F443142

General Info

Members Datasets Scaffolds Average Seq Length
434 253 376 337

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0024128|Ga0451577_0024128_2909_4012
Length 367
Sequence VADPGLKSGVLLFLHLNYAAMNLKKRCEAFAELGSLLRKTISDIGRGEKTDMDQLIRSQYNKNQWFTSENVIAAISAVADELTPGNLEKWTSMYPELENSSEKHNVGVIMAGNIPLVGFHDFLCVLITGNKLIARTSSKDSDLIVYISELLCSINNEFREMINFTEGTLTGFDAVIATGSNNTSRYFEYYFGKYPHIIRKNRNSIAILDGTETYDEIKELGKDIFSYFGLGCRNVSKIYLPEGYDIANLTRCWNDYSPVAMNSKYANNYDYYKAIFLVNREPFTDTGYLLMKEDKKIASPVAVLYYEYFSTYGNLIKEIKLIEENIQCTVSKNHTPFGQAQKPALWEYADGIDTIEFLLKKKSPGRL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
4 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
5 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
6 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
7 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
8 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
9 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
10 2738541284 Pedobacter sp. YR016 Isolate Unclassified
11 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
12 2738541302 Pedobacter sp. CF074 Isolate Unclassified
13 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
14 2738543023 Pedobacter sp. OK628 Isolate Unclassified
15 2739367651 Pedobacter sp. OK291 Isolate Unclassified
16 2739367663 Pedobacter sp. YR510 Isolate Unclassified
17 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
18 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
19 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
20 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
21 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
22 2818991437 Pedobacter terrae 518 Isolate Unclassified
23 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
24 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
25 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
26 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
27 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
28 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
29 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
30 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
31 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
32 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
33 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
34 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
35 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
36 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
37 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
38 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
39 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
40 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
41 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
42 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
43 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
44 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
45 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
46 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
47 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
48 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
49 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
50 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
51 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
52 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
53 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
54 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
55 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
56 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
57 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
58 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
59 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
60 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
61 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
62 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
63 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
64 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
65 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
66 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
67 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
68 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
69 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
70 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
71 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
72 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
73 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
74 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
75 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
76 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
77 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
78 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
79 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
80 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
81 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
82 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
83 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
84 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
85 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
86 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
87 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
90 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
95 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
96 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
97 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
105 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
106 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
107 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
132 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
133 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
136 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
137 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
168 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
174 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
175 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
178 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
190 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
193 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
200 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
201 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
202 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
207 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
210 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
