F443133
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 434 | 249 | 418 | 298 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0018987|Ga0395900_0018987_3558_4526 |
| Length | 322 |
| Sequence | VIRTQGAEPPFRNVALIGLGLIGSSIARGVAEAMPEVELRGYDCDPDVRRRAASLGLVDLLAEDPAAAVAGADLVIFCVPVGAMAGAARSVGPHLAPGAVVSDVGSCKGPVLEALRETLPRAAIVPAHPIAGTENSGPEAGFAALFRNRWCILTPEIADPSADRLAAFWTALGARVEIMDAKRHDLVLAVTSHLPHLIAYTIVGTASHLEAVTEGEVIKYSAGGFRDFTRIAASDPTMWRDIFLSNRGAVLEILGRFLDDLEQLSDAIRDGDGDLLFDWFSRTRAIRRAIVQEGEAAPVPNIPAPGGEGAVGRRRSAAPAPD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 2 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 3 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 4 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 5 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 6 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 7 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 8 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 9 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 10 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 11 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 12 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 13 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 14 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 15 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 16 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 17 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 18 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 19 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 20 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 21 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 22 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 23 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 24 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 25 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 26 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 27 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 28 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 29 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 86 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 121 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 122 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 123 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 124 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 125 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 126 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 127 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 128 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 129 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 130 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 131 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 132 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 133 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 134 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 135 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 136 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 138 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 140 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 141 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 142 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 143 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 144 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 145 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 146 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 147 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 148 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 149 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 150 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 151 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 152 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 153 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 194 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 195 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 196 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 197 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 198 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 200 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 201 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 202 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 203 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 204 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 205 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 206 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 207 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 208 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 209 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 210 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 211 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 212 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 213 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 214 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 217 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 218 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 219 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 220 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 221 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 222 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 223 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 224 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 226 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 227 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 228 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 229 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 230 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 235 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 236 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 237 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 238 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 239 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 240 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 241 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 242 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 243 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 244 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 245 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 246 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 247 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 248 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 249 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.31 |
| Metatranscriptomes | 0 |
| Isolates | 3.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.91 |
| Nodule | 0 |
| Rhizoplane | 4.15 |
| Rhizosphere | 80.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000464 | 3300001904 | Bacteria | 7616 |
| 2 | JGI24736J21556_1001337 | 3300001904 | Bacteria | 4509 |
| 3 | JGI24741J21665_1000069 | 3300001915 | Bacteria | 25234 |
| 4 | JGI24752J21851_1000454 | 3300001976 | Bacteria | 5534 |
| 5 | JGI24740J21852_10002676 | 3300001979 | Bacteria | 7995 |
| 6 | JGI24740J21852_10020243 | 3300001979 | Bacteria | 2325 |
| 7 | JGI24740J21852_10040483 | 3300001979 | Bacteria | 1412 |
| 8 | JGI24739J22299_10000697 | 3300001989 | Bacteria | 12185 |
| 9 | JGI24739J22299_10002049 | 3300001989 | Bacteria | 7713 |
| 10 | JGI24737J22298_10002270 | 3300001990 | Bacteria | 6847 |
| 11 | JGI24737J22298_10003279 | 3300001990 | Bacteria | 5737 |
| 12 | JGI24737J22298_10010614 | 3300001990 | Bacteria | 3036 |
| 13 | JGI24735J21928_10000951 | 3300002067 | Bacteria | 10337 |
| 14 | JGI24735J21928_10002415 | 3300002067 | Bacteria | 6495 |
| 15 | JGI24750J21931_1000400 | 3300002070 | Bacteria | 7332 |
| 16 | JGI24748J21848_1000030 | 3300002074 | Bacteria | 85078 |
| 17 | JGI24738J21930_10000736 | 3300002075 | Bacteria | 9422 |
| 18 | JGI24034J26672_10000014 | 3300002239 | Bacteria | 139881 |
| 19 | JGI24034J26672_10000046 | 3300002239 | Bacteria | 63764 |
