 3300046692 Ga0495671_0255589 Ga0495671_0255589_136_567 143
340 3300046694 Ga0495649_0260155 Ga0495649_0260155_373_804 143
341 3300046794 Ga0495589_0016792 Ga0495589_0016792_1796_2227 143
342 3300046809 Ga0495600_0011618 Ga0495600_0011618_3295_3726 143
343 3300046810 Ga0495660_0038771 Ga0495660_0038771_1421_1852 143
344 3300047315 Ga0495581_0007398 Ga0495581_0007398_2742_3173 143
345 3300047315 Ga0495581_0293039 Ga0495581_0293039_293_724 143
346 3300047317 Ga0495604_0612053 Ga0495604_0612053_256_687 143
347 3300047318 Ga0495636_0006381 Ga0495636_0006381_4004_4435 143
348 3300047318 Ga0495636_0155287 Ga0495636_0155287_288_719 143
349 3300047319 Ga0495674_0004869 Ga0495674_0004869_11742_12173 143
350 3300047320 Ga0495672_0003403 Ga0495672_0003403_5264_5698 143
351 3300047321 Ga0495676_0024471 Ga0495676_0024471_3506_3937 143
352 3300047321 Ga0495676_0094874 Ga0495676_0094874_480_944 143
353 3300047321 Ga0495676_0175449 Ga0495676_0175449_1024_1455 143
354 3300047321 Ga0495676_0245992 Ga0495676_0245992_82_513 143
355 3300047322 Ga0495680_0593723 Ga0495680_0593723_284_715 143
356 3300047323 Ga0495683_0001075 Ga0495683_0001075_15065_15496 143
357 3300047323 Ga0495683_0031854 Ga0495683_0031854_970_1401 143
358 3300047323 Ga0495683_0054664 Ga0495683_0054664_690_1121 143
359 3300047443 Ga0495687_078702 Ga0495687_078702_188_619 143
360 3300047444 Ga0495675_0055692 Ga0495675_0055692_844_1275 143
361 3300047444 Ga0495675_0224116 Ga0495675_0224116_11_442 143
362 3300047445 Ga0495677_0003862 Ga0495677_0003862_4079_4510 143
363 3300047445 Ga0495677_0005249 Ga0495677_0005249_1581_2012 143
364 3300047447 Ga0495685_008678 Ga0495685_008678_233_664 143
365 3300047470 Ga0495681_0009074 Ga0495681_0009074_2315_2746 143
366 3300047470 Ga0495681_0102498 Ga0495681_0102498_316_747 143
367 3300047470 Ga0495681_0124813 Ga0495681_0124813_101_604 143
368 3300047472 Ga0495686_0012569 Ga0495686_0012569_191_625 143
369 3300047472 Ga0495686_0126349 Ga0495686_0126349_1051_1482 143
370 3300047673 Ga0495593_0003662 Ga0495593_0003662_1654_2085 143
371 3300047673 Ga0495593_0038742 Ga0495593_0038742_593_1024 143
372 3300048088 Ga0495602_0268792 Ga0495602_0268792_76_507 143
373 3300048089 Ga0495614_0051543 Ga0495614_0051543_1019_1450 143
374 3300048091 Ga0495626_0001690 Ga0495626_0001690_8446_8949 143
375 3300048091 Ga0495626_0012242 Ga0495626_0012242_3852_4283 143
376 3300048091 Ga0495626_0018066 Ga0495626_0018066_2564_2995 143
377 3300048091 Ga0495626_0096005 Ga0495626_0096005_646_1077 143
378 3300048091 Ga0495626_0111824 Ga0495626_0111824_395_826 143
379 3300048091 Ga0495626_0207607 Ga0495626_0207607_128_559 143
380 3300048091 Ga0495626_0406487 Ga0495626_0406487_73_504 143
381 3300048907 Ga0496104_0063741 Ga0496104_0063741_2766_3197 143
382 3300048908 Ga0496105_0008341 Ga0496105_0008341_4965_5396 143
383 3300048918 Ga0496115_0049883 Ga0496115_0049883_648_1079 143
384 3300048918 Ga0496115_0193775 Ga0496115_0193775_1067_1498 143
385 3300048920 Ga0496117_0003585 Ga0496117_0003585_17273_17704 143
386 3300048920 Ga0496117_0021335 Ga0496117_0021335_1679_2110 143
387 3300048920 Ga0496117_0035225 Ga0496117_0035225_2797_3228 143
388 3300048920 Ga0496117_0123691 Ga0496117_0123691_487_918 143
389 3300048921 Ga0496118_0000065 Ga0496118_0000065_130390_130821 143
390 3300048921 Ga0496118_0002920 Ga0496118_0002920_21715_22146 143
391 3300048921 Ga0496118_0009252 Ga0496118_0009252_6769_7200 143
392 3300048921 Ga0496118_0015155 Ga0496118_0015155_3897_4328 143
393 3300048922 Ga0496119_0002015 Ga0496119_0002015_19765_20196 143
394 3300048922 Ga0496119_0057543 Ga0496119_0057543_1189_1620 143
395 3300048923 Ga0496120_0000505 Ga0496120_0000505_19765_20196 143
396 3300048923 Ga0496120_0002370 Ga0496120_0002370_13254_13685 143
397 3300048924 Ga0496121_0000550 Ga0496121_0000550_56753_57184 143
398 3300048924 Ga0496121_0064903 Ga0496121_0064903_744_1175 143
399 3300048924 Ga0496121_0262171 Ga0496121_0262171_440_871 143
400 3300048924 Ga0496121_0415042 Ga0496121_0415042_125_556 143
401 3300048929 Ga0496126_0013046 Ga0496126_0013046_2800_3231 143
402 3300048929 Ga0496126_0194317 Ga0496126_0194317_37_468 143
403 3300049459 Ga0495678_192470 Ga0495678_192470_172_606 143
404 3300049460 Ga0495682_0017962 Ga0495682_0017962_1471_1902 143
405 3300049460 Ga0495682_0022141 Ga0495682_0022141_659_1090 143
406 3300049568 Ga0501031_0030289 Ga0501031_0030289_1277_1708 143
407 3300049569 Ga0501032_0041546 Ga0501032_0041546_2078_2509 143
408 3300049570 Ga0501033_0095897 Ga0501033_0095897_885_1316 143
409 3300049570 Ga0501033_0435139 Ga0501033_0435139_12_443 143
410 3300049571 Ga0501034_0291624 Ga0501034_0291624_653_1084 143
411 3300049573 Ga0501037_0039383 Ga0501037_0039383_1287_1718 143
412 3300049574 Ga0501038_0222674 Ga0501038_0222674_711_1142 143
413 3300049575 Ga0501039_0169133 Ga0501039_0169133_612_1043 143
414 3300049576 Ga0501040_0070832 Ga0501040_0070832_173_604 143
415 3300049578 Ga0501042_0627309 Ga0501042_0627309_243_674 143
416 3300049579 Ga0501043_0072147 Ga0501043_0072147_1024_1455 143
417 3300049579 Ga0501043_0079720 Ga0501043_0079720_221_652 143
418 3300049579 Ga0501043_0141974 Ga0501043_0141974_589_1020 143
419 3300049580 Ga0501046_0128790 Ga0501046_0128790_1279_1710 143
420 3300049581 Ga0501047_0050453 Ga0501047_0050453_450_881 143
421 3300049581 Ga0501047_0121118 Ga0501047_0121118_916_1347 143
422 3300049582 Ga0501048_0042083 Ga0501048_0042083_1216_1647 143
423 3300049582 Ga0501048_1405833 Ga0501048_1405833_52_483 143
424 3300049586 Ga0501070_0018622 Ga0501070_0018622_1379_1810 143
425 3300049589 Ga0501073_0063896 Ga0501073_0063896_443_874 143
426 3300049590 Ga0501074_0312157 Ga0501074_0312157_56_487 143
427 3300049742 Ga0501080_0079225 Ga0501080_0079225_875_1306 143
428 3300049822 Ga0501035_0090095 Ga0501035_0090095_470_901 143
429 3300049822 Ga0501035_0289522 Ga0501035_0289522_303_734 143
430 3300049823 Ga0501044_0093446 Ga0501044_0093446_1937_2368 143
431 3300049823 Ga0501044_0102111 Ga0501044_0102111_1524_1955 143
432 3300049823 Ga0501044_0114757 Ga0501044_0114757_1615_2046 143
433 3300049823 Ga0501044_0402322 Ga0501044_0402322_450_881 143
434 3300049824 Ga0501045_0092308 Ga0501045_0092308_1387_1818 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