213 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
214 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
215 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
218 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
219 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
220 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
225 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
226 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
227 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
228 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
229 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
230 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
231 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
232 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
233 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
234 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
235 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
240 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
241 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
242 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
243 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
244 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
245 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
246 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
247 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
248 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
249 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
250 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
251 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
252 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
253 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.41
Metatranscriptomes 0
Isolates 13.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.3
Nodule 0.92
Rhizoplane 0.92
Rhizosphere 78.34
Stem 0
Stem Tuber 0
Unclassified 14.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1762647 2162886007 Bacteria 207340
2 SwRhRL2b_contig_1858013 2162886007 Bacteria 9768
3 JGI24736J21556_1005036 3300001904 Bacteria 2238
4 JGI24740J21852_10011936 3300001979 Bacteria 3290
5 JGI24737J22298_10008833 3300001990 Bacteria 3364
6 JGI25162J39368_1000011 3300002737 Bacteria 379156
7 rootH1_10000689 3300003316 Bacteria 16557
8 rootH1_10050627 3300003316 Bacteria 16709
9 rootH1_10050627 3300003323 Bacteria 8158
10 rootH1_10127305 3300003316 Bacteria 4347
11 rootH2_10018544 3300003320 Bacteria 61980
12 rootH2_10030116 3300003320 Bacteria 9853
13 rootH2_10173457 3300003320 Bacteria 6600
14 rootL2_10037352 3300003322 Bacteria 16890
15 rootL2_10039107 3300003322 Bacteria 4224
16 rootL2_10049321 3300003322 Bacteria 3120
17 rootL2_10085583 3300003322 Bacteria 1836
18 rootL2_10108158 3300003322 Bacteria 2311
19 rootL2_10266281 3300003322 Eukaryota 1344
20 rootH1_10011373 3300003323 Bacteria 34922
21 rootH1_10029472 3300003323 Bacteria 17623
22 rootH1_10044583 3300003323 Bacteria 3331
23 rootH1_10052672 3300003323 Bacteria 6549
24 rootH1_10057524 3300003323 Bacteria 3691
25 rootH1_10057911 3300003323 Bacteria 3005
26 rootH1_10060174 3300003323 Bacteria 5376
27 rootH1_10060268 3300003323 Bacteria 1722
28 rootH1_10138065 3300003323 Bacteria 6812
29 rootH1_10149597 3300003323 Bacteria 2975
30 rootH1_10180666 3300003323 Unclassified 1380
31 Ga0055536_1000001 3300003781 Bacteria 630663
32 Ga0055531_10000201 3300003794 Bacteria 65910
33 Ga0065165_1001124 3300005262 Bacteria 31527
34 Ga0065714_10003290 3300005288 Bacteria 9457
35 Ga0065714_10013268 3300005288 Bacteria 3909
36 Ga0065714_10064863 3300005288 Bacteria 16719
37 Ga0065714_10075400 3300005288 Bacteria 2912
38 Ga0065714_10094205 3300005288 Bacteria 1823
39 Ga0065714_10126133 3300005288 Bacteria 1292
40 Ga0065704_10000210 3300005289 Bacteria 93612
41 Ga0065704_10070151 3300005289 Bacteria 259038
42 Ga0065704_10170266 3300005289 Bacteria 1296
43 Ga0070658_10000049 3300005327 Bacteria 119985
44 Ga0070676_10020593 3300005328 Bacteria 3685
45 Ga0070676_10025038 3300005328 Bacteria 3369
46 Ga0070683_100117837 3300005329 Bacteria 2507
47 Ga0070670_100064759 3300005331 Bacteria 3136
48 Ga0068869_100005895 3300005334 Bacteria 7737
49 Ga0068869_100034748 3300005334 Bacteria 3568
50 Ga0070666_10000131 3300005335 Bacteria 52822
51 Ga0070666_10077221 3300005335 Bacteria 2273
52 Ga0070682_100167438 3300005337 Bacteria 1524
53 Ga0068868_100006177 3300005338 Bacteria 8474
54 Ga0068868_100139804 3300005338 Bacteria 1987
55 Ga0070660_100006716 3300005339 Bacteria 7982
56 Ga0070661_100306833 3300005344 Bacteria 1236
57 Ga0070669_100139869 3300005353 Bacteria 1865
58 Ga0070675_100047572 3300005354 Bacteria 3514
59 Ga0070671_100009348 3300005355 Bacteria 7871
60 Ga0070671_100027520 3300005355 Bacteria 4680
61 Ga0070671_100267963 3300005355 Bacteria 1452
62 Ga0070673_100017631 3300005364 Bacteria 5083
63 Ga0070673_100141286 3300005364 Bacteria 2031
64 Ga0070688_100199584 3300005365 Bacteria 1399
65 Ga0070667_100202017 3300005367 Bacteria 1764
66 Ga0070667_100300408 3300005367 Bacteria 1445
67 Ga0070700_100317605 3300005441 Bacteria 1143
68 Ga0070662_100000030 3300005457 Bacteria 81418
69 Ga0070662_100004861 3300005457 Bacteria 8522
70 Ga0070698_100012636 3300005471 Bacteria 8940
71 Ga0070684_100079225 3300005535 Bacteria 2904
72 Ga0068853_100289912 3300005539 Bacteria 1511
73 Ga0068853_100382096 3300005539 Bacteria 1315
74 Ga0070672_100090704 3300005543 Bacteria 2465
75 Ga0070695_100253401 3300005545 Bacteria 1282
76 Ga0068855_100073079 3300005563 Bacteria 3985
77 Ga0068854_100030159 3300005578 Bacteria 3760
78 Ga0068854_100078537 3300005578 Bacteria 2432
79 Ga0068854_100079181 3300005578 Bacteria 2422
80 Ga0068856_100000835 3300005614 Bacteria 33215
81 Ga0068856_100214276 3300005614 Bacteria 1941
82 Ga0068859_100103559 3300005617 Bacteria 2904
83 Ga0068864_100035911 3300005618 Bacteria 4221
84 Ga0068864_100038143 3300005618 Bacteria 4102
85 Ga0068863_100119491 3300005841 Bacteria 2512
86 Ga0068858_100286328 3300005842 Bacteria 1570
87 Ga0068858_100327756 3300005842 Bacteria 1464
88 Ga0068860_100007709 3300005843 Bacteria 10765
89 Ga0068862_100021173 3300005844 Bacteria 5436
90 Ga0097621_100143679 3300006237 Bacteria 2041
91 Ga0068871_100041103 3300006358 Bacteria 3706
92 Ga0068871_100480230 3300006358 Bacteria 1118
93 Ga0075434_100252671 3300006871 Bacteria 1782
94 Ga0097620_100103555 3300006931 Bacteria 2904
95 Ga0079104_1001101 3300006946 Bacteria 20054
96 Ga0099826_10017781 3300006948 Bacteria 5371
97 Ga0105251_10040800 3300009011 Bacteria 2262
98 Ga0105244_10000003 3300009036 Bacteria 494610
99 Ga0105240_10112883 3300009093 Bacteria 3284
100 Ga0105240_10564141 3300009093 Bacteria 1258