| 20 | JGI24751J29686_10000210 | 3300002459 | Bacteria | 25006 |
| 21 | Ga0055534_1020815 | 3300003784 | Bacteria | 1104 |
| 22 | Ga0065704_10070376 | 3300005289 | Bacteria | 28305 |
| 23 | Ga0065704_10075413 | 3300005289 | Bacteria | 5605 |
| 24 | Ga0070658_10007890 | 3300005327 | Bacteria | 8572 |
| 25 | Ga0070658_10026116 | 3300005327 | Bacteria | 4685 |
| 26 | Ga0070658_10039513 | 3300005327 | Bacteria | 3807 |
| 27 | Ga0070690_100000005 | 3300005330 | Bacteria | 142006 |
| 28 | Ga0070670_100004743 | 3300005331 | Bacteria | 11413 |
| 29 | Ga0070670_100019456 | 3300005331 | Bacteria | 5827 |
| 30 | Ga0070670_100052532 | 3300005331 | Bacteria | 3499 |
| 31 | Ga0070670_100053433 | 3300005331 | Bacteria | 3469 |
| 32 | Ga0070666_10000011 | 3300005335 | Bacteria | 261736 |
| 33 | Ga0070666_10155096 | 3300005335 | Bacteria | 1599 |
| 34 | Ga0070660_100091405 | 3300005339 | Bacteria | 2401 |
| 35 | Ga0070668_100000025 | 3300005347 | Bacteria | 93131 |
| 36 | Ga0070668_100031943 | 3300005347 | Bacteria | 4006 |
| 37 | Ga0070669_100000123 | 3300005353 | Bacteria | 71501 |
| 38 | Ga0070669_100051879 | 3300005353 | Bacteria | 2999 |
| 39 | Ga0070669_100061661 | 3300005353 | Bacteria | 2756 |
| 40 | Ga0070669_100329049 | 3300005353 | Bacteria | 1235 |
| 41 | Ga0070671_100001385 | 3300005355 | Bacteria | 18115 |
| 42 | Ga0070671_100002401 | 3300005355 | Bacteria | 14479 |
| 43 | Ga0070671_100148934 | 3300005355 | Bacteria | 1976 |
| 44 | Ga0070688_100002976 | 3300005365 | Bacteria | 8634 |
| 45 | Ga0070659_100012883 | 3300005366 | Bacteria | 6215 |
| 46 | Ga0070659_100017500 | 3300005366 | Bacteria | 5398 |
| 47 | Ga0070659_100079655 | 3300005366 | Bacteria | 2615 |
| 48 | Ga0070667_100000006 | 3300005367 | Bacteria | 336732 |
| 49 | Ga0070667_100000660 | 3300005367 | Bacteria | 33497 |
| 50 | Ga0070667_100009763 | 3300005367 | Bacteria | 7959 |
| 51 | Ga0070667_100252145 | 3300005367 | Bacteria | 1578 |
| 52 | Ga0070663_100039233 | 3300005455 | Bacteria | 3308 |
| 53 | Ga0070663_100149583 | 3300005455 | Bacteria | 1789 |
| 54 | Ga0070662_100134343 | 3300005457 | Bacteria | 1911 |
| 55 | Ga0068867_100142521 | 3300005459 | Bacteria | 1875 |
| 56 | Ga0070685_10001167 | 3300005466 | Bacteria | 14058 |
| 57 | Ga0070685_10020959 | 3300005466 | Bacteria | 3545 |
| 58 | Ga0068853_100103499 | 3300005539 | Bacteria | 2520 |
| 59 | Ga0068853_100232830 | 3300005539 | Bacteria | 1686 |
| 60 | Ga0068853_100294024 | 3300005539 | Bacteria | 1500 |
| 61 | Ga0070686_100000001 | 3300005544 | Bacteria | 515830 |
| 62 | Ga0070686_100000259 | 3300005544 | Bacteria | 36127 |
| 63 | Ga0070665_100000004 | 3300005548 | Bacteria | 785500 |
| 64 | Ga0070665_100000078 | 3300005548 | Bacteria | 188101 |
| 65 | Ga0070665_100002184 | 3300005548 | Bacteria | 21806 |
| 66 | Ga0070665_100130227 | 3300005548 | Bacteria | 2518 |
| 67 | Ga0070665_100202588 | 3300005548 | Bacteria | 1985 |
| 68 | Ga0070664_100031094 | 3300005564 | Bacteria | 4457 |
| 69 | Ga0070664_100252178 | 3300005564 | Bacteria | 1586 |
| 70 | Ga0068857_100001897 | 3300005577 | Bacteria | 16857 |
| 71 | Ga0068857_100053886 | 3300005577 | Bacteria | 3568 |
| 72 | Ga0068856_100009259 | 3300005614 | Bacteria | 9568 |
| 73 | Ga0068864_100001665 | 3300005618 | Bacteria | 18296 |
| 74 | Ga0068864_100008568 | 3300005618 | Bacteria | 8440 |
| 75 | Ga0068864_100019929 | 3300005618 | Bacteria | 5607 |
| 76 | Ga0068861_100009524 | 3300005719 | Bacteria | 6712 |
| 77 | Ga0068863_100000046 | 3300005841 | Bacteria | 143895 |
| 78 | Ga0068863_100000058 | 3300005841 | Bacteria | 123096 |
| 79 | Ga0068863_100007173 | 3300005841 | Bacteria | 10935 |
| 80 | Ga0068863_100010071 | 3300005841 | Bacteria | 9199 |
| 81 | Ga0068863_100079946 | 3300005841 | Bacteria | 3096 |
| 82 | Ga0068858_100000969 | 3300005842 | Bacteria | 29675 |
| 83 | Ga0068858_100024081 | 3300005842 | Bacteria | 5673 |
| 84 | Ga0068860_100000030 | 3300005843 | Bacteria | 256364 |
| 85 | Ga0068860_100000057 | 3300005843 | Bacteria | 201847 |
| 86 | Ga0068860_100000074 | 3300005843 | Bacteria | 173022 |
| 87 | Ga0068862_100000360 | 3300005844 | Bacteria | 49364 |
| 88 | Ga0068862_100001011 | 3300005844 | Bacteria | 27000 |
| 89 | Ga0068862_100138066 | 3300005844 | Bacteria | 2162 |
| 90 | Ga0081539_10003935 | 3300005985 | Bacteria | 17233 |
| 91 | Ga0075368_10000565 | 3300006042 | Bacteria | 11108 |
| 92 | Ga0075367_10007298 | 3300006178 | Bacteria | 5652 |
| 93 | Ga0097621_100039192 | 3300006237 | Bacteria | 3805 |
| 94 | Ga0075370_10031257 | 3300006353 | Bacteria | 2972 |
| 95 | Ga0075431_100035703 | 3300006847 | Bacteria | 5118 |
| 96 | Ga0075434_100063434 | 3300006871 | Bacteria | 3677 |
| 97 | Ga0105251_10007138 | 3300009011 | Bacteria | 6952 |
| 98 | Ga0105250_10049618 | 3300009092 | Bacteria | 1684 |
| 99 | Ga0114129_10551038 | 3300009147 | Bacteria | 1499 |
| 100 | Ga0105241_10002141 | 3300009174 | Bacteria | 14918 |
| 101 | Ga0105248_10459944 | 3300009177 | Bacteria | 1434 |
| 102 | Ga0105237_10072875 | 3300009545 | Bacteria | 3427 |
| 103 | Ga0105238_10291451 | 3300009551 | Bacteria | 1614 |
| 104 | Ga0105249_10000016 | 3300009553 | Bacteria | 278643 |
| 105 | Ga0105148_100361 | 3300009978 | Bacteria | 5140 |
| 106 | Ga0105239_10538009 | 3300010375 | Bacteria | 1330 |
| 107 | Ga0157373_10123191 | 3300013100 | Bacteria | 1822 |
| 108 | Ga0157371_10073522 | 3300013102 | Bacteria | 2421 |
| 109 | Ga0157371_10085725 | 3300013102 | Bacteria | 2231 |
| 110 | Ga0157371_10299381 | 3300013102 | Bacteria | 1164 |
| 111 | Ga0157370_10107037 | 3300013104 | Bacteria | 2616 |
| 112 | Ga0157369_10044451 | 3300013105 | Bacteria | 4834 |
| 113 | Ga0163162_10098740 | 3300013306 | Bacteria | 3010 |
| 114 | Ga0157372_10129606 | 3300013307 | Bacteria | 2901 |
| 115 | Ga0163163_10036223 | 3300014325 | Bacteria | 4793 |
| 116 | Ga0163163_10048140 | 3300014325 | Bacteria | 4191 |
| 117 | Ga0157380_10000454 | 3300014326 | Bacteria | 25013 |
| 118 | Ga0157379_10003523 | 3300014968 | Bacteria | 13255 |
| 119 | Ga0163161_10000037 | 3300017792 | Bacteria | 150124 |
| 120 | Ga0163161_10048288 | 3300017792 | Bacteria | 3074 |
| 121 | Ga0213872_10006794 | 3300021361 | Bacteria | 5696 |
| 122 | Ga0213872_10040170 | 3300021361 | Bacteria | 2136 |
| 123 | Ga0213872_10042646 | 3300021361 | Bacteria | 2068 |
| 124 | Ga0209147_100882 | 3300025229 | Bacteria | 13811 |
| 125 | Ga0207680_10000008 | 3300025903 | Bacteria | 518177 |
| 126 | Ga0207680_10015956 | 3300025903 | Bacteria | 3933 |
| 127 | Ga0207680_10248745 | 3300025903 | Bacteria | 1227 |
| 128 | Ga0207647_10000301 | 3300025904 | Bacteria | 40628 |
| 129 | Ga0207647_10214948 | 3300025904 | Bacteria | 1109 |
| 130 | Ga0207705_10068816 | 3300025909 | Bacteria | 2564 |
| 131 | Ga0207705_10082407 | 3300025909 | Bacteria | 2346 |
| 132 | Ga0207705_10221174 | 3300025909 | Bacteria | 1438 |
| 133 | Ga0207654_10006583 | 3300025911 | Bacteria | 5841 |
| 134 | Ga0207695_10002890 | 3300025913 | Bacteria | 24889 |
| 135 | Ga0207695_10018738 | 3300025913 | Bacteria | 7991 |
| 136 | Ga0207671_10000592 | 3300025914 | Bacteria | 48411 |
| 137 | Ga0207671_10152696 | 3300025914 | Bacteria | 1785 |
| 138 | Ga0207657_10020085 | 3300025919 | Bacteria | 6325 |
| 139 | Ga0207657_10039417 | 3300025919 | Bacteria | 4199 |
| 140 | Ga0207649_10197479 | 3300025920 | Bacteria | 1419 |
| 141 | Ga0207681_10000038 | 3300025923 | Bacteria | 153694 |
| 142 | Ga0207681_10063203 | 3300025923 | Bacteria | 2552 |
| 143 | Ga0207681_10122480 | 3300025923 | Bacteria | 1909 |
| 144 | Ga0207681_10126323 | 3300025923 | Bacteria | 1884 |
| 145 | Ga0207681_10190650 | 3300025923 | Bacteria | 1568 |
| 146 | Ga0207694_10001595 | 3300025924 | Bacteria | 19193 |
| 147 | Ga0207694_10071656 | 3300025924 | Bacteria | 2708 |
| 148 | Ga0207694_10071728 | 3300025924 | Bacteria | 2707 |
| 149 | Ga0207650_10017809 | 3300025925 | Bacteria | 4976 |
| 150 | Ga0207650_10021560 | 3300025925 | Bacteria | 4552 |
| 151 | Ga0207650_10116051 | 3300025925 | Bacteria | 2079 |
| 152 | Ga0207650_10164214 | 3300025925 | Bacteria | 1761 |
| 153 | Ga0207687_10434060 | 3300025927 | Bacteria | 1086 |
| 154 | Ga0207644_10000421 | 3300025931 | Bacteria | 27476 |
| 155 | Ga0207644_10001279 | 3300025931 | Bacteria | 16188 |
| 156 | Ga0207644_10034430 | 3300025931 | Bacteria | 3544 |