37

174

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.8978 21 139
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.756 21 139
6oh4-assembly2.cif.gz_B x-ray crystal structure of the mouse cmp-sialic acid transporter in complex with cmp, by hanging drop vapor diffusion 0.7392 14 139
5y79-assembly1.cif.gz_B crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate 0.6861 15 136
5hx1-assembly2.cif.gz_B crystal structure of dr2231_e46a mutant in complex with dump and magnesium 0.6651 97 140
ID Description Score Start End Superfamily
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8002 17 142 1.20.1740.10
af_P69210_8_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7627 71 142 1.10.3730.20
af_P27844_148_285_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.7513 5 140 1.25.10.10
af_P69212_3_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.747 78 140 1.10.3730.20
af_P27844_148_285_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.7374 5 140 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A7L8ALB2-F1-model_v4 deleted 0.9819 5 140
AF-A0A7Z8LQS4-F1-model_v4 deleted 0.9816 5 140
AF-A0A7U8P779-F1-model_v4 deleted 0.9782 13 140
AF-A0A837CND4-F1-model_v4 EamA domain-containing protein 0.9731 3 140 GO:0016020
AF-A0A840RW37-F1-model_v4 Transporter family protein 0.9715 1 142 GO:0016020

Feature Viewer

pLDDT pTM Quality
91.52 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map