101 Ga0111539_10016935 3300009094 Bacteria 9022
102 Ga0111539_10021415 3300009094 Bacteria 7957
103 Ga0105241_10012764 3300009174 Bacteria 6165
104 Ga0105241_10045552 3300009174 Bacteria 3328
105 Ga0105242_10195497 3300009176 Bacteria 1793
106 Ga0105237_10000224 3300009545 Bacteria 79854
107 Ga0105249_10016990 3300009553 Bacteria 6455
108 Ga0105239_10000002 3300010375 Bacteria 610298
109 Ga0105239_10180445 3300010375 Bacteria 2362
110 Ga0105239_10335426 3300010375 Unclassified 1706
111 Ga0105239_10422040 3300010375 Bacteria 1511
112 Ga0105246_10172737 3300011119 Bacteria 1657
113 Ga0157373_10000012 3300013100 Bacteria 188666
114 Ga0157373_10000821 3300013100 Bacteria 24074
115 Ga0157373_10009016 3300013100 Bacteria 7381
116 Ga0157373_10038091 3300013100 Bacteria 3446
117 Ga0157373_10185934 3300013100 Bacteria 1463
118 Ga0157371_10000016 3300013102 Bacteria 330495
119 Ga0157371_10000135 3300013102 Bacteria 107607
120 Ga0157371_10001915 3300013102 Bacteria 20795
121 Ga0157371_10002407 3300013102 Bacteria 17905
122 Ga0157371_10003683 3300013102 Bacteria 13759
123 Ga0157371_10009053 3300013102 Bacteria 7872
124 Ga0157371_10009366 3300013102 Bacteria 7714
125 Ga0157371_10139950 3300013102 Bacteria 1724
126 Ga0157371_10244056 3300013102 Bacteria 1292
127 Ga0157370_10000451 3300013104 Bacteria 51369
128 Ga0157370_10000700 3300013104 Bacteria 41896
129 Ga0157370_10001048 3300013104 Bacteria 34816
130 Ga0157370_10001740 3300013104 Bacteria 26790
131 Ga0157370_10013319 3300013104 Bacteria 8471
132 Ga0157370_10016704 3300013104 Bacteria 7427
133 Ga0157370_10024879 3300013104 Bacteria 5928
134 Ga0157370_10055735 3300013104 Bacteria 3764
135 Ga0157370_10059844 3300013104 Bacteria 3619
136 Ga0157370_10076685 3300013104 Bacteria 3149
137 Ga0157369_10000129 3300013105 Bacteria 108473
138 Ga0157369_10000475 3300013105 Bacteria 53219
139 Ga0157369_10005279 3300013105 Bacteria 15056
140 Ga0157369_10125203 3300013105 Bacteria 2725
141 Ga0157369_10136822 3300013105 Bacteria 2593
142 Ga0157369_10243169 3300013105 Bacteria 1879
143 Ga0157374_10000203 3300013296 Bacteria 54699
144 Ga0157374_10010367 3300013296 Bacteria 8017
145 Ga0157374_10031507 3300013296 Bacteria 4820
146 Ga0157378_10055996 3300013297 Bacteria 3513
147 Ga0163162_10000186 3300013306 Bacteria 57565
148 Ga0163162_10004931 3300013306 Bacteria 12864
149 Ga0163162_10014484 3300013306 Bacteria 7705
150 Ga0163162_10035563 3300013306 Bacteria 4962
151 Ga0163162_10220652 3300013306 Bacteria 2026
152 Ga0163162_10347394 3300013306 Bacteria 1616
153 Ga0157372_10000017 3300013307 Bacteria 219543
154 Ga0157372_10000061 3300013307 Bacteria 119814
155 Ga0157372_10002526 3300013307 Bacteria 19845
156 Ga0157372_10016734 3300013307 Bacteria 7871
157 Ga0157372_10050616 3300013307 Bacteria 4620
158 Ga0157372_10102804 3300013307 Bacteria 3264
159 Ga0157372_10294096 3300013307 Bacteria 1889
160 Ga0157375_10051809 3300013308 Bacteria 4033
161 Ga0157375_10054320 3300013308 Bacteria 3945
162 Ga0157375_10266750 3300013308 Bacteria 1874
163 Ga0157375_10379050 3300013308 Bacteria 1581
164 Ga0157375_10748007 3300013308 Bacteria 1129
165 Ga0163163_10123615 3300014325 Bacteria 2623
166 Ga0157380_10000348 3300014326 Bacteria 27709
167 Ga0182008_10000006 3300014497 Bacteria 378521
168 Ga0182008_10002060 3300014497 Bacteria 12878
169 Ga0182008_10076487 3300014497 Bacteria 1647
170 Ga0157377_10019977 3300014745 Bacteria 3503
171 Ga0157377_10298384 3300014745 Bacteria 1062
172 Ga0157379_10030460 3300014968 Bacteria 4803
173 Ga0157379_10259555 3300014968 Bacteria 1578
174 Ga0157376_10026576 3300014969 Bacteria 4577
175 Ga0182006_1002952 3300015261 Bacteria 8994
176 Ga0182006_1005181 3300015261 Bacteria 6251
177 Ga0182006_1006254 3300015261 Bacteria 5549
178 Ga0182006_1063730 3300015261 Bacteria 1384
179 Ga0182006_1063731 3300015261 Bacteria 1384
180 Ga0182007_10000003 3300015262 Bacteria 548244
181 Ga0182007_10035586 3300015262 Bacteria 1678
182 Ga0183373_1001 3300015682 Bacteria 1410374
183 Ga0163161_10000074 3300017792 Bacteria 101784
184 Ga0163161_10000177 3300017792 Bacteria 58594
185 Ga0163161_10001686 3300017792 Bacteria 16215
186 Ga0163161_10009952 3300017792 Bacteria 6587
187 Ga0163161_10027487 3300017792 Bacteria 4036
188 Ga0163161_10190196 3300017792 Bacteria 1578
189 Ga0213876_10009668 3300021384 Bacteria 5190
190 Ga0209026_1007986 3300025250 Bacteria 2280
191 Ga0209676_1000008 3300025292 Bacteria 991778
192 Ga0209050_1000045 3300025298 Bacteria 388022
193 Ga0209050_1003017 3300025298 Bacteria 13054
194 Ga0209257_1000005 3300025304 Bacteria 1592528
195 Ga0207655_1000010 3300025728 Bacteria 649325
196 Ga0207647_10000247 3300025904 Bacteria 44109
197 Ga0207647_10011512 3300025904 Bacteria 6202
198 Ga0207645_10004216 3300025907 Bacteria 10675
199 Ga0207645_10021988 3300025907 Bacteria 4154
200 Ga0207705_10000079 3300025909 Bacteria 119999
201 Ga0207654_10083486 3300025911 Bacteria 1929
202 Ga0207695_10025505 3300025913 Bacteria 6615
203 Ga0207695_10064738 3300025913 Bacteria 3762
204 Ga0207695_10105899 3300025913 Bacteria 2799
205 Ga0207695_10224575 3300025913 Bacteria 1785
206 Ga0207671_10000102 3300025914 Bacteria 130461
207 Ga0207671_10000272 3300025914 Bacteria 77080
208 Ga0207657_10034980 3300025919 Bacteria 4509
209 Ga0207649_10221531 3300025920 Bacteria 1348
210 Ga0207652_10071535 3300025921 Bacteria 3014
211 Ga0207644_10031365 3300025931 Bacteria 3702
212 Ga0207644_10032555 3300025931 Bacteria 3638
213 Ga0207706_10000129 3300025933 Bacteria 81280
214 Ga0207706_10002616 3300025933 Bacteria 17530
215 Ga0207704_10095431 3300025938 Bacteria 1966
216 Ga0207691_10034399 3300025940 Bacteria 4712
217 Ga0207689_10010592 3300025942 Bacteria 7941
218 Ga0207689_10318284 3300025942 Bacteria 1291
219 Ga0207679_10125398 3300025945 Bacteria 2051
220 Ga0207679_10206085 3300025945 Unclassified 1646
221 Ga0207651_10092368 3300025960 Bacteria 2219
222 Ga0207651_10403825 3300025960 Bacteria 1163
223 Ga0207640_10078004 3300025981 Bacteria 2253
224 Ga0207640_10132573 3300025981 Bacteria 1803
225 Ga0207677_10007221 3300026023 Bacteria 6124
226 Ga0207677_10033044 3300026023 Bacteria 3332
227 Ga0207677_10114387 3300026023 Bacteria 2016
228 Ga0207703_10078855 3300026035 Bacteria 2738
229 Ga0207703_10275496 3300026035 Bacteria 1526
230 Ga0207639_10261810 3300026041 Bacteria 1513
231 Ga0207678_10233030 3300026067 Bacteria 1577
232 Ga0207702_10000196 3300026078 Bacteria 71703
233 Ga0207702_10330970 3300026078 Bacteria 1453
234 Ga0207648_10026160 3300026089 Bacteria 5188
235 Ga0207648_10077000 3300026089 Bacteria 2907
236 Ga0207676_10093529 3300026095 Bacteria 2475
237 Ga0207674_10335964 3300026116 Bacteria 1461
238 Ga0207698_10415733 3300026142 Bacteria 1289