| 157 | Ga0207706_10007461 | 3300025933 | Bacteria | 10114 |
| 158 | Ga0207706_10008272 | 3300025933 | Bacteria | 9600 |
| 159 | Ga0207706_10069642 | 3300025933 | Bacteria | 3094 |
| 160 | Ga0207679_10235530 | 3300025945 | Bacteria | 1548 |
| 161 | Ga0207667_10000716 | 3300025949 | Bacteria | 43016 |
| 162 | Ga0207667_10191039 | 3300025949 | Bacteria | 2101 |
| 163 | Ga0207712_10000009 | 3300025961 | Bacteria | 518177 |
| 164 | Ga0207668_10000134 | 3300025972 | Bacteria | 52027 |
| 165 | Ga0207668_10016808 | 3300025972 | Bacteria | 4575 |
| 166 | Ga0207640_10089368 | 3300025981 | Bacteria | 2129 |
| 167 | Ga0207640_10218915 | 3300025981 | Bacteria | 1456 |
| 168 | Ga0207658_10000105 | 3300025986 | Bacteria | 91475 |
| 169 | Ga0207658_10005320 | 3300025986 | Bacteria | 8847 |
| 170 | Ga0207658_10008033 | 3300025986 | Bacteria | 7188 |
| 171 | Ga0207703_10000210 | 3300026035 | Bacteria | 68170 |
| 172 | Ga0207703_10003301 | 3300026035 | Bacteria | 13539 |
| 173 | Ga0207703_10006485 | 3300026035 | Bacteria | 9341 |
| 174 | Ga0207639_10003214 | 3300026041 | Bacteria | 10985 |
| 175 | Ga0207639_10255578 | 3300026041 | Bacteria | 1530 |
| 176 | Ga0207678_10000079 | 3300026067 | Bacteria | 78764 |
| 177 | Ga0207678_10006391 | 3300026067 | Bacteria | 10465 |
| 178 | Ga0207702_10000727 | 3300026078 | Bacteria | 35312 |
| 179 | Ga0207702_10041333 | 3300026078 | Bacteria | 3866 |
| 180 | Ga0207641_10000145 | 3300026088 | Bacteria | 100817 |
| 181 | Ga0207641_10003855 | 3300026088 | Bacteria | 13129 |
| 182 | Ga0207641_10008513 | 3300026088 | Bacteria | 8478 |
| 183 | Ga0207641_10040734 | 3300026088 | Bacteria | 3891 |
| 184 | Ga0207641_10082808 | 3300026088 | Bacteria | 2788 |
| 185 | Ga0207641_10128705 | 3300026088 | Unclassified | 2270 |
| 186 | Ga0207676_10001812 | 3300026095 | Bacteria | 15661 |
| 187 | Ga0207676_10018759 | 3300026095 | Bacteria | 5036 |
| 188 | Ga0207676_10063365 | 3300026095 | Bacteria | 2936 |
| 189 | Ga0207674_10001036 | 3300026116 | Bacteria | 36260 |
| 190 | Ga0207674_10011366 | 3300026116 | Bacteria | 10004 |
| 191 | Ga0207674_10044060 | 3300026116 | Bacteria | 4598 |
| 192 | Ga0207674_10148655 | 3300026116 | Bacteria | 2300 |
| 193 | Ga0207675_100001977 | 3300026118 | Bacteria | 20443 |
| 194 | Ga0207698_10059579 | 3300026142 | Bacteria | 2965 |
| 195 | Ga0209813_10001114 | 3300027866 | Bacteria | 5991 |
| 196 | Ga0268266_10000009 | 3300028379 | Bacteria | 1097737 |
| 197 | Ga0268266_10000131 | 3300028379 | Bacteria | 146628 |
| 198 | Ga0268266_10002579 | 3300028379 | Bacteria | 19230 |
| 199 | Ga0268266_10019026 | 3300028379 | Bacteria | 5850 |
| 200 | Ga0268265_10001399 | 3300028380 | Bacteria | 20452 |
| 201 | Ga0268265_10005805 | 3300028380 | Bacteria | 8421 |
| 202 | Ga0268265_10139881 | 3300028380 | Bacteria | 2025 |
| 203 | Ga0268264_10000003 | 3300028381 | Bacteria | 1141976 |
| 204 | Ga0268264_10000070 | 3300028381 | Bacteria | 268524 |
| 205 | Ga0268264_10000078 | 3300028381 | Bacteria | 249595 |
| 206 | Ga0316177_1038734 | 3300030731 | Bacteria | 1470 |
| 207 | Ga0307408_100014585 | 3300031548 | Bacteria | 5222 |
| 208 | Ga0307408_100025861 | 3300031548 | Bacteria | 4023 |
| 209 | Ga0307408_100062557 | 3300031548 | Bacteria | 2720 |
| 210 | Ga0307508_10012591 | 3300031616 | Bacteria | 7737 |
| 211 | Ga0316576_10116908 | 3300031727 | Bacteria | 2001 |
| 212 | Ga0307405_10008734 | 3300031731 | Bacteria | 5152 |
| 213 | Ga0307405_10009874 | 3300031731 | Bacteria | 4913 |
| 214 | Ga0307406_10011396 | 3300031901 | Bacteria | 5045 |
| 215 | Ga0307406_10050193 | 3300031901 | Bacteria | 2643 |
| 216 | Ga0307412_10070655 | 3300031911 | Bacteria | 2380 |
| 217 | Ga0307416_100085937 | 3300032002 | Bacteria | 2679 |
| 218 | Ga0316583_10003009 | 3300032133 | Bacteria | 5924 |
| 219 | Ga0307510_10091365 | 3300033180 | Bacteria | 2887 |
| 220 | Ga0373936_0069810 | 3300035113 | Bacteria | 1446 |
| 221 | Ga0373941_0068317 | 3300035115 | Bacteria | 1174 |
| 222 | Ga0373943_0027566 | 3300035170 | Bacteria | 2670 |
| 223 | Ga0373935_0013438 | 3300035692 | Bacteria | 4939 |
| 224 | Ga0373927_0047944 | 3300035695 | Bacteria | 2763 |
| 225 | Ga0373947_0001499 | 3300035725 | Bacteria | 14324 |
| 226 | Ga0373937_0106581 | 3300036401 | Bacteria | 2605 |
| 227 | Ga0316584_0060786 | 3300036712 | Bacteria | 2830 |
| 228 | Ga0373925_0005204 | 3300037068 | Bacteria | 9727 |
| 229 | Ga0395899_0029687 | 3300037312 | Bacteria | 4113 |
| 230 | Ga0395899_0031471 | 3300037312 | Bacteria | 3987 |
| 231 | Ga0395900_0004338 | 3300037418 | Bacteria | 15047 |
| 232 | Ga0395900_0012537 | 3300037418 | Bacteria | 8672 |
| 233 | Ga0395900_0018987 | 3300037418 | Bacteria | 7012 |
| 234 | Ga0395900_0021088 | 3300037418 | Bacteria | 6659 |
| 235 | Ga0395900_0082516 | 3300037418 | Bacteria | 3303 |
| 236 | Ga0395900_0123944 | 3300037418 | Bacteria | 2650 |
| 237 | Ga0395900_0181694 | 3300037418 | Bacteria | 2137 |
| 238 | Ga0395900_0303787 | 3300037418 | Bacteria | 1581 |
| 239 | Ga0395898_0017964 | 3300037466 | Bacteria | 7216 |
| 240 | Ga0395898_0047178 | 3300037466 | Bacteria | 4228 |
| 241 | Ga0395898_0125839 | 3300037466 | Bacteria | 2455 |
| 242 | Ga0395905_0000967 | 3300037471 | Bacteria | 36867 |
| 243 | Ga0395905_0004248 | 3300037471 | Bacteria | 14961 |
| 244 | Ga0395905_0012219 | 3300037471 | Bacteria | 8270 |
| 245 | Ga0395905_0019295 | 3300037471 | Bacteria | 6464 |
| 246 | Ga0395905_0019322 | 3300037471 | Bacteria | 6460 |
| 247 | Ga0395905_0092411 | 3300037471 | Bacteria | 2837 |
| 248 | Ga0395905_0092673 | 3300037471 | Bacteria | 2833 |
| 249 | Ga0395905_0112290 | 3300037471 | Bacteria | 2559 |
| 250 | Ga0395905_0143436 | 3300037471 | Bacteria | 2247 |
| 251 | Ga0395905_0160612 | 3300037471 | Bacteria | 2112 |
| 252 | Ga0395905_0170521 | 3300037471 | Bacteria | 2044 |
| 253 | Ga0395905_0225126 | 3300037471 | Bacteria | 1755 |
| 254 | Ga0395901_0014221 | 3300038443 | Bacteria | 8103 |
| 255 | Ga0395901_0035946 | 3300038443 | Bacteria | 5118 |
| 256 | Ga0395901_0054591 | 3300038443 | Bacteria | 4153 |
| 257 | Ga0395901_0075844 | 3300038443 | Bacteria | 3508 |
| 258 | Ga0395901_0129869 | 3300038443 | Bacteria | 2647 |
| 259 | Ga0395901_0135599 | 3300038443 | Bacteria | 2587 |
| 260 | Ga0395901_0145707 | 3300038443 | Bacteria | 2489 |
| 261 | Ga0395901_0227641 | 3300038443 | Bacteria | 1947 |
| 262 | Ga0395901_0394830 | 3300038443 | Bacteria | 1422 |
| 263 | Ga0395901_0424259 | 3300038443 | Bacteria | 1363 |
| 264 | Ga0436361_0033754 | 3300039447 | Bacteria | 8967 |
| 265 | Ga0436361_0201739 | 3300039447 | Bacteria | 8461 |
| 266 | Ga0436361_0512068 | 3300039447 | Bacteria | 1593 |
| 267 | Ga0436361_0939956 | 3300039447 | Bacteria | 3097 |
| 268 | Ga0436361_1219833 | 3300039447 | Bacteria | 21424 |
| 269 | Ga0439436_0041375 | 3300041404 | Bacteria | 1319 |
| 270 | Ga0439461_0000005 | 3300041410 | Bacteria | 28399 |
| 271 | Ga0439445_0000595 | 3300042004 | Bacteria | 7415 |
| 272 | Ga0439448_0009999 | 3300042005 | Bacteria | 2803 |
| 273 | Ga0439455_0017331 | 3300042012 | Bacteria | 1677 |
| 274 | Ga0439458_0000419 | 3300042157 | Bacteria | 10686 |
| 275 | Ga0439458_0005492 | 3300042157 | Bacteria | 2850 |
| 276 | Ga0451576_0000017 | 3300045051 | Bacteria | 558261 |
| 277 | Ga0466967_0314874 | 3300045976 | Bacteria | 1508 |
| 278 | Ga0495627_000336 | 3300046453 | Bacteria | 44344 |
| 279 | Ga0495603_0000026 | 3300046455 | Bacteria | 61348 |
| 280 | Ga0495629_0001467 | 3300046459 | Bacteria | 18588 |
| 281 | Ga0495638_0000068 | 3300046460 | Bacteria | 167596 |
| 282 | Ga0495641_0006743 | 3300046461 | Bacteria | 7370 |
| 283 | Ga0495580_0010350 | 3300046472 | Bacteria | 7270 |
| 284 | Ga0495582_0000526 | 3300046473 | Bacteria | 21123 |
| 285 | Ga0495639_0000233 | 3300046475 | Bacteria | 27728 |
| 286 | Ga0495639_0065680 | 3300046475 | Bacteria | 1669 |
| 287 | Ga0495584_0012679 | 3300046491 | Bacteria | 4301 |
| 288 | Ga0495594_0000255 | 3300046499 | Bacteria | 25909 |
| 289 | Ga0495583_0000269 | 3300046506 | Bacteria | 85380 |
| 290 | Ga0495583_0016466 | 3300046506 | Bacteria | 3971 |
| 291 | Ga0495608_0112815 | 3300046511 | Bacteria | 1747 |
| 292 | Ga0495610_0000083 | 3300046512 | Bacteria | 112946 |
| 293 | Ga0495616_0000010 | 3300046513 | Bacteria | 224378 |
| 294 | Ga0495632_0000047 | 3300046519 | Bacteria | 138951 |
| 295 | Ga0495632_0001120 | 3300046519 | Bacteria | 22955 |
| 296 | Ga0495637_0000387 | 3300046520 | Bacteria | 32696 |
| 297 | Ga0495643_0000031 | 3300046522 | Bacteria | 257820 |
| 298 | Ga0495643_0050258 | 3300046522 | Bacteria | 2246 |
| 299 | Ga0495648_0000046 | 3300046524 | Bacteria | 167725 |
| 300 | Ga0495648_0000114 | 3300046524 | Bacteria | 98677 |
| 301 | Ga0495648_0003922 | 3300046524 | Bacteria | 12881 |
| 302 | Ga0495648_0021285 | 3300046524 | Bacteria | 4495 |
| 303 | Ga0495663_0000017 | 3300046525 | Bacteria | 138955 |
| 304 | Ga0495654_0033032 | 3300046530 | Bacteria | 2621 |
| 305 | Ga0495609_0056731 | 3300046538 | Bacteria | 1735 |
| 306 | Ga0495597_0013574 | 3300046542 | Bacteria | 3897 |
| 307 | Ga0495622_0000481 | 3300046557 | Bacteria | 25103 |
| 308 | Ga0495633_0000496 | 3300046558 | Bacteria | 39673 |
| 309 | Ga0495633_0000929 | 3300046558 | Bacteria | 24783 |
| 310 | Ga0495634_0002955 | 3300046642 | Bacteria | 13884 |
| 311 | Ga0495625_0037418 | 3300046660 | Bacteria | 3561 |
| 312 | Ga0495588_0001982 | 3300046674 | Bacteria | 8756 |
| 313 | Ga0495647_0002262 | 3300046681 | Bacteria | 6040 |
| 314 | Ga0495658_0006290 | 3300046683 | Bacteria | 5835 |
| 315 | Ga0495669_0009610 | 3300046684 | Bacteria | 4081 |
| 316 | Ga0495613_0000386 | 3300046689 | Bacteria | 38025 |
| 317 | Ga0495671_0000021 | 3300046692 | Bacteria | 257820 |
| 318 | Ga0495671_0000057 | 3300046692 | Bacteria | 114166 |
| 319 | Ga0495581_0000121 | 3300047315 | Bacteria | 33464 |
| 320 | Ga0495672_0021578 | 3300047320 | Bacteria | 4199 |
| 321 | Ga0495676_0020217 | 3300047321 | Bacteria | 5847 |
| 322 | Ga0495673_0000110 | 3300047469 | Bacteria | 166127 |
| 323 | Ga0495673_0066762 | 3300047469 | Bacteria | 1524 |
| 324 | Ga0495681_0000036 | 3300047470 | Bacteria | 124207 |
| 325 | Ga0495681_0001006 | 3300047470 | Bacteria | 21606 |
| 326 | Ga0495681_0099809 | 3300047470 | Bacteria | 1270 |
| 327 | Ga0495686_0000281 | 3300047472 | Bacteria | 89475 |
| 328 | Ga0495686_0009998 | 3300047472 | Bacteria | 6779 |
| 329 | Ga0495686_0031802 | 3300047472 | Bacteria | 3418 |
| 330 | Ga0495593_0000434 | 3300047673 | Bacteria | 23326 |
| 331 | Ga0495614_0009176 | 3300048089 | Bacteria | 4382 |
| 332 | Ga0496102_0000022 | 3300048905 | Bacteria | 246314 |
| 333 | Ga0496102_0102348 | 3300048905 | Bacteria | 2662 |
| 334 | Ga0496103_0000167 | 3300048906 | Bacteria | 68561 |
| 335 | Ga0496103_0079021 | 3300048906 | Bacteria | 2066 |
| 336 | Ga0496104_0001962 | 3300048907 | Bacteria | 17811 |
| 337 | Ga0496104_0030371 | 3300048907 | Bacteria | 5021 |
| 338 | Ga0496105_0000479 | 3300048908 | Bacteria | 26244 |
| 339 | Ga0496105_0037628 | 3300048908 | Bacteria | 3985 |
| 340 | Ga0496107_0064865 | 3300048910 | Bacteria | 2648 |
| 341 | Ga0496108_0000270 | 3300048911 | Bacteria | 44669 |
| 342 | Ga0496108_0066267 | 3300048911 | Bacteria | 3045 |
| 343 | Ga0496110_0018059 | 3300048913 | Bacteria | 5908 |
| 344 | Ga0496110_0051447 | 3300048913 | Bacteria | 3620 |
| 345 | Ga0496110_0077507 | 3300048913 | Bacteria | 2957 |
| 346 | Ga0496110_0328962 | 3300048913 | Bacteria | 1392 |
| 347 | Ga0496113_0059257 | 3300048916 | Bacteria | 2884 |
| 348 | Ga0496114_0002987 | 3300048917 | Bacteria | 12971 |
| 349 | Ga0496115_0000029 | 3300048918 | Bacteria | 141359 |
| 350 | Ga0496116_0008266 | 3300048919 | Bacteria | 9052 |
| 351 | Ga0496116_0024547 | 3300048919 | Bacteria | 4455 |
| 352 | Ga0496117_0000260 | 3300048920 | Bacteria | 99636 |
| 353 | Ga0496117_0012209 | 3300048920 | Bacteria | 7598 |
| 354 | Ga0496117_0063836 | 3300048920 | Bacteria | 2515 |
| 355 | Ga0496117_0099965 | 3300048920 | Bacteria | 1838 |
| 356 | Ga0496118_0000039 | 3300048921 | Bacteria | 305458 |
| 357 | Ga0496118_0016400 | 3300048921 | Bacteria | 6799 |
| 358 | Ga0496118_0041843 | 3300048921 | Bacteria | 3621 |
| 359 | Ga0496119_0010119 | 3300048922 | Bacteria | 7964 |
| 360 | Ga0496119_0026738 | 3300048922 | Bacteria | 3991 |
| 361 | Ga0496120_0017516 | 3300048923 | Bacteria | 4642 |
| 362 | Ga0496121_0000683 | 3300048924 | Bacteria | 63257 |
| 363 | Ga0496121_0001144 | 3300048924 | Bacteria | 46508 |
| 364 | Ga0496121_0003936 | 3300048924 | Bacteria | 20562 |
| 365 | Ga0496122_0026031 | 3300048925 | Bacteria | 5061 |
| 366 | Ga0496122_0037986 | 3300048925 | Bacteria | 3866 |
| 367 | Ga0496122_0163263 | 3300048925 | Bacteria | 1355 |
| 368 | Ga0496123_0034180 | 3300048926 | Bacteria | 3646 |
| 369 | Ga0496123_0103020 | 3300048926 | Bacteria | 1655 |
| 370 | Ga0496124_0000076 | 3300048927 | Bacteria | 215767 |
| 371 | Ga0496124_0019841 | 3300048927 | Bacteria | 6237 |
| 372 | Ga0496125_0000505 | 3300048928 | Bacteria | 67726 |
| 373 | Ga0496125_0059705 | 3300048928 | Bacteria | 3070 |
| 374 | Ga0496126_0000469 | 3300048929 | Bacteria | 80156 |
| 375 | Ga0496126_0020335 | 3300048929 | Bacteria | 6514 |
| 376 | Ga0496126_0033481 | 3300048929 | Bacteria | 4834 |
| 377 | Ga0496126_0075554 | 3300048929 | Bacteria | 2990 |
| 378 | Ga0495678_026408 | 3300049459 | Bacteria | 2480 |
| 379 | Ga0501034_0164253 | 3300049571 | Bacteria | 2190 |
| 380 | Ga0501211_002826 | 3300049658 | Bacteria | 1819 |
| 381 | Ga0501223_000054 | 3300049663 | Bacteria | 38195 |
| 382 | Ga0501224_015571 | 3300049664 | Bacteria | 1127 |
| 383 | Ga0501235_003549 | 3300049669 | Bacteria | 3372 |
| 384 | Ga0501246_000807 | 3300049676 | Bacteria | 2321 |
| 385 | Ga0501225_0000004 | 3300049705 | Bacteria | 140738 |
| 386 | Ga0501225_0049060 | 3300049705 | Bacteria | 1173 |
| 387 | Ga0501234_001459 | 3300049707 | Bacteria | 3712 |
| 388 | Ga0501282_009656 | 3300049778 | Bacteria | 1036 |
| 389 | Ga0501044_0012999 | 3300049823 | Bacteria | 9012 |
| 390 | nmdc:mga03683_757_c1 | 3300050489 | Bacteria | 9260 |
| 391 | nmdc:mga03n38_30699_c1 | 3300050490 | Bacteria | 2261 |
| 392 | nmdc:mga06z11_119_c1 | 3300050494 | Bacteria | 32670 |
| 393 | nmdc:mga04h51_37_c1 | 3300050495 | Bacteria | 45941 |
| 394 | nmdc:mga07m45_22875_c1 | 3300050496 | Bacteria | 3413 |
| 395 | nmdc:mga0qj67_527803_c1 | 3300050509 | Unclassified | 948 |
| 396 | nmdc:mga06r32_6191_c1 | 3300050510 | Bacteria | 10741 |
| 397 | nmdc:mga0n895_44670_c1 | 3300050512 | Bacteria | 4320 |
| 398 | nmdc:mga0n895_582937_c1 | 3300050512 | Bacteria | 1122 |
| 399 | Ga0495619_0067280 | 3300053085 | Bacteria | 2391 |
| 400 | Ga0500643_000134 | 3300053087 | Bacteria | 75321 |
| 401 | Ga0500651_0023412 | 3300053093 | Bacteria | 3868 |
| 402 | Ga0500641_0047782 | 3300053096 | Bacteria | 1751 |
| 403 | Ga0500562_005025 | 3300053108 | Bacteria | 3327 |
| 404 | Ga0500592_000167 | 3300053116 | Bacteria | 13144 |
| 405 | Ga0500608_000042 | 3300053122 | Bacteria | 56626 |
| 406 | Ga0500655_000111 | 3300053133 | Bacteria | 21178 |
| 407 | Ga0500590_000373 | 3300053148 | Bacteria | 14845 |
| 408 | Ga0500590_006730 | 3300053148 | Bacteria | 5618 |
| 409 | Ga0500604_0000031 | 3300053151 | Bacteria | 57942 |
| 410 | Ga0500624_000005 | 3300053157 | Bacteria | 187122 |
| 411 | Ga0500627_0000078 | 3300053158 | Bacteria | 36296 |
| 412 | Ga0500627_0031816 | 3300053158 | Bacteria | 2219 |
| 413 | Ga0500627_0058707 | 3300053158 | Bacteria | 1689 |
| 414 | Ga0500639_019031 | 3300053163 | Bacteria | 3622 |
| 415 | Ga0500567_000588 | 3300053723 | Bacteria | 12916 |
| 416 | Ga0500570_000123 | 3300053724 | Bacteria | 22515 |
| 417 | Ga0500625_000157 | 3300053729 | Bacteria | 14392 |
| 418 | Ga0500645_026954 | 3300053730 | Bacteria | 1745 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045976 | Ga0466967_0314874 | Ga0466967_0314874_266_1171 | 242 |
| 2 | 3300050509 | nmdc:mga0qj67_527803_c1 | nmdc:mga0qj67_527803_c1_170_934 | 252 |
| 3 | 3300041404 | Ga0439436_0041375 | Ga0439436_0041375_30_860 | 266 |
| 4 | 3300048905 | Ga0496102_0000022 | Ga0496102_0000022_138800_139708 | 268 |
| 5 | 3300048906 | Ga0496103_0000167 | Ga0496103_0000167_42983_43891 | 268 |
| 6 | 3300048907 | Ga0496104_0001962 | Ga0496104_0001962_2857_3765 | 268 |
| 7 | 3300048908 | Ga0496105_0000479 | Ga0496105_0000479_22554_23462 | 268 |
| 8 | 3300048910 | Ga0496107_0064865 | Ga0496107_0064865_927_1835 | 268 |
| 9 | 3300048913 | Ga0496110_0051447 | Ga0496110_0051447_420_1328 | 268 |
| 10 | 3300048917 | Ga0496114_0002987 | Ga0496114_0002987_2295_3203 | 268 |