239 Ga0209281_1000156 3300027111 Bacteria 163207
240 Ga0209968_1000562 3300027526 Bacteria 5744
241 Ga0209282_1026074 3300027666 Bacteria 3646
242 Ga0268265_10026183 3300028380 Bacteria 4147
243 Ga0268265_10252050 3300028380 Bacteria 1564
244 Ga0268264_10009106 3300028381 Bacteria 8232
245 Ga0268264_10129403 3300028381 Bacteria 2236
246 Ga0265338_10053615 3300028800 Bacteria 3605
247 Ga0265338_10235998 3300028800 Bacteria 1357
248 Ga0316177_1197492 3300030731 Bacteria 24690
249 Ga0316176_1064606 3300030732 Bacteria 3032
250 Ga0316183_1096868 3300030742 Bacteria 33618
251 Ga0265327_10000930 3300031251 Bacteria 42884
252 Ga0316576_10012973 3300031727 Bacteria 5519
253 Ga0316576_10017487 3300031727 Bacteria 4873
254 Ga0316576_10039244 3300031727 Bacteria 3398
255 Ga0316578_10026765 3300031728 Bacteria 3254
256 Ga0307405_10000003 3300031731 Bacteria 569064
257 Ga0307405_10022946 3300031731 Bacteria 3537
258 Ga0307410_10000055 3300031852 Bacteria 40536
259 Ga0307406_10000009 3300031901 Bacteria 119997
260 Ga0307407_10000008 3300031903 Bacteria 191228
261 Ga0307407_10002757 3300031903 Bacteria 6993
262 Ga0307412_10000427 3300031911 Bacteria 25500
263 Ga0307412_10024582 3300031911 Bacteria 3720
264 Ga0307412_10387999 3300031911 Bacteria 1133
265 Ga0307409_100007951 3300031995 Bacteria 6389
266 Ga0307409_100287416 3300031995 Bacteria 1523
267 Ga0307416_100000009 3300032002 Bacteria 374271
268 Ga0307416_100001158 3300032002 Bacteria 14168
269 Ga0307416_100388492 3300032002 Bacteria 1429
270 Ga0307414_10000001 3300032004 Bacteria 1352954
271 Ga0307414_10000452 3300032004 Bacteria 21710
272 Ga0307414_10000600 3300032004 Bacteria 18575
273 Ga0307414_10024304 3300032004 Bacteria 3862
274 Ga0307414_10035951 3300032004 Bacteria 3301
275 Ga0307414_10048246 3300032004 Bacteria 2936
276 Ga0307414_10071265 3300032004 Bacteria 2506
277 Ga0307414_10095427 3300032004 Bacteria 2222
278 Ga0307411_10000005 3300032005 Bacteria 391311
279 Ga0307415_100000517 3300032126 Bacteria 16833
280 Ga0307510_10034229 3300033180 Bacteria 5691
281 Ga0316574_0076458 3300035398 Bacteria 2121
282 Ga0373947_0017462 3300035725 Bacteria 4127
283 Ga0316582_0019583 3300036647 Unclassified 3965
284 Ga0316584_0020535 3300036712 Bacteria 4790
285 Ga0316584_0124757 3300036712 Bacteria 1923
286 Ga0316584_0190683 3300036712 Unclassified 1515
287 Ga0316584_0377947 3300036712 Bacteria 1013
288 Ga0395899_0000493 3300037312 Bacteria 44066
289 Ga0395898_0295763 3300037466 Bacteria 1545
290 Ga0395898_0410703 3300037466 Bacteria 1290
291 Ga0395905_0000003 3300037471 Bacteria 1347396
292 Ga0436365_1377856 3300039437 Bacteria 10058
293 Ga0436361_1146696 3300039447 Bacteria 7687
294 Ga0439447_000239 3300041407 Bacteria 19387
295 Ga0439466_0007256 3300041411 Bacteria 4195
296 Ga0451802_1821551 3300041460 Bacteria 1078
297 Ga0451849_0217799 3300041505 Bacteria 1593
298 Ga0451577_0000161 3300042876 Bacteria 146704
299 Ga0451577_0024128 3300042876 Bacteria 5533
300 Ga0451577_0130468 3300042876 Bacteria 2254
301 Ga0451577_0178370 3300042876 Bacteria 1915
302 Ga0453683_0000678 3300044673 Bacteria 36221
303 Ga0453683_0013407 3300044673 Bacteria 5352
304 Ga0453683_0033380 3300044673 Bacteria 3245
305 Ga0453683_0112941 3300044673 Bacteria 1709
306 Ga0466961_0049045 3300044693 Bacteria 2699
307 Ga0466964_0073671 3300044706 Unclassified 1450
308 Ga0453684_0000553 3300044712 Bacteria 141396
309 Ga0453684_0001372 3300044712 Bacteria 70492
310 Ga0453684_0012405 3300044712 Bacteria 14057
311 Ga0453684_0012636 3300044712 Bacteria 13881
312 Ga0453684_0028964 3300044712 Bacteria 7881
313 Ga0453684_0038853 3300044712 Bacteria 6495
314 Ga0453684_0046143 3300044712 Bacteria 5801
315 Ga0453684_0113357 3300044712 Bacteria 3289
316 Ga0453684_0141934 3300044712 Bacteria 2867
317 Ga0453684_0240146 3300044712 Bacteria 2086
318 Ga0453684_0344847 3300044712 Bacteria 1681
319 Ga0453684_0678802 3300044712 Bacteria 1121
320 Ga0451576_0000020 3300045051 Bacteria 529568
321 Ga0451576_0000952 3300045051 Bacteria 54377
322 Ga0451576_0005906 3300045051 Bacteria 15187
323 Ga0451576_0032735 3300045051 Bacteria 5530
324 Ga0451576_0040203 3300045051 Bacteria 4951
325 Ga0451576_0192702 3300045051 Bacteria 2129
326 Ga0466958_0046196 3300045836 Bacteria 2628
327 Ga0495627_002780 3300046453 Bacteria 8127
328 Ga0495638_0000003 3300046460 Bacteria 888792
329 Ga0495606_0026840 3300046507 Bacteria 4095
330 Ga0495606_0060735 3300046507 Bacteria 2420
331 Ga0495606_0078354 3300046507 Bacteria 2061
332 Ga0495610_0000523 3300046512 Bacteria 38598
333 Ga0495610_0002021 3300046512 Bacteria 17360
334 Ga0495643_0000620 3300046522 Bacteria 42297
335 Ga0495642_0130342 3300046528 Unclassified 1082
336 Ga0495625_0207229 3300046660 Bacteria 1290
337 Ga0495661_0002179 3300046665 Bacteria 15283
338 Ga0495636_0000053 3300047318 Bacteria 50598
339 Ga0495687_000516 3300047443 Bacteria 46369
340 Ga0495681_0090982 3300047470 Bacteria 1347
341 Ga0495686_0001934 3300047472 Bacteria 20630
342 Ga0496108_0511355 3300048911 Bacteria 1049
343 Ga0496115_0378981 3300048918 Bacteria 1151
344 Ga0496115_0420621 3300048918 Bacteria 1082
345 Ga0496116_0000041 3300048919 Bacteria 343299
346 Ga0496124_0005888 3300048927 Bacteria 13574
347 Ga0496125_0000036 3300048928 Bacteria 335814
348 Ga0496125_0233701 3300048928 Bacteria 1173
349 Ga0496126_0008262 3300048929 Bacteria 11239
350 Ga0501202_014215 3300049652 Bacteria 1522
351 Ga0501202_031001 3300049652 Bacteria 1115
352 Ga0501217_016020 3300049661 Bacteria 1712
353 Ga0501223_007466 3300049663 Bacteria 2238
354 Ga0501249_000003 3300049679 Bacteria 242930
355 Ga0501259_004338 3300049688 Bacteria 2258
356 Ga0501264_000061 3300049761 Bacteria 15261
357 Ga0501266_000025 3300049763 Bacteria 67199
358 Ga0501280_001707 3300049776 Bacteria 3888
359 Ga0501044_0124134 3300049823 Unclassified 2580
360 nmdc:mga08y16_210058_c1 3300050511 Bacteria 2016
361 nmdc:mga0n895_48775_c1 3300050512 Bacteria 4146
362 Ga0500646_0001897 3300053090 Bacteria 5475
363 Ga0500651_0000342 3300053093 Bacteria 26101
364 Ga0500641_0000030 3300053096 Bacteria 96500
365 Ga0500641_0000166 3300053096 Bacteria 24750
366 Ga0500641_0000396 3300053096 Bacteria 16176
367 Ga0500608_000271 3300053122 Bacteria 20029
368 Ga0500658_0000008 3300053134 Bacteria 273324
369 Ga0500604_0000768 3300053151 Bacteria 8819
370 Ga0500616_0000068 3300053153 Bacteria 235628
371 Ga0500616_0067238 3300053153 Bacteria 1838
372 Ga0500616_0130596 3300053153 Unclassified 1187
373 Ga0500622_0000014 3300053156 Bacteria 368189
374 Ga0500622_0000020 3300053156 Bacteria 271239
375 Ga0500622_0000403 3300053156 Bacteria 41386
376 Ga0500634_0117889 3300053161 Bacteria 1297

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003316 rootH1_10000689 rootH1_100006898 268