| 11 | 3300048918 | Ga0496115_0000029 | Ga0496115_0000029_97132_98040 | 268 |
| 12 | 3300048919 | Ga0496116_0008266 | Ga0496116_0008266_5280_6188 | 268 |
| 13 | 3300048920 | Ga0496117_0000260 | Ga0496117_0000260_61518_62426 | 268 |
| 14 | 3300048921 | Ga0496118_0000039 | Ga0496118_0000039_229694_230602 | 268 |
| 15 | 3300048922 | Ga0496119_0010119 | Ga0496119_0010119_2703_3611 | 268 |
| 16 | 3300048923 | Ga0496120_0017516 | Ga0496120_0017516_699_1607 | 268 |
| 17 | 3300048924 | Ga0496121_0000683 | Ga0496121_0000683_37261_38169 | 268 |
| 18 | 3300048927 | Ga0496124_0000076 | Ga0496124_0000076_75766_76674 | 268 |
| 19 | 3300048929 | Ga0496126_0000469 | Ga0496126_0000469_43229_44137 | 268 |
| 20 | 3300049778 | Ga0501282_009656 | Ga0501282_009656_105_1013 | 269 |
| 21 | 3300046524 | Ga0495648_0000114 | Ga0495648_0000114_59842_60750 | 270 |
| 22 | 3300048925 | Ga0496122_0037986 | Ga0496122_0037986_116_1024 | 270 |
| 23 | 3300048926 | Ga0496123_0034180 | Ga0496123_0034180_166_1074 | 270 |
| 24 | 3300048928 | Ga0496125_0000505 | Ga0496125_0000505_57801_58709 | 270 |
| 25 | 3300046506 | Ga0495583_0016466 | Ga0495583_0016466_1712_2620 | 271 |
| 26 | 3300031548 | Ga0307408_100062557 | Ga0307408_1000625572 | 272 |
| 27 | 3300026116 | Ga0207674_10011366 | Ga0207674_100113668 | 273 |
| 28 | 3300038443 | Ga0395901_0014221 | Ga0395901_0014221_4842_5750 | 273 |
| 29 | 3300005327 | Ga0070658_10039513 | Ga0070658_100395132 | 274 |
| 30 | 3300025909 | Ga0207705_10082407 | Ga0207705_100824072 | 274 |
| 31 | 3300050510 | nmdc:mga06r32_6191_c1 | nmdc:mga06r32_6191_c1_190_1020 | 274 |
| 32 | 3300014325 | Ga0163163_10048140 | Ga0163163_100481405 | 275 |
| 33 | 3300049658 | Ga0501211_002826 | Ga0501211_002826_977_1804 | 275 |
| 34 | 3300037312 | Ga0395899_0031471 | Ga0395899_0031471_2684_3610 | 277 |
| 35 | 3300037466 | Ga0395898_0125839 | Ga0395898_0125839_81_1007 | 277 |
| 36 | 3300005331 | Ga0070670_100004743 | Ga0070670_1000047435 | 279 |
| 37 | 3300005347 | Ga0070668_100000025 | Ga0070668_10000002531 | 279 |
| 38 | 3300005355 | Ga0070671_100001385 | Ga0070671_1000013859 | 279 |
| 39 | 3300005367 | Ga0070667_100000006 | Ga0070667_100000006301 | 279 |
| 40 | 3300005842 | Ga0068858_100000969 | Ga0068858_10000096923 | 279 |
| 41 | 3300005843 | Ga0068860_100000074 | Ga0068860_100000074142 | 279 |
| 42 | 3300005844 | Ga0068862_100000360 | Ga0068862_10000036011 | 279 |
| 43 | 3300025903 | Ga0207680_10015956 | Ga0207680_100159563 | 279 |
| 44 | 3300025925 | Ga0207650_10021560 | Ga0207650_100215605 | 279 |
| 45 | 3300025931 | Ga0207644_10000421 | Ga0207644_1000042122 | 279 |
| 46 | 3300025972 | Ga0207668_10000134 | Ga0207668_1000013413 | 279 |
| 47 | 3300025986 | Ga0207658_10000105 | Ga0207658_1000010557 | 279 |
| 48 | 3300026035 | Ga0207703_10006485 | Ga0207703_100064859 | 279 |
| 49 | 3300026088 | Ga0207641_10082808 | Ga0207641_100828084 | 279 |
| 50 | 3300028380 | Ga0268265_10001399 | Ga0268265_1000139916 | 279 |
| 51 | 3300028381 | Ga0268264_10000070 | Ga0268264_10000070238 | 279 |
| 52 | 3300006847 | Ga0075431_100035703 | Ga0075431_1000357036 | 280 |
| 53 | 3300006871 | Ga0075434_100063434 | Ga0075434_1000634343 | 280 |
| 54 | 3300050512 | nmdc:mga0n895_44670_c1 | nmdc:mga0n895_44670_c1_202_1113 | 280 |
| 55 | 3300005841 | Ga0068863_100007173 | Ga0068863_1000071734 | 281 |
| 56 | 3300026088 | Ga0207641_10128705 | Ga0207641_101287053 | 281 |
| 57 | 3300005331 | Ga0070670_100052532 | Ga0070670_1000525322 | 282 |
| 58 | 3300005353 | Ga0070669_100329049 | Ga0070669_1003290492 | 282 |
| 59 | 3300005366 | Ga0070659_100079655 | Ga0070659_1000796552 | 282 |
| 60 | 3300005577 | Ga0068857_100001897 | Ga0068857_10000189715 | 282 |
| 61 | 3300005618 | Ga0068864_100019929 | Ga0068864_1000199292 | 282 |
| 62 | 3300014325 | Ga0163163_10036223 | Ga0163163_100362234 | 282 |
| 63 | 3300025923 | Ga0207681_10126323 | Ga0207681_101263232 | 282 |
| 64 | 3300026088 | Ga0207641_10008513 | Ga0207641_100085133 | 282 |
| 65 | 3300026095 | Ga0207676_10018759 | Ga0207676_100187594 | 282 |
| 66 | 3300026116 | Ga0207674_10001036 | Ga0207674_1000103638 | 282 |
| 67 | 3300005548 | Ga0070665_100000078 | Ga0070665_1000000784 | 287 |
| 68 | 3300028379 | Ga0268266_10000131 | Ga0268266_1000013158 | 287 |
| 69 | 3300035170 | Ga0373943_0027566 | Ga0373943_0027566_1627_2553 | 287 |
| 70 | 3300035692 | Ga0373935_0013438 | Ga0373935_0013438_2926_3852 | 287 |
| 71 | 3300035695 | Ga0373927_0047944 | Ga0373927_0047944_584_1510 | 287 |
| 72 | 3300035725 | Ga0373947_0001499 | Ga0373947_0001499_12579_13505 | 287 |
| 73 | 3300036401 | Ga0373937_0106581 | Ga0373937_0106581_1086_2012 | 287 |
| 74 | 3300037068 | Ga0373925_0005204 | Ga0373925_0005204_7807_8733 | 287 |
| 75 | 3300046455 | Ga0495603_0000026 | Ga0495603_0000026_33591_34517 | 287 |
| 76 | 3300046459 | Ga0495629_0001467 | Ga0495629_0001467_3125_4051 | 287 |
| 77 | 3300046461 | Ga0495641_0006743 | Ga0495641_0006743_6276_7202 | 287 |
| 78 | 3300046472 | Ga0495580_0010350 | Ga0495580_0010350_3220_4146 | 287 |
| 79 | 3300046473 | Ga0495582_0000526 | Ga0495582_0000526_788_1714 | 287 |
| 80 | 3300046475 | Ga0495639_0000233 | Ga0495639_0000233_17806_18732 | 287 |
| 81 | 3300046499 | Ga0495594_0000255 | Ga0495594_0000255_14830_15756 | 287 |
| 82 | 3300046511 | Ga0495608_0112815 | Ga0495608_0112815_224_1150 | 287 |
| 83 | 3300046557 | Ga0495622_0000481 | Ga0495622_0000481_13548_14474 | 287 |
| 84 | 3300046642 | Ga0495634_0002955 | Ga0495634_0002955_364_1290 | 287 |
| 85 | 3300046674 | Ga0495588_0001982 | Ga0495588_0001982_6851_7777 | 287 |
| 86 | 3300046681 | Ga0495647_0002262 | Ga0495647_0002262_588_1514 | 287 |
| 87 | 3300046683 | Ga0495658_0006290 | Ga0495658_0006290_1037_1963 | 287 |
| 88 | 3300046689 | Ga0495613_0000386 | Ga0495613_0000386_9245_10171 | 287 |
| 89 | 3300047315 | Ga0495581_0000121 | Ga0495581_0000121_23440_24366 | 287 |
| 90 | 3300047321 | Ga0495676_0020217 | Ga0495676_0020217_4371_5297 | 287 |
| 91 | 3300047673 | Ga0495593_0000434 | Ga0495593_0000434_17357_18283 | 287 |
| 92 | 3300048089 | Ga0495614_0009176 | Ga0495614_0009176_2854_3780 | 287 |
| 93 | 3300053085 | Ga0495619_0067280 | Ga0495619_0067280_1383_2309 | 287 |
| 94 | 3300049707 | Ga0501234_001459 | Ga0501234_001459_1579_2448 | 288 |
| 95 | 3300005459 | Ga0068867_100142521 | Ga0068867_1001425213 | 289 |
| 96 | 3300005985 | Ga0081539_10003935 | Ga0081539_1000393515 | 289 |
| 97 | 3300050490 | nmdc:mga03n38_30699_c1 | nmdc:mga03n38_30699_c1_775_1659 | 289 |
| 98 | 3300021361 | Ga0213872_10006794 | Ga0213872_100067942 | 291 |
| 99 | 3300021361 | Ga0213872_10040170 | Ga0213872_100401702 | 291 |
| 100 | 3300021361 | Ga0213872_10042646 | Ga0213872_100426462 | 291 |
| 101 | 3300035113 | Ga0373936_0069810 | Ga0373936_0069810_120_1028 | 291 |
| 102 | 3300039447 | Ga0436361_0033754 | Ga0436361_0033754_315_1196 | 291 |
| 103 | 3300039447 | Ga0436361_0201739 | Ga0436361_0201739_3911_4792 | 291 |
| 104 | 3300039447 | Ga0436361_0512068 | Ga0436361_0512068_539_1420 | 291 |
| 105 | 3300039447 | Ga0436361_0939956 | Ga0436361_0939956_780_1661 | 291 |
| 106 | 3300039447 | Ga0436361_1219833 | Ga0436361_1219833_13952_14830 | 291 |
| 107 | 3300041410 | Ga0439461_0000005 | Ga0439461_0000005_8120_9028 | 292 |
| 108 | 3300005841 | Ga0068863_100079946 | Ga0068863_1000799463 | 294 |
| 109 | 3300025925 | Ga0207650_10116051 | Ga0207650_101160514 | 294 |
| 110 | 3300026088 | Ga0207641_10040734 | Ga0207641_100407344 | 294 |
| 111 | 3300049571 | Ga0501034_0164253 | Ga0501034_0164253_762_1682 | 295 |
| 112 | iso_pu_bacteria | 2882806704 | 2882808796 | 296 |
| 113 | iso_pu_bacteria | 2512564014 | 2512644621 | 297 |
| 114 | iso_pu_bacteria | 2582581305 | 2585263149 | 297 |
| 115 | iso_pu_bacteria | 2775507255 | 2778125709 | 297 |
| 116 | iso_pu_bacteria | 2808606401 | 2809065127 | 297 |
| 117 | iso_pu_bacteria | 2808606404 | 2809081094 | 297 |
| 118 | iso_pu_bacteria | 2808606405 | 2809085459 | 297 |
| 119 | iso_pu_bacteria | 2880518877 | 2880520738 | 297 |
| 120 | iso_pu_bacteria | 2919709256 | 2919712535 | 297 |
| 121 | 3300003784 | Ga0055534_1020815 | Ga0055534_10208151 | 298 |
| 122 | 3300031727 | Ga0316576_10116908 | Ga0316576_101169082 | 298 |
| 123 | 3300005539 | Ga0068853_100232830 | Ga0068853_1002328302 | 299 |