2 3300048911 Ga0496108_0511355 Ga0496108_0511355_25_843 269
3 3300041460 Ga0451802_1821551 Ga0451802_1821551_24_872 275
4 3300036647 Ga0316582_0019583 Ga0316582_0019583_81_947 276
5 3300036712 Ga0316584_0190683 Ga0316584_0190683_547_1410 276
6 3300036712 Ga0316584_0377947 Ga0316584_0377947_97_963 276
7 3300044712 Ga0453684_0678802 Ga0453684_0678802_184_1083 288
8 3300003322 rootL2_10039107 rootL2_100391075 299
9 3300006237 Ga0097621_100143679 Ga0097621_1001436792 299
10 3300005262 Ga0065165_1001124 Ga0065165_10011242 302
11 3300005334 Ga0068869_100005895 Ga0068869_1000058957 303
12 3300005364 Ga0070673_100141286 Ga0070673_1001412863 303
13 3300014968 Ga0157379_10259555 Ga0157379_102595552 303
14 3300028381 Ga0268264_10129403 Ga0268264_101294031 303
15 3300048918 Ga0496115_0420621 Ga0496115_0420621_104_1072 303
16 3300048918 Ga0496115_0378981 Ga0496115_0378981_10_948 305
17 3300044673 Ga0453683_0112941 Ga0453683_0112941_616_1677 307
18 3300005614 Ga0068856_100000835 Ga0068856_10000083529 308
19 3300026078 Ga0207702_10000196 Ga0207702_1000019663 308
20 3300044712 Ga0453684_0038853 Ga0453684_0038853_103_1164 308
21 2162886007 SwRhRL2b_contig_1858013 SwRhRL2b_0927.00007560 309
22 3300005288 Ga0065714_10003290 Ga0065714_100032905 309
23 3300005289 Ga0065704_10000210 Ga0065704_1000021015 309
24 3300009094 Ga0111539_10016935 Ga0111539_100169359 309
25 3300013100 Ga0157373_10000821 Ga0157373_1000082122 309
26 3300013102 Ga0157371_10001915 Ga0157371_100019157 309
27 3300013104 Ga0157370_10001048 Ga0157370_1000104827 309
28 3300015261 Ga0182006_1002952 Ga0182006_10029521 309
29 3300031911 Ga0307412_10000427 Ga0307412_1000042716 309
30 3300032004 Ga0307414_10000600 Ga0307414_1000060017 309
31 3300048928 Ga0496125_0233701 Ga0496125_0233701_43_1113 309
32 3300037466 Ga0395898_0295763 Ga0395898_0295763_178_1176 310
33 3300037471 Ga0395905_0000003 Ga0395905_0000003_418342_419352 310
34 3300053093 Ga0500651_0000342 Ga0500651_0000342_21149_22168 311
35 3300003323 rootH1_10044583 rootH1_100445832 313
36 3300005365 Ga0070688_100199584 Ga0070688_1001995841 313
37 3300050512 nmdc:mga0n895_48775_c1 nmdc:mga0n895_48775_c1_2510_3475 313
38 3300053153 Ga0500616_0130596 Ga0500616_0130596_187_1161 313
39 3300003794 Ga0055531_10000201 Ga0055531_1000020120 314
40 3300025304 Ga0209257_1000005 Ga0209257_10000051005 314
41 3300046507 Ga0495606_0078354 Ga0495606_0078354_156_1172 314
42 3300005289 Ga0065704_10170266 Ga0065704_101702661 315
43 3300046507 Ga0495606_0060735 Ga0495606_0060735_193_1224 315
44 3300005471 Ga0070698_100012636 Ga0070698_1000126363 316
45 3300013104 Ga0157370_10016704 Ga0157370_100167048 316
46 3300005355 Ga0070671_100009348 Ga0070671_1000093489 317
47 3300005842 Ga0068858_100327756 Ga0068858_1003277562 317
48 3300010375 Ga0105239_10180445 Ga0105239_101804452 317
49 3300011119 Ga0105246_10172737 Ga0105246_101727372 317
50 3300013308 Ga0157375_10051809 Ga0157375_100518097 317
51 3300025931 Ga0207644_10031365 Ga0207644_100313653 317
52 3300042876 Ga0451577_0130468 Ga0451577_0130468_644_1663 317
53 3300044712 Ga0453684_0001372 Ga0453684_0001372_1442_2461 317
54 3300047443 Ga0495687_000516 Ga0495687_000516_38038_39063 317
55 3300045051 Ga0451576_0032735 Ga0451576_0032735_922_1938 318
56 3300032004 Ga0307414_10000452 Ga0307414_1000045216 319
57 3300009011 Ga0105251_10040800 Ga0105251_100408002 320
58 3300046528 Ga0495642_0130342 Ga0495642_0130342_83_1045 320
59 3300047318 Ga0495636_0000053 Ga0495636_0000053_32734_33696 320
60 iso_pu_bacteria 2839989709 2839992049 320
61 iso_pu_bacteria 2910245624 2910249523 320
62 3300032004 Ga0307414_10024304 Ga0307414_100243042 321
63 3300044712 Ga0453684_0113357 Ga0453684_0113357_397_1404 321
64 iso_pu_bacteria 2896344016 2896346417 321
65 3300001904 JGI24736J21556_1005036 JGI24736J21556_10050362 322
66 3300005338 Ga0068868_100139804 Ga0068868_1001398043 322
67 3300005339 Ga0070660_100006716 Ga0070660_1000067166 322
68 3300005457 Ga0070662_100000030 Ga0070662_10000003061 322
69 3300005539 Ga0068853_100382096 Ga0068853_1003820961 322
70 3300009174 Ga0105241_10045552 Ga0105241_100455524 322
71 3300013100 Ga0157373_10038091 Ga0157373_100380915 322
72 3300013102 Ga0157371_10244056 Ga0157371_102440561 322
73 3300013296 Ga0157374_10000203 Ga0157374_1000020330 322
74 3300013307 Ga0157372_10050616 Ga0157372_100506161 322
75 3300014497 Ga0182008_10076487 Ga0182008_100764872 322
76 3300015262 Ga0182007_10035586 Ga0182007_100355862 322
77 3300025904 Ga0207647_10000247 Ga0207647_1000024725 322
78 3300025911 Ga0207654_10083486 Ga0207654_100834861 322
79 3300025913 Ga0207695_10224575 Ga0207695_102245752 322
80 3300025919 Ga0207657_10034980 Ga0207657_100349804 322
81 3300025933 Ga0207706_10000129 Ga0207706_1000012929 322
82 3300025960 Ga0207651_10403825 Ga0207651_104038251 322
83 3300026023 Ga0207677_10033044 Ga0207677_100330444 322
84 3300039447 Ga0436361_1146696 Ga0436361_1146696_287_1312 322
85 3300049661 Ga0501217_016020 Ga0501217_016020_398_1399 322
86 3300053153 Ga0500616_0067238 Ga0500616_0067238_229_1230 322
87 3300003316 rootH1_10050627 rootH1_1005062710 323
88 3300003316 rootH1_10127305 rootH1_101273053 323
89 3300003320 rootH2_10018544 rootH2_1001854441 323
90 3300003320 rootH2_10030116 rootH2_100301161 323
91 3300003320 rootH2_10173457 rootH2_101734573 323
92 3300003322 rootL2_10037352 rootL2_100373523 323
93 3300003322 rootL2_10049321 rootL2_100493212 323
94 3300003322 rootL2_10085583 rootL2_100855832 323
95 3300003322 rootL2_10108158 rootL2_101081582 323
96 3300003322 rootL2_10266281 rootL2_102662811 323
97 3300003323 rootH1_10011373 rootH1_1001137324 323
98 3300003323 rootH1_10029472 rootH1_1002947211 323
99 3300003323 rootH1_10052672 rootH1_100526723 323
100 3300003323 rootH1_10057524 rootH1_100575242 323
101 3300003323 rootH1_10057911 rootH1_100579113 323
102 3300003323 rootH1_10060174 rootH1_100601745 323
103 3300003323 rootH1_10060268 rootH1_100602682 323
104 3300003323 rootH1_10149597 rootH1_101495972 323
105 3300003323 rootH1_10180666 rootH1_101806662 323
106 3300005288 Ga0065714_10094205 Ga0065714_100942052 323
107 3300005614 Ga0068856_100214276 Ga0068856_1002142762 323
108 3300013102 Ga0157371_10003683 Ga0157371_1000368315 323
109 3300025298 Ga0209050_1003017 Ga0209050_10030175 323
110 3300026078 Ga0207702_10330970 Ga0207702_103309702 323
111 3300028800 Ga0265338_10053615 Ga0265338_100536152 323
112 3300031995 Ga0307409_100007951 Ga0307409_1000079512 323
113 3300032002 Ga0307416_100001158 Ga0307416_10000115811 323
114 3300032126 Ga0307415_100000517 Ga0307415_10000051713 323
115 3300044706 Ga0466964_0073671 Ga0466964_0073671_313_1320 323
116 3300046460 Ga0495638_0000003 Ga0495638_0000003_781925_782932 323