| 124 | 3300005539 | Ga0068853_100294024 | Ga0068853_1002940242 | 299 |
| 125 | 3300025904 | Ga0207647_10214948 | Ga0207647_102149481 | 299 |
| 126 | 3300030731 | Ga0316177_1038734 | Ga0316177_10387342 | 299 |
| 127 | 3300037418 | Ga0395900_0018987 | Ga0395900_0018987_3558_4526 | 299 |
| 128 | 3300037466 | Ga0395898_0017964 | Ga0395898_0017964_1529_2497 | 299 |
| 129 | 3300038443 | Ga0395901_0227641 | Ga0395901_0227641_595_1563 | 299 |
| 130 | iso_pu_bacteria | 2738541275 | 2738710666 | 299 |
| 131 | iso_pu_bacteria | 2738541301 | 2738849091 | 299 |
| 132 | iso_pu_bacteria | 2738541304 | 2738864820 | 299 |
| 133 | iso_pu_bacteria | 2738543022 | 2739297338 | 299 |
| 134 | iso_pu_bacteria | 2738543033 | 2739359016 | 299 |
| 135 | iso_pu_bacteria | 2928100450 | 2928100767 | 299 |
| 136 | iso_pu_bacteria | 2928959182 | 2928960830 | 299 |
| 137 | 3300002459 | JGI24751J29686_10000210 | JGI24751J29686_1000021023 | 300 |
| 138 | 3300006237 | Ga0097621_100039192 | Ga0097621_1000391925 | 300 |
| 139 | 3300013102 | Ga0157371_10085725 | Ga0157371_100857252 | 300 |
| 140 | 3300031616 | Ga0307508_10012591 | Ga0307508_100125913 | 300 |
| 141 | 3300045051 | Ga0451576_0000017 | Ga0451576_0000017_340121_341029 | 300 |
| 142 | 3300049664 | Ga0501224_015571 | Ga0501224_015571_69_974 | 300 |
| 143 | 3300053151 | Ga0500604_0000031 | Ga0500604_0000031_32540_33448 | 300 |
| 144 | 3300001904 | JGI24736J21556_1000464 | JGI24736J21556_10004642 | 301 |
| 145 | 3300001904 | JGI24736J21556_1001337 | JGI24736J21556_10013374 | 301 |
| 146 | 3300001915 | JGI24741J21665_1000069 | JGI24741J21665_10000694 | 301 |
| 147 | 3300001976 | JGI24752J21851_1000454 | JGI24752J21851_10004544 | 301 |
| 148 | 3300001979 | JGI24740J21852_10002676 | JGI24740J21852_100026762 | 301 |
| 149 | 3300001979 | JGI24740J21852_10020243 | JGI24740J21852_100202432 | 301 |
| 150 | 3300001979 | JGI24740J21852_10040483 | JGI24740J21852_100404832 | 301 |
| 151 | 3300001989 | JGI24739J22299_10000697 | JGI24739J22299_1000069717 | 301 |
| 152 | 3300001989 | JGI24739J22299_10002049 | JGI24739J22299_100020496 | 301 |
| 153 | 3300001990 | JGI24737J22298_10002270 | JGI24737J22298_100022702 | 301 |
| 154 | 3300001990 | JGI24737J22298_10003279 | JGI24737J22298_100032792 | 301 |
| 155 | 3300001990 | JGI24737J22298_10010614 | JGI24737J22298_100106144 | 301 |
| 156 | 3300002067 | JGI24735J21928_10000951 | JGI24735J21928_100009518 | 301 |
| 157 | 3300002067 | JGI24735J21928_10002415 | JGI24735J21928_100024152 | 301 |
| 158 | 3300002070 | JGI24750J21931_1000400 | JGI24750J21931_10004006 | 301 |
| 159 | 3300002074 | JGI24748J21848_1000030 | JGI24748J21848_100003031 | 301 |
| 160 | 3300002075 | JGI24738J21930_10000736 | JGI24738J21930_1000073610 | 301 |
| 161 | 3300002239 | JGI24034J26672_10000014 | JGI24034J26672_100000148 | 301 |
| 162 | 3300002239 | JGI24034J26672_10000046 | JGI24034J26672_1000004648 | 301 |
| 163 | 3300005289 | Ga0065704_10070376 | Ga0065704_1007037611 | 301 |
| 164 | 3300005289 | Ga0065704_10075413 | Ga0065704_100754132 | 301 |
| 165 | 3300005327 | Ga0070658_10007890 | Ga0070658_100078905 | 301 |
| 166 | 3300005327 | Ga0070658_10026116 | Ga0070658_100261161 | 301 |
| 167 | 3300005330 | Ga0070690_100000005 | Ga0070690_10000000524 | 301 |
| 168 | 3300005331 | Ga0070670_100019456 | Ga0070670_1000194567 | 301 |
| 169 | 3300005331 | Ga0070670_100053433 | Ga0070670_1000534333 | 301 |
| 170 | 3300005335 | Ga0070666_10000011 | Ga0070666_10000011243 | 301 |
| 171 | 3300005335 | Ga0070666_10155096 | Ga0070666_101550962 | 301 |
| 172 | 3300005339 | Ga0070660_100091405 | Ga0070660_1000914052 | 301 |
| 173 | 3300005347 | Ga0070668_100031943 | Ga0070668_1000319431 | 301 |
| 174 | 3300005353 | Ga0070669_100000123 | Ga0070669_10000012320 | 301 |
| 175 | 3300005353 | Ga0070669_100051879 | Ga0070669_1000518794 | 301 |
| 176 | 3300005353 | Ga0070669_100061661 | Ga0070669_1000616613 | 301 |
| 177 | 3300005355 | Ga0070671_100002401 | Ga0070671_1000024015 | 301 |
| 178 | 3300005355 | Ga0070671_100148934 | Ga0070671_1001489342 | 301 |
| 179 | 3300005365 | Ga0070688_100002976 | Ga0070688_1000029768 | 301 |
| 180 | 3300005366 | Ga0070659_100012883 | Ga0070659_1000128833 | 301 |
| 181 | 3300005366 | Ga0070659_100017500 | Ga0070659_1000175003 | 301 |
| 182 | 3300005367 | Ga0070667_100000660 | Ga0070667_10000066027 | 301 |
| 183 | 3300005367 | Ga0070667_100009763 | Ga0070667_1000097638 | 301 |
| 184 | 3300005367 | Ga0070667_100252145 | Ga0070667_1002521452 | 301 |
| 185 | 3300005455 | Ga0070663_100039233 | Ga0070663_1000392334 | 301 |
| 186 | 3300005455 | Ga0070663_100149583 | Ga0070663_1001495832 | 301 |
| 187 | 3300005457 | Ga0070662_100134343 | Ga0070662_1001343432 | 301 |
| 188 | 3300005466 | Ga0070685_10001167 | Ga0070685_1000116710 | 301 |
| 189 | 3300005466 | Ga0070685_10020959 | Ga0070685_100209594 | 301 |
| 190 | 3300005539 | Ga0068853_100103499 | Ga0068853_1001034993 | 301 |
| 191 | 3300005544 | Ga0070686_100000001 | Ga0070686_100000001277 | 301 |
| 192 | 3300005544 | Ga0070686_100000259 | Ga0070686_1000002594 | 301 |
| 193 | 3300005548 | Ga0070665_100000004 | Ga0070665_1000000048 | 301 |
| 194 | 3300005548 | Ga0070665_100002184 | Ga0070665_10000218411 | 301 |
| 195 | 3300005548 | Ga0070665_100130227 | Ga0070665_1001302273 | 301 |
| 196 | 3300005548 | Ga0070665_100202588 | Ga0070665_1002025882 | 301 |
| 197 | 3300005564 | Ga0070664_100031094 | Ga0070664_1000310944 | 301 |
| 198 | 3300005564 | Ga0070664_100252178 | Ga0070664_1002521782 | 301 |
| 199 | 3300005577 | Ga0068857_100053886 | Ga0068857_1000538862 | 301 |
| 200 | 3300005614 | Ga0068856_100009259 | Ga0068856_10000925910 | 301 |
| 201 | 3300005618 | Ga0068864_100001665 | Ga0068864_10000166510 | 301 |
| 202 | 3300005618 | Ga0068864_100008568 | Ga0068864_1000085689 | 301 |
| 203 | 3300005719 | Ga0068861_100009524 | Ga0068861_1000095249 | 301 |
| 204 | 3300005841 | Ga0068863_100000046 | Ga0068863_100000046114 | 301 |
| 205 | 3300005841 | Ga0068863_100000058 | Ga0068863_10000005890 | 301 |
| 206 | 3300005841 | Ga0068863_100010071 | Ga0068863_1000100712 | 301 |
| 207 | 3300005842 | Ga0068858_100024081 | Ga0068858_1000240812 | 301 |
| 208 | 3300005843 | Ga0068860_100000030 | Ga0068860_10000003017 | 301 |
| 209 | 3300005843 | Ga0068860_100000057 | Ga0068860_100000057186 | 301 |
| 210 | 3300005844 | Ga0068862_100001011 | Ga0068862_10000101124 | 301 |
| 211 | 3300005844 | Ga0068862_100138066 | Ga0068862_1001380662 | 301 |
| 212 | 3300006042 | Ga0075368_10000565 | Ga0075368_1000056511 | 301 |
| 213 | 3300006178 | Ga0075367_10007298 | Ga0075367_100072986 | 301 |
| 214 | 3300006353 | Ga0075370_10031257 | Ga0075370_100312572 | 301 |
| 215 | 3300009011 | Ga0105251_10007138 | Ga0105251_100071382 | 301 |
| 216 | 3300009092 | Ga0105250_10049618 | Ga0105250_100496182 | 301 |
| 217 | 3300009147 | Ga0114129_10551038 | Ga0114129_105510381 | 301 |
| 218 | 3300009174 | Ga0105241_10002141 | Ga0105241_1000214113 | 301 |
| 219 | 3300009177 | Ga0105248_10459944 | Ga0105248_104599442 | 301 |
| 220 | 3300009545 | Ga0105237_10072875 | Ga0105237_100728754 | 301 |
| 221 | 3300009551 | Ga0105238_10291451 | Ga0105238_102914512 | 301 |
| 222 | 3300009553 | Ga0105249_10000016 | Ga0105249_1000001617 | 301 |
| 223 | 3300009978 | Ga0105148_100361 | Ga0105148_1003613 | 301 |
| 224 | 3300010375 | Ga0105239_10538009 | Ga0105239_105380092 | 301 |
| 225 | 3300013100 | Ga0157373_10123191 | Ga0157373_101231912 | 301 |
| 226 | 3300013102 | Ga0157371_10073522 | Ga0157371_100735222 | 301 |
| 227 | 3300013102 | Ga0157371_10299381 | Ga0157371_102993811 | 301 |
| 228 | 3300013104 | Ga0157370_10107037 | Ga0157370_101070372 | 301 |
| 229 | 3300013105 | Ga0157369_10044451 | Ga0157369_100444513 | 301 |
| 230 | 3300013306 | Ga0163162_10098740 | Ga0163162_100987404 | 301 |
| 231 | 3300013307 | Ga0157372_10129606 | Ga0157372_101296063 | 301 |
| 232 | 3300014326 | Ga0157380_10000454 | Ga0157380_1000045413 | 301 |
| 233 | 3300014968 | Ga0157379_10003523 | Ga0157379_100035239 | 301 |
| 234 | 3300017792 | Ga0163161_10000037 | Ga0163161_10000037138 | 301 |
| 235 | 3300017792 | Ga0163161_10048288 | Ga0163161_100482883 | 301 |
| 236 | 3300025229 | Ga0209147_100882 | Ga0209147_1008828 | 301 |
| 237 | 3300025903 | Ga0207680_10000008 | Ga0207680_10000008269 | 301 |
| 238 | 3300025903 | Ga0207680_10248745 | Ga0207680_102487451 | 301 |
| 239 | 3300025904 | Ga0207647_10000301 | Ga0207647_100003018 | 301 |
| 240 | 3300025909 | Ga0207705_10068816 | Ga0207705_100688162 | 301 |
| 241 | 3300025909 | Ga0207705_10221174 | Ga0207705_102211742 | 301 |
| 242 | 3300025911 | Ga0207654_10006583 | Ga0207654_100065834 | 301 |
| 243 | 3300025913 | Ga0207695_10002890 | Ga0207695_100028907 | 301 |
| 244 | 3300025913 | Ga0207695_10018738 | Ga0207695_1001873811 | 301 |
| 245 | 3300025914 | Ga0207671_10000592 | Ga0207671_1000059225 | 301 |
| 246 | 3300025914 | Ga0207671_10152696 | Ga0207671_101526961 | 301 |
| 247 | 3300025919 | Ga0207657_10020085 | Ga0207657_100200856 | 301 |
| 248 | 3300025919 | Ga0207657_10039417 | Ga0207657_100394174 | 301 |
| 249 | 3300025920 | Ga0207649_10197479 | Ga0207649_101974792 | 301 |
| 250 | 3300025923 | Ga0207681_10000038 | Ga0207681_1000003829 | 301 |
| 251 | 3300025923 | Ga0207681_10063203 | Ga0207681_100632033 | 301 |
| 252 | 3300025923 | Ga0207681_10122480 | Ga0207681_101224802 | 301 |
| 253 | 3300025923 | Ga0207681_10190650 | Ga0207681_101906502 | 301 |
| 254 | 3300025924 | Ga0207694_10001595 | Ga0207694_100015958 | 301 |
| 255 | 3300025924 | Ga0207694_10071656 | Ga0207694_100716562 | 301 |
| 256 | 3300025924 | Ga0207694_10071728 | Ga0207694_100717283 | 301 |
| 257 | 3300025925 | Ga0207650_10017809 | Ga0207650_100178096 | 301 |
| 258 | 3300025925 | Ga0207650_10164214 | Ga0207650_101642142 | 301 |
| 259 | 3300025927 | Ga0207687_10434060 | Ga0207687_104340601 | 301 |
| 260 | 3300025931 | Ga0207644_10001279 | Ga0207644_100012797 | 301 |
| 261 | 3300025931 | Ga0207644_10034430 | Ga0207644_100344303 | 301 |
| 262 | 3300025933 | Ga0207706_10007461 | Ga0207706_100074614 | 301 |
| 263 | 3300025933 | Ga0207706_10008272 | Ga0207706_100082723 | 301 |
| 264 | 3300025933 | Ga0207706_10069642 | Ga0207706_100696422 | 301 |
| 265 | 3300025945 | Ga0207679_10235530 | Ga0207679_102355302 | 301 |
| 266 | 3300025949 | Ga0207667_10000716 | Ga0207667_100007166 | 301 |
| 267 | 3300025949 | Ga0207667_10191039 | Ga0207667_101910392 | 301 |
| 268 | 3300025961 | Ga0207712_10000009 | Ga0207712_10000009269 | 301 |
| 269 | 3300025972 | Ga0207668_10016808 | Ga0207668_100168085 | 301 |
| 270 | 3300025981 | Ga0207640_10089368 | Ga0207640_100893682 | 301 |
| 271 | 3300025981 | Ga0207640_10218915 | Ga0207640_102189152 | 301 |
| 272 | 3300025986 | Ga0207658_10005320 | Ga0207658_100053202 | 301 |
| 273 | 3300025986 | Ga0207658_10008033 | Ga0207658_100080332 | 301 |
| 274 | 3300026035 | Ga0207703_10000210 | Ga0207703_1000021036 | 301 |
| 275 | 3300026035 | Ga0207703_10003301 | Ga0207703_100033014 | 301 |
| 276 | 3300026041 | Ga0207639_10003214 | Ga0207639_100032145 | 301 |
| 277 | 3300026041 | Ga0207639_10255578 | Ga0207639_102555782 | 301 |
| 278 | 3300026067 | Ga0207678_10000079 | Ga0207678_1000007945 | 301 |
| 279 | 3300026067 | Ga0207678_10006391 | Ga0207678_100063917 | 301 |
| 280 | 3300026078 | Ga0207702_10000727 | Ga0207702_1000072737 | 301 |
| 281 | 3300026078 | Ga0207702_10041333 | Ga0207702_100413332 | 301 |
| 282 | 3300026088 | Ga0207641_10000145 | Ga0207641_1000014575 | 301 |
| 283 | 3300026088 | Ga0207641_10003855 | Ga0207641_100038552 | 301 |
| 284 | 3300026095 | Ga0207676_10001812 | Ga0207676_100018125 | 301 |
| 285 | 3300026095 | Ga0207676_10063365 | Ga0207676_100633652 | 301 |
| 286 | 3300026116 | Ga0207674_10044060 | Ga0207674_100440603 | 301 |
| 287 | 3300026116 | Ga0207674_10148655 | Ga0207674_101486552 | 301 |
| 288 | 3300026118 | Ga0207675_100001977 | Ga0207675_10000197717 | 301 |
| 289 | 3300026142 | Ga0207698_10059579 | Ga0207698_100595791 | 301 |
| 290 | 3300027866 | Ga0209813_10001114 | Ga0209813_100011143 | 301 |
| 291 | 3300028379 | Ga0268266_10000009 | Ga0268266_10000009781 | 301 |
| 292 | 3300028379 | Ga0268266_10002579 | Ga0268266_1000257912 | 301 |
| 293 | 3300028379 | Ga0268266_10019026 | Ga0268266_100190262 | 301 |
| 294 | 3300028380 | Ga0268265_10005805 | Ga0268265_100058059 | 301 |
| 295 | 3300028380 | Ga0268265_10139881 | Ga0268265_101398812 | 301 |
| 296 | 3300028381 | Ga0268264_10000003 | Ga0268264_10000003891 | 301 |
| 297 | 3300028381 | Ga0268264_10000078 | Ga0268264_100000788 | 301 |
| 298 | 3300031548 | Ga0307408_100014585 | Ga0307408_1000145855 | 301 |
| 299 | 3300031548 | Ga0307408_100025861 | Ga0307408_1000258613 | 301 |
| 300 | 3300031731 | Ga0307405_10008734 | Ga0307405_100087345 | 301 |
| 301 | 3300031731 | Ga0307405_10009874 | Ga0307405_100098745 | 301 |
| 302 | 3300031901 | Ga0307406_10011396 | Ga0307406_100113964 | 301 |
| 303 | 3300031901 | Ga0307406_10050193 | Ga0307406_100501933 | 301 |
| 304 | 3300031911 | Ga0307412_10070655 | Ga0307412_100706552 | 301 |
| 305 | 3300032002 | Ga0307416_100085937 | Ga0307416_1000859371 | 301 |
| 306 | 3300032133 | Ga0316583_10003009 | Ga0316583_100030092 | 301 |
| 307 | 3300033180 | Ga0307510_10091365 | Ga0307510_100913652 | 301 |
| 308 | 3300035115 | Ga0373941_0068317 | Ga0373941_0068317_161_1141 | 301 |
| 309 | 3300036712 | Ga0316584_0060786 | Ga0316584_0060786_1859_2782 | 301 |
| 310 | 3300037312 | Ga0395899_0029687 | Ga0395899_0029687_2976_3905 | 301 |
| 311 | 3300037418 | Ga0395900_0004338 | Ga0395900_0004338_6115_7044 | 301 |
| 312 | 3300037418 | Ga0395900_0012537 | Ga0395900_0012537_4282_5211 | 301 |
| 313 | 3300037418 | Ga0395900_0021088 | Ga0395900_0021088_1944_2873 | 301 |
| 314 | 3300037418 | Ga0395900_0082516 | Ga0395900_0082516_951_1880 | 301 |
| 315 | 3300037418 | Ga0395900_0123944 | Ga0395900_0123944_860_1789 | 301 |
| 316 | 3300037418 | Ga0395900_0181694 | Ga0395900_0181694_508_1437 | 301 |
| 317 | 3300037418 | Ga0395900_0303787 | Ga0395900_0303787_267_1184 | 301 |
| 318 | 3300037466 | Ga0395898_0047178 | Ga0395898_0047178_3208_4137 | 301 |
| 319 | 3300037471 | Ga0395905_0000967 | Ga0395905_0000967_871_1800 | 301 |
| 320 | 3300037471 | Ga0395905_0004248 | Ga0395905_0004248_6049_6978 | 301 |
| 321 | 3300037471 | Ga0395905_0012219 | Ga0395905_0012219_1411_2334 | 301 |
| 322 | 3300037471 | Ga0395905_0019295 | Ga0395905_0019295_3813_4742 | 301 |
| 323 | 3300037471 | Ga0395905_0019322 | Ga0395905_0019322_956_1885 | 301 |
| 324 | 3300037471 | Ga0395905_0092411 | Ga0395905_0092411_989_1918 | 301 |
| 325 | 3300037471 | Ga0395905_0092673 | Ga0395905_0092673_1015_1944 | 301 |
| 326 | 3300037471 | Ga0395905_0112290 | Ga0395905_0112290_914_1843 | 301 |
| 327 | 3300037471 | Ga0395905_0143436 | Ga0395905_0143436_739_1668 | 301 |
| 328 | 3300037471 | Ga0395905_0160612 | Ga0395905_0160612_636_1565 | 301 |
| 329 | 3300037471 | Ga0395905_0170521 | Ga0395905_0170521_270_1178 | 301 |
| 330 | 3300037471 | Ga0395905_0225126 | Ga0395905_0225126_626_1534 | 301 |
| 331 | 3300038443 | Ga0395901_0035946 | Ga0395901_0035946_3163_4092 | 301 |
| 332 | 3300038443 | Ga0395901_0054591 | Ga0395901_0054591_729_1658 | 301 |
| 333 | 3300038443 | Ga0395901_0075844 | Ga0395901_0075844_1680_2609 | 301 |
| 334 | 3300038443 | Ga0395901_0129869 | Ga0395901_0129869_743_1672 | 301 |
| 335 | 3300038443 | Ga0395901_0135599 | Ga0395901_0135599_1185_2114 | 301 |
| 336 | 3300038443 | Ga0395901_0145707 | Ga0395901_0145707_908_1837 | 301 |
| 337 | 3300038443 | Ga0395901_0394830 | Ga0395901_0394830_327_1244 | 301 |
| 338 | 3300038443 | Ga0395901_0424259 | Ga0395901_0424259_355_1284 | 301 |
| 339 | 3300042004 | Ga0439445_0000595 | Ga0439445_0000595_2202_3128 | 301 |
| 340 | 3300042005 | Ga0439448_0009999 | Ga0439448_0009999_195_1124 | 301 |
| 341 | 3300042012 | Ga0439455_0017331 | Ga0439455_0017331_179_1108 | 301 |
| 342 | 3300042157 | Ga0439458_0000419 | Ga0439458_0000419_8912_9841 | 301 |
| 343 | 3300042157 | Ga0439458_0005492 | Ga0439458_0005492_933_1862 | 301 |
| 344 | 3300046453 | Ga0495627_000336 | Ga0495627_000336_8813_9718 | 301 |
| 345 | 3300046460 | Ga0495638_0000068 | Ga0495638_0000068_68051_68962 | 301 |
| 346 | 3300046475 | Ga0495639_0065680 | Ga0495639_0065680_124_1053 | 301 |
| 347 | 3300046491 | Ga0495584_0012679 | Ga0495584_0012679_379_1284 | 301 |
| 348 | 3300046506 | Ga0495583_0000269 | Ga0495583_0000269_14373_15284 | 301 |
| 349 | 3300046512 | Ga0495610_0000083 | Ga0495610_0000083_43182_44087 | 301 |
| 350 | 3300046513 | Ga0495616_0000010 | Ga0495616_0000010_118342_119247 | 301 |