117 3300047472 Ga0495686_0001934 Ga0495686_0001934_13563_14591 323
118 3300049652 Ga0501202_014215 Ga0501202_014215_142_1143 323
119 3300049652 Ga0501202_031001 Ga0501202_031001_83_1084 323
120 3300049688 Ga0501259_004338 Ga0501259_004338_1036_2037 323
121 3300049761 Ga0501264_000061 Ga0501264_000061_2066_3067 323
122 3300053151 Ga0500604_0000768 Ga0500604_0000768_3634_4638 323
123 3300053153 Ga0500616_0000068 Ga0500616_0000068_221326_222333 323
124 3300053156 Ga0500622_0000014 Ga0500622_0000014_333920_334924 323
125 3300053156 Ga0500622_0000020 Ga0500622_0000020_268491_269495 323
126 3300053156 Ga0500622_0000403 Ga0500622_0000403_33290_34306 323
127 iso_pu_bacteria 2890804823 2890805650 323
128 iso_pu_bacteria 8055419101 8055421173 323
129 3300005545 Ga0070695_100253401 Ga0070695_1002534012 324
130 3300009094 Ga0111539_10021415 Ga0111539_100214151 324
131 3300009176 Ga0105242_10195497 Ga0105242_101954971 324
132 3300032002 Ga0307416_100388492 Ga0307416_1003884921 324
133 3300042876 Ga0451577_0178370 Ga0451577_0178370_893_1903 324
134 3300050511 nmdc:mga08y16_210058_c1 nmdc:mga08y16_210058_c1_991_1998 324
135 iso_pu_bacteria 2513020052 2513236507 324
136 iso_pu_bacteria 2519899754 2520878486 324
137 iso_pu_bacteria 2643221600 2644011755 324
138 iso_pu_bacteria 2643221667 2644370139 324
139 iso_pu_bacteria 2643221716 2644642014 324
140 iso_pu_bacteria 2643221725 2644685553 324
141 iso_pu_bacteria 2738541279 2738736215 324
142 iso_pu_bacteria 2738541285 2738768658 324
143 iso_pu_bacteria 2738543007 2739217797 324
144 iso_pu_bacteria 2739367857 2740003433 324
145 iso_pu_bacteria 2739367858 2740008250 324
146 iso_pu_bacteria 2802428842 2802653416 324
147 iso_pu_bacteria 2816332280 2817415510 324
148 iso_pu_bacteria 2833640130 2833644208 324
149 iso_pu_bacteria 2857613821 2857614288 324
150 iso_pu_bacteria 2857618242 2857619356 324
151 iso_pu_bacteria 2881359912 2881362340 324
152 iso_pu_bacteria 2903895155 2903898284 324
153 iso_pu_bacteria 2904419702 2904423317 324
154 iso_pu_bacteria 2904555929 2904556350 324
155 iso_pu_bacteria 2919191525 2919193260 324
156 iso_pu_bacteria 2919509842 2919511690 324
157 iso_pu_bacteria 2919683626 2919686541 324
158 iso_pu_bacteria 2929150217 2929152757 324
159 iso_pu_bacteria 2958458903 2958462798 324
160 iso_pu_bacteria 2965320100 2965320336 324
161 iso_pu_bacteria 2977268062 2977269447 324
162 iso_pu_bacteria 8054307821 8054309504 324
163 iso_pu_bacteria 8055588893 8055589415 324
164 iso_pu_bacteria 8055592153 8055594433 324
165 iso_pu_bacteria 8056440228 8056444527 324
166 3300005353 Ga0070669_100139869 Ga0070669_1001398692 325
167 3300044712 Ga0453684_0141934 Ga0453684_0141934_1268_2269 325
168 3300047470 Ga0495681_0090982 Ga0495681_0090982_205_1212 325
169 iso_pu_bacteria 2902048731 2902051056 325
170 iso_pu_bacteria 8003151029 8003157729 325
171 iso_pu_bacteria 2585427687 2586210063 326
172 iso_pu_bacteria 2738541284 2738760390 326
173 iso_pu_bacteria 2738541302 2738851793 326
174 iso_pu_bacteria 2738543023 2739302538 326
175 iso_pu_bacteria 2739367651 2739590684 326
176 iso_pu_bacteria 2739367663 2739647386 326
177 iso_pu_bacteria 2775506987 2776612442 326
178 iso_pu_bacteria 2818991437 2819546356 326
179 iso_pu_bacteria 2842722452 2842725033 326
180 iso_pu_bacteria 2842909656 2842914199 326
181 iso_pu_bacteria 2849281842 2849285948 326
182 iso_pu_bacteria 2852627209 2852630357 326
183 iso_pu_bacteria 2857627736 2857630303 326
184 iso_pu_bacteria 2881955468 2881955655 326
185 iso_pu_bacteria 2904445276 2904448678 326
186 iso_pu_bacteria 2919186247 2919189644 326
187 iso_pu_bacteria 2939664404 2939667870 326
188 iso_pu_bacteria 2945997725 2946001974 326
189 iso_pu_bacteria 2954016120 2954018860 326
190 3300009545 Ga0105237_10000224 Ga0105237_1000022462 327
191 3300009553 Ga0105249_10016990 Ga0105249_100169907 327
192 3300013306 Ga0163162_10004931 Ga0163162_100049318 327
193 3300013308 Ga0157375_10054320 Ga0157375_100543203 327
194 3300015261 Ga0182006_1063730 Ga0182006_10637301 327
195 3300015261 Ga0182006_1063731 Ga0182006_10637311 327
196 3300017792 Ga0163161_10009952 Ga0163161_100099527 327
197 3300025914 Ga0207671_10000272 Ga0207671_1000027214 327
198 3300031727 Ga0316576_10017487 Ga0316576_100174872 327
199 3300044673 Ga0453683_0000678 Ga0453683_0000678_24267_25310 327
200 3300044673 Ga0453683_0013407 Ga0453683_0013407_880_1926 327
201 3300044673 Ga0453683_0033380 Ga0453683_0033380_370_1413 327
202 3300044712 Ga0453684_0046143 Ga0453684_0046143_4712_5758 327
203 3300044712 Ga0453684_0240146 Ga0453684_0240146_279_1322 327
204 3300044712 Ga0453684_0344847 Ga0453684_0344847_364_1407 327
205 3300045051 Ga0451576_0000952 Ga0451576_0000952_9278_10321 327
206 3300045051 Ga0451576_0005906 Ga0451576_0005906_4852_5898 327
207 3300045051 Ga0451576_0040203 Ga0451576_0040203_225_1268 327
208 3300045051 Ga0451576_0192702 Ga0451576_0192702_237_1280 327
209 iso_pu_bacteria 2898713307 2898715043 327
210 3300003781 Ga0055536_1000001 Ga0055536_1000001284 328
211 3300005288 Ga0065714_10013268 Ga0065714_100132682 328
212 3300005288 Ga0065714_10064863 Ga0065714_100648633 328
213 3300005288 Ga0065714_10075400 Ga0065714_100754004 328
214 3300005288 Ga0065714_10126133 Ga0065714_101261331 328
215 3300005328 Ga0070676_10020593 Ga0070676_100205932 328
216 3300005335 Ga0070666_10077221 Ga0070666_100772212 328
217 3300006946 Ga0079104_1001101 Ga0079104_10011018 328
218 3300006948 Ga0099826_10017781 Ga0099826_100177814 328
219 3300009036 Ga0105244_10000003 Ga0105244_10000003139 328
220 3300013100 Ga0157373_10000012 Ga0157373_1000001241 328
221 3300013100 Ga0157373_10009016 Ga0157373_100090166 328
222 3300013102 Ga0157371_10000016 Ga0157371_10000016128 328
223 3300013102 Ga0157371_10009053 Ga0157371_100090535 328
224 3300013102 Ga0157371_10009366 Ga0157371_100093667 328
225 3300013104 Ga0157370_10000451 Ga0157370_1000045137 328
226 3300013104 Ga0157370_10000700 Ga0157370_1000070032 328
227 3300013104 Ga0157370_10001740 Ga0157370_1000174012 328
228 3300013104 Ga0157370_10013319 Ga0157370_100133195 328
229 3300013104 Ga0157370_10055735 Ga0157370_100557353 328
230 3300013104 Ga0157370_10059844 Ga0157370_100598442 328
231 3300013104 Ga0157370_10076685 Ga0157370_100766852 328
232 3300013105 Ga0157369_10000129 Ga0157369_1000012992 328
233 3300013105 Ga0157369_10005279 Ga0157369_100052797 328
234 3300013306 Ga0163162_10000186 Ga0163162_1000018659 328
235 3300013306 Ga0163162_10035563 Ga0163162_100355633 328
236 3300013306 Ga0163162_10347394 Ga0163162_103473941 328
237 3300013308 Ga0157375_10266750 Ga0157375_102667503 328
238 3300014326 Ga0157380_10000348 Ga0157380_1000034812 328
239 3300014497 Ga0182008_10000006 Ga0182008_10000006307 328
240 3300014497 Ga0182008_10002060 Ga0182008_100020607 328
241 3300015261 Ga0182006_1005181 Ga0182006_10051815 328
242 3300015261 Ga0182006_1006254 Ga0182006_10062543 328
243 3300015262 Ga0182007_10000003 Ga0182007_10000003299 328
244 3300015682 Ga0183373_1001 Ga0183373_1001668 328
245 3300017792 Ga0163161_10000074 Ga0163161_10000074102 328
246 3300017792 Ga0163161_10000177 Ga0163161_1000017728 328
247 3300017792 Ga0163161_10001686 Ga0163161_1000168610 328
248 3300017792 Ga0163161_10190196 Ga0163161_101901962 328
249 3300025292 Ga0209676_1000008 Ga0209676_1000008577 328
250 3300025298 Ga0209050_1000045 Ga0209050_1000045208 328
251 3300025728 Ga0207655_1000010 Ga0207655_1000010410 328
252 3300025907 Ga0207645_10021988 Ga0207645_100219884 328
253 3300025913 Ga0207695_10105899 Ga0207695_101058992 328
254 3300026089 Ga0207648_10077000 Ga0207648_100770002 328
255 3300027111 Ga0209281_1000156 Ga0209281_1000156145 328
256 3300027526 Ga0209968_1000562 Ga0209968_10005626 328
257 3300027666 Ga0209282_1026074 Ga0209282_10260741 328
258 3300031251 Ga0265327_10000930 Ga0265327_1000093039 328
259 3300031727 Ga0316576_10012973 Ga0316576_100129732 328
260 3300031727 Ga0316576_10039244 Ga0316576_100392443 328
261 3300031728 Ga0316578_10026765 Ga0316578_100267652 328
262 3300031731 Ga0307405_10000003 Ga0307405_1000000382 328
263 3300031852 Ga0307410_10000055 Ga0307410_1000005532 328
264 3300031901 Ga0307406_10000009 Ga0307406_1000000975 328
265 3300031903 Ga0307407_10000008 Ga0307407_1000000870 328
266 3300031903 Ga0307407_10002757 Ga0307407_100027574 328
267 3300031911 Ga0307412_10387999 Ga0307412_103879991 328
268 3300031995 Ga0307409_100287416 Ga0307409_1002874162 328
269 3300032002 Ga0307416_100000009 Ga0307416_100000009240 328
270 3300032004 Ga0307414_10000001 Ga0307414_10000001423 328
271 3300032004 Ga0307414_10035951 Ga0307414_100359514 328
272 3300032004 Ga0307414_10048246 Ga0307414_100482463 328
273 3300032004 Ga0307414_10071265 Ga0307414_100712652 328
274 3300032005 Ga0307411_10000005 Ga0307411_10000005225 328
275 3300033180 Ga0307510_10034229 Ga0307510_100342294 328
276 3300035398 Ga0316574_0076458 Ga0316574_0076458_49_1125 328
277 3300036712 Ga0316584_0020535 Ga0316584_0020535_839_1882 328
278 3300036712 Ga0316584_0124757 Ga0316584_0124757_173_1264 328
279 3300041407 Ga0439447_000239 Ga0439447_000239_4888_5958 328
280 3300041411 Ga0439466_0007256 Ga0439466_0007256_2314_3375 328
281 3300042876 Ga0451577_0024128 Ga0451577_0024128_2909_4012 328
282 3300044712 Ga0453684_0000553 Ga0453684_0000553_135547_136650 328
283 3300044712 Ga0453684_0012405 Ga0453684_0012405_11559_12614 328
284 3300044712 Ga0453684_0028964 Ga0453684_0028964_4158_5210 328
285 3300045051 Ga0451576_0000020 Ga0451576_0000020_32945_33988 328
286 3300046453 Ga0495627_002780 Ga0495627_002780_5016_6074 328
287 3300046507 Ga0495606_0026840 Ga0495606_0026840_40_1098 328
288 3300046512 Ga0495610_0000523 Ga0495610_0000523_8112_9128 328
289 3300046512 Ga0495610_0002021 Ga0495610_0002021_6438_7454 328
290 3300046522 Ga0495643_0000620 Ga0495643_0000620_6405_7463 328
291 3300046660 Ga0495625_0207229 Ga0495625_0207229_87_1145 328
292 3300048919 Ga0496116_0000041 Ga0496116_0000041_240421_241485 328
293 3300048927 Ga0496124_0005888 Ga0496124_0005888_1064_2128 328
294 3300048928 Ga0496125_0000036 Ga0496125_0000036_61_1125 328
295 3300048929 Ga0496126_0008262 Ga0496126_0008262_10043_11107 328
296 3300049679 Ga0501249_000003 Ga0501249_000003_188615_189685 328
297 3300049763 Ga0501266_000025 Ga0501266_000025_47061_48131 328
298 3300049776 Ga0501280_001707 Ga0501280_001707_1854_2915 328
299 3300053090 Ga0500646_0001897 Ga0500646_0001897_2099_3157 328
300 3300053096 Ga0500641_0000030 Ga0500641_0000030_64597_65670 328
301 3300053096 Ga0500641_0000166 Ga0500641_0000166_19793_20863 328
302 3300053096 Ga0500641_0000396 Ga0500641_0000396_4212_5270 328
303 3300053134 Ga0500658_0000008 Ga0500658_0000008_107034_108104 328
304 3300053161 Ga0500634_0117889 Ga0500634_0117889_55_1071 328
305 iso_pu_bacteria 2842903701 2842906906 328
306 3300001979 JGI24740J21852_10011936 JGI24740J21852_100119365 329
307 3300001990 JGI24737J22298_10008833 JGI24737J22298_100088334 329
308 3300002737 JGI25162J39368_1000011 JGI25162J39368_1000011127 329
309 3300003323 rootH1_10138065 rootH1_101380658 329
310 3300005327 Ga0070658_10000049 Ga0070658_1000004935 329
311 3300005328 Ga0070676_10025038 Ga0070676_100250382 329
312 3300005329 Ga0070683_100117837 Ga0070683_1001178371 329
313 3300005331 Ga0070670_100064759 Ga0070670_1000647594 329
314 3300005334 Ga0068869_100034748 Ga0068869_1000347484 329
315 3300005335 Ga0070666_10000131 Ga0070666_1000013121 329
316 3300005337 Ga0070682_100167438 Ga0070682_1001674382 329
317 3300005338 Ga0068868_100006177 Ga0068868_1000061776 329
318 3300005344 Ga0070661_100306833 Ga0070661_1003068331 329
319 3300005354 Ga0070675_100047572 Ga0070675_1000475724 329
320 3300005355 Ga0070671_100027520 Ga0070671_1000275202 329
321 3300005355 Ga0070671_100267963 Ga0070671_1002679631 329
322 3300005364 Ga0070673_100017631 Ga0070673_1000176312 329
323 3300005367 Ga0070667_100202017 Ga0070667_1002020172 329
324 3300005367 Ga0070667_100300408 Ga0070667_1003004082 329
325 3300005441 Ga0070700_100317605 Ga0070700_1003176051 329
326 3300005457 Ga0070662_100004861 Ga0070662_1000048615 329
327 3300005535 Ga0070684_100079225 Ga0070684_1000792252 329
328 3300005539 Ga0068853_100289912 Ga0068853_1002899121 329
329 3300005543 Ga0070672_100090704 Ga0070672_1000907043 329
330 3300005563 Ga0068855_100073079 Ga0068855_1000730793 329
331 3300005578 Ga0068854_100030159 Ga0068854_1000301594 329
332 3300005578 Ga0068854_100078537 Ga0068854_1000785372 329
333 3300005578 Ga0068854_100079181 Ga0068854_1000791814 329
334 3300005617 Ga0068859_100103559 Ga0068859_1001035592 329
335 3300005618 Ga0068864_100035911 Ga0068864_1000359112 329
336 3300005618 Ga0068864_100038143 Ga0068864_1000381433 329
337 3300005841 Ga0068863_100119491 Ga0068863_1001194913 329
338 3300005842 Ga0068858_100286328 Ga0068858_1002863282 329
339 3300005843 Ga0068860_100007709 Ga0068860_1000077096 329
340 3300005844 Ga0068862_100021173 Ga0068862_1000211733 329
341 3300006358 Ga0068871_100041103 Ga0068871_1000411033 329
342 3300006358 Ga0068871_100480230 Ga0068871_1004802301 329
343 3300006871 Ga0075434_100252671 Ga0075434_1002526712 329
344 3300006931 Ga0097620_100103555 Ga0097620_1001035552 329
345 3300009093 Ga0105240_10564141 Ga0105240_105641412 329
346 3300009174 Ga0105241_10012764 Ga0105241_100127645 329
347 3300010375 Ga0105239_10000002 Ga0105239_10000002135 329
348 3300013100 Ga0157373_10185934 Ga0157373_101859342 329
349 3300013102 Ga0157371_10000135 Ga0157371_1000013563 329
350 3300013102 Ga0157371_10002407 Ga0157371_100024079 329
351 3300013102 Ga0157371_10139950 Ga0157371_101399502 329
352 3300013104 Ga0157370_10024879 Ga0157370_100248796 329
353 3300013105 Ga0157369_10000475 Ga0157369_1000047514 329
354 3300013105 Ga0157369_10125203 Ga0157369_101252033 329
355 3300013105 Ga0157369_10136822 Ga0157369_101368222 329
356 3300013105 Ga0157369_10243169 Ga0157369_102431693 329
357 3300013296 Ga0157374_10010367 Ga0157374_100103679 329
358 3300013296 Ga0157374_10031507 Ga0157374_100315075 329
359 3300013297 Ga0157378_10055996 Ga0157378_100559963 329
360 3300013306 Ga0163162_10014484 Ga0163162_100144843 329
361 3300013306 Ga0163162_10220652 Ga0163162_102206522 329
362 3300013307 Ga0157372_10000017 Ga0157372_10000017164 329
363 3300013307 Ga0157372_10000061 Ga0157372_1000006152 329
364 3300013307 Ga0157372_10002526 Ga0157372_100025268 329
365 3300013307 Ga0157372_10102804 Ga0157372_101028042 329
366 3300013308 Ga0157375_10379050 Ga0157375_103790502 329
367 3300013308 Ga0157375_10748007 Ga0157375_107480071 329
368 3300014325 Ga0163163_10123615 Ga0163163_101236152 329
369 3300014745 Ga0157377_10019977 Ga0157377_100199774 329
370 3300014745 Ga0157377_10298384 Ga0157377_102983841 329
371 3300014968 Ga0157379_10030460 Ga0157379_100304602 329
372 3300014969 Ga0157376_10026576 Ga0157376_100265762 329
373 3300017792 Ga0163161_10027487 Ga0163161_100274872 329
374 3300021384 Ga0213876_10009668 Ga0213876_100096685 329
375 3300025250 Ga0209026_1007986 Ga0209026_10079863 329
376 3300025907 Ga0207645_10004216 Ga0207645_100042162 329
377 3300025909 Ga0207705_10000079 Ga0207705_1000007965 329
378 3300025913 Ga0207695_10064738 Ga0207695_100647384 329
379 3300025920 Ga0207649_10221531 Ga0207649_102215312 329
380 3300025921 Ga0207652_10071535 Ga0207652_100715353 329
381 3300025931 Ga0207644_10032555 Ga0207644_100325555 329
382 3300025933 Ga0207706_10002616 Ga0207706_100026167 329
383 3300025938 Ga0207704_10095431 Ga0207704_100954312 329
384 3300025940 Ga0207691_10034399 Ga0207691_100343992 329
385 3300025942 Ga0207689_10010592 Ga0207689_100105925 329
386 3300025942 Ga0207689_10318284 Ga0207689_103182841 329
387 3300025945 Ga0207679_10125398 Ga0207679_101253984 329
388 3300025945 Ga0207679_10206085 Ga0207679_102060852 329
389 3300025960 Ga0207651_10092368 Ga0207651_100923682 329
390 3300025981 Ga0207640_10078004 Ga0207640_100780042 329
391 3300025981 Ga0207640_10132573 Ga0207640_101325733 329
392 3300026023 Ga0207677_10007221 Ga0207677_100072215 329
393 3300026023 Ga0207677_10114387 Ga0207677_101143873 329
394 3300026035 Ga0207703_10078855 Ga0207703_100788552 329
395 3300026035 Ga0207703_10275496 Ga0207703_102754962 329
396 3300026041 Ga0207639_10261810 Ga0207639_102618102 329
397 3300026067 Ga0207678_10233030 Ga0207678_102330302 329
398 3300026089 Ga0207648_10026160 Ga0207648_100261604 329
399 3300026095 Ga0207676_10093529 Ga0207676_100935294 329
400 3300026142 Ga0207698_10415733 Ga0207698_104157331 329
401 3300028380 Ga0268265_10026183 Ga0268265_100261834 329
402 3300028380 Ga0268265_10252050 Ga0268265_102520502 329
403 3300028381 Ga0268264_10009106 Ga0268264_100091062 329
404 3300028800 Ga0265338_10235998 Ga0265338_102359981 329
405 3300030731 Ga0316177_1197492 Ga0316177_11974926 329
406 3300030732 Ga0316176_1064606 Ga0316176_10646064 329
407 3300030742 Ga0316183_1096868 Ga0316183_109686817 329
408 3300031731 Ga0307405_10022946 Ga0307405_100229465 329
409 3300031911 Ga0307412_10024582 Ga0307412_100245825 329
410 3300032004 Ga0307414_10095427 Ga0307414_100954273 329
411 3300035725 Ga0373947_0017462 Ga0373947_0017462_2145_3143 329
412 3300037312 Ga0395899_0000493 Ga0395899_0000493_35509_36534 329
413 3300037466 Ga0395898_0410703 Ga0395898_0410703_264_1259 329
414 3300039437 Ga0436365_1377856 Ga0436365_1377856_4379_5377 329
415 3300041505 Ga0451849_0217799 Ga0451849_0217799_144_1142 329
416 3300042876 Ga0451577_0000161 Ga0451577_0000161_96361_97428 329
417 3300044693 Ga0466961_0049045 Ga0466961_0049045_1372_2397 329
418 3300044712 Ga0453684_0012636 Ga0453684_0012636_632_1702 329
419 3300045836 Ga0466958_0046196 Ga0466958_0046196_371_1396 329
420 3300046665 Ga0495661_0002179 Ga0495661_0002179_10181_11203 329
421 3300049663 Ga0501223_007466 Ga0501223_007466_638_1729 329
422 3300049823 Ga0501044_0124134 Ga0501044_0124134_751_1755 329
423 3300053122 Ga0500608_000271 Ga0500608_000271_18866_19891 329
424 2162886007 SwRhRL2b_contig_1762647 SwRhRL2b_0716.00005320 330
425 3300005289 Ga0065704_10070151 Ga0065704_10070151217 330
426 3300009093 Ga0105240_10112883 Ga0105240_101128833 330
427 3300010375 Ga0105239_10335426 Ga0105239_103354261 330
428 3300010375 Ga0105239_10422040 Ga0105239_104220401 330
429 3300013307 Ga0157372_10016734 Ga0157372_100167343 330
430 3300013307 Ga0157372_10294096 Ga0157372_102940961 330
431 3300025904 Ga0207647_10011512 Ga0207647_100115126 330
432 3300025913 Ga0207695_10025505 Ga0207695_100255052 330
433 3300025914 Ga0207671_10000102 Ga0207671_1000010255 330
434 3300026116 Ga0207674_10335964 Ga0207674_103359642 330

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05893

LuxC

Acyl-CoA reductase (LuxC)

38

252

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mz8-assembly1.cif.gz_D crystal structure of aldehyde dehydrogenase 21 (aldh21) from physcomitrella patens in complex with the reaction product succinate 0.7574 2 293
7xc6-assembly1.cif.gz_A photobacterium phosphoreum fatty acid reductase complex luxc-luxe 0.7569 2 327
1qi1-assembly1.cif.gz_A ternary complex of an nadp dependent aldehyde dehydrogenase 0.753 2 293
8c54-assembly1.cif.gz_D cryo-em structure of nadh bound sla dehydrogenase rlgabd from rhizobium leguminosarum bv. trifolii srd1565 0.7522 2 293
4pxl-assembly1.cif.gz_A structure of zm aldh2-3 (rf2c) in complex with nad 0.7498 2 288
ID Description Score Start End Superfamily
af_Q55CJ9_31_264_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.7666 2 171 3.40.605.10
af_A0A0G2KZR6_2_316_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.7657 91 293 3.40.605.10
af_Q55CJ9_14_489_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.7599 2 293 3.40.605.10
af_I1MTI7_10_220_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.7566 2 171 3.40.605.10
2iluA01 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.7552 2 167 3.40.605.10
ID Description Score Start End GO Terms
AF-A0A4Q2ZKK5-F1-model_v4 deleted 0.9889 1 330
AF-A0A426H581-F1-model_v4 deleted 0.9888 3 213
AF-A0A3B7ML81-F1-model_v4 Acyl-CoA reductase 0.9867 2 330
AF-A0A7V5BDN5-F1-model_v4 Acyl-CoA reductase 0.9861 2 330 GO:0003995
GO:0008218
AF-A0A4Q3NKS4-F1-model_v4 Acyl-CoA reductase 0.9854 50 327

Feature Viewer

pLDDT pTM Quality
95.51 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map