| 351 | 3300046519 | Ga0495632_0000047 | Ga0495632_0000047_44950_45855 | 301 |
| 352 | 3300046519 | Ga0495632_0001120 | Ga0495632_0001120_14573_15484 | 301 |
| 353 | 3300046520 | Ga0495637_0000387 | Ga0495637_0000387_2716_3621 | 301 |
| 354 | 3300046522 | Ga0495643_0000031 | Ga0495643_0000031_131387_132292 | 301 |
| 355 | 3300046522 | Ga0495643_0050258 | Ga0495643_0050258_37_942 | 301 |
| 356 | 3300046524 | Ga0495648_0000046 | Ga0495648_0000046_68014_68925 | 301 |
| 357 | 3300046524 | Ga0495648_0003922 | Ga0495648_0003922_222_1127 | 301 |
| 358 | 3300046524 | Ga0495648_0021285 | Ga0495648_0021285_2204_3109 | 301 |
| 359 | 3300046525 | Ga0495663_0000017 | Ga0495663_0000017_44956_45861 | 301 |
| 360 | 3300046530 | Ga0495654_0033032 | Ga0495654_0033032_877_1785 | 301 |
| 361 | 3300046538 | Ga0495609_0056731 | Ga0495609_0056731_398_1303 | 301 |
| 362 | 3300046542 | Ga0495597_0013574 | Ga0495597_0013574_2623_3528 | 301 |
| 363 | 3300046558 | Ga0495633_0000496 | Ga0495633_0000496_27500_28405 | 301 |
| 364 | 3300046558 | Ga0495633_0000929 | Ga0495633_0000929_8420_9325 | 301 |
| 365 | 3300046660 | Ga0495625_0037418 | Ga0495625_0037418_2092_2997 | 301 |
| 366 | 3300046684 | Ga0495669_0009610 | Ga0495669_0009610_2046_2951 | 301 |
| 367 | 3300046692 | Ga0495671_0000021 | Ga0495671_0000021_125529_126434 | 301 |
| 368 | 3300046692 | Ga0495671_0000057 | Ga0495671_0000057_14580_15491 | 301 |
| 369 | 3300047320 | Ga0495672_0021578 | Ga0495672_0021578_2091_2996 | 301 |
| 370 | 3300047469 | Ga0495673_0000110 | Ga0495673_0000110_66598_67509 | 301 |
| 371 | 3300047469 | Ga0495673_0066762 | Ga0495673_0066762_471_1376 | 301 |
| 372 | 3300047470 | Ga0495681_0000036 | Ga0495681_0000036_111674_112579 | 301 |
| 373 | 3300047470 | Ga0495681_0001006 | Ga0495681_0001006_7814_8719 | 301 |
| 374 | 3300047470 | Ga0495681_0099809 | Ga0495681_0099809_38_943 | 301 |
| 375 | 3300047472 | Ga0495686_0000281 | Ga0495686_0000281_63776_64684 | 301 |
| 376 | 3300047472 | Ga0495686_0009998 | Ga0495686_0009998_1721_2629 | 301 |
| 377 | 3300047472 | Ga0495686_0031802 | Ga0495686_0031802_1043_1948 | 301 |
| 378 | 3300048905 | Ga0496102_0102348 | Ga0496102_0102348_1651_2556 | 301 |
| 379 | 3300048906 | Ga0496103_0079021 | Ga0496103_0079021_1055_1960 | 301 |
| 380 | 3300048907 | Ga0496104_0030371 | Ga0496104_0030371_229_1134 | 301 |
| 381 | 3300048908 | Ga0496105_0037628 | Ga0496105_0037628_1705_2613 | 301 |
| 382 | 3300048911 | Ga0496108_0000270 | Ga0496108_0000270_7596_8501 | 301 |
| 383 | 3300048911 | Ga0496108_0066267 | Ga0496108_0066267_533_1438 | 301 |
| 384 | 3300048913 | Ga0496110_0018059 | Ga0496110_0018059_195_1100 | 301 |
| 385 | 3300048913 | Ga0496110_0077507 | Ga0496110_0077507_1803_2708 | 301 |
| 386 | 3300048913 | Ga0496110_0328962 | Ga0496110_0328962_337_1242 | 301 |
| 387 | 3300048916 | Ga0496113_0059257 | Ga0496113_0059257_1875_2780 | 301 |
| 388 | 3300048919 | Ga0496116_0024547 | Ga0496116_0024547_1375_2280 | 301 |
| 389 | 3300048920 | Ga0496117_0012209 | Ga0496117_0012209_4958_5863 | 301 |
| 390 | 3300048920 | Ga0496117_0063836 | Ga0496117_0063836_1424_2329 | 301 |
| 391 | 3300048920 | Ga0496117_0099965 | Ga0496117_0099965_99_1004 | 301 |
| 392 | 3300048921 | Ga0496118_0016400 | Ga0496118_0016400_1371_2279 | 301 |
| 393 | 3300048921 | Ga0496118_0041843 | Ga0496118_0041843_524_1429 | 301 |
| 394 | 3300048922 | Ga0496119_0026738 | Ga0496119_0026738_2720_3625 | 301 |
| 395 | 3300048924 | Ga0496121_0001144 | Ga0496121_0001144_16783_17691 | 301 |
| 396 | 3300048924 | Ga0496121_0003936 | Ga0496121_0003936_19471_20376 | 301 |
| 397 | 3300048925 | Ga0496122_0026031 | Ga0496122_0026031_70_975 | 301 |
| 398 | 3300048925 | Ga0496122_0163263 | Ga0496122_0163263_171_1076 | 301 |
| 399 | 3300048926 | Ga0496123_0103020 | Ga0496123_0103020_271_1176 | 301 |
| 400 | 3300048927 | Ga0496124_0019841 | Ga0496124_0019841_934_1839 | 301 |
| 401 | 3300048928 | Ga0496125_0059705 | Ga0496125_0059705_1372_2277 | 301 |
| 402 | 3300048929 | Ga0496126_0020335 | Ga0496126_0020335_3690_4595 | 301 |
| 403 | 3300048929 | Ga0496126_0033481 | Ga0496126_0033481_2506_3411 | 301 |
| 404 | 3300048929 | Ga0496126_0075554 | Ga0496126_0075554_1446_2363 | 301 |
| 405 | 3300049459 | Ga0495678_026408 | Ga0495678_026408_797_1702 | 301 |
| 406 | 3300049663 | Ga0501223_000054 | Ga0501223_000054_19707_20612 | 301 |
| 407 | 3300049669 | Ga0501235_003549 | Ga0501235_003549_1604_2509 | 301 |
| 408 | 3300049676 | Ga0501246_000807 | Ga0501246_000807_1119_2024 | 301 |
| 409 | 3300049705 | Ga0501225_0000004 | Ga0501225_0000004_90165_91070 | 301 |
| 410 | 3300049705 | Ga0501225_0049060 | Ga0501225_0049060_242_1147 | 301 |
| 411 | 3300049823 | Ga0501044_0012999 | Ga0501044_0012999_88_1053 | 301 |
| 412 | 3300050489 | nmdc:mga03683_757_c1 | nmdc:mga03683_757_c1_4225_5151 | 301 |
| 413 | 3300050494 | nmdc:mga06z11_119_c1 | nmdc:mga06z11_119_c1_1727_2632 | 301 |
| 414 | 3300050495 | nmdc:mga04h51_37_c1 | nmdc:mga04h51_37_c1_43310_44215 | 301 |
| 415 | 3300050496 | nmdc:mga07m45_22875_c1 | nmdc:mga07m45_22875_c1_381_1286 | 301 |
| 416 | 3300050512 | nmdc:mga0n895_582937_c1 | nmdc:mga0n895_582937_c1_76_1002 | 301 |
| 417 | 3300053087 | Ga0500643_000134 | Ga0500643_000134_20132_21040 | 301 |
| 418 | 3300053093 | Ga0500651_0023412 | Ga0500651_0023412_498_1403 | 301 |
| 419 | 3300053096 | Ga0500641_0047782 | Ga0500641_0047782_185_1090 | 301 |
| 420 | 3300053108 | Ga0500562_005025 | Ga0500562_005025_1538_2443 | 301 |
| 421 | 3300053116 | Ga0500592_000167 | Ga0500592_000167_9461_10369 | 301 |
| 422 | 3300053122 | Ga0500608_000042 | Ga0500608_000042_11220_12149 | 301 |
| 423 | 3300053133 | Ga0500655_000111 | Ga0500655_000111_16888_17793 | 301 |
| 424 | 3300053148 | Ga0500590_000373 | Ga0500590_000373_6295_7200 | 301 |
| 425 | 3300053148 | Ga0500590_006730 | Ga0500590_006730_1022_1936 | 301 |
| 426 | 3300053157 | Ga0500624_000005 | Ga0500624_000005_31454_32362 | 301 |
| 427 | 3300053158 | Ga0500627_0000078 | Ga0500627_0000078_4406_5314 | 301 |
| 428 | 3300053158 | Ga0500627_0031816 | Ga0500627_0031816_1025_1933 | 301 |
| 429 | 3300053158 | Ga0500627_0058707 | Ga0500627_0058707_65_970 | 301 |
| 430 | 3300053163 | Ga0500639_019031 | Ga0500639_019031_1896_2801 | 301 |
| 431 | 3300053723 | Ga0500567_000588 | Ga0500567_000588_10360_11289 | 301 |
| 432 | 3300053724 | Ga0500570_000123 | Ga0500570_000123_7578_8483 | 301 |
| 433 | 3300053729 | Ga0500625_000157 | Ga0500625_000157_10395_11324 | 301 |
| 434 | 3300053730 | Ga0500645_026954 | Ga0500645_026954_619_1524 | 301 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wji-assembly1.cif.gz_A-2 | crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with nadp and tyrosine | 0.9568 | 1 | 292 |
| 8gqr-assembly1.cif.gz_A | crystal structure of viod with fad | 0.9533 | 5 | 39 |
| 4wji-assembly1.cif.gz_A-2 | crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with nadp and tyrosine | 0.9505 | 1 | 292 |
| 6qgm-assembly2.cif.gz_e | virx1 apo structure | 0.9242 | 4 | 39 |
| 3kd9-assembly2.cif.gz_C-2 | crystal structure of pyridine nucleotide disulfide oxidoreductase from pyrococcus horikoshii | 0.9225 | 5 | 39 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P40012_11_539_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9549 | 5 | 39 | 3.50.50.60 |
| af_Q0E3X3_17_318_3.50.50.100 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; | 0.9497 | 4 | 39 | 3.50.50.100 |
| af_A0A0R4IEI2_4_483_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9497 | 6 | 39 | 3.50.50.60 |
| af_Q2FV16_5_493_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9478 | 5 | 36 | 3.50.50.60 |
| af_Q10062_1_488_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9466 | 6 | 39 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520HM71-F1-model_v4 | Prephenate dehydrogenase/arogenate dehydrogenase family protein | 0.9971 | 1 | 138 |
GO:0004665
GO:0006571 GO:0008977 GO:0070403 |
| AF-A0A350KVM2-F1-model_v4 | deleted | 0.9946 | 4 | 110 |
|
| AF-A0A1F2ZZQ4-F1-model_v4 | Prephenate/arogenate dehydrogenase domain-containing protein | 0.9736 | 4 | 291 |
GO:0004665
GO:0006571 GO:0008977 GO:0070403 |
| AF-A0A353IQS3-F1-model_v4 | Prephenate/arogenate dehydrogenase family protein | 0.9728 | 2 | 279 |
GO:0004665
GO:0006571 GO:0008977 GO:0070403 |
| AF-A0A4Q1U7U3-F1-model_v4 | deleted | 0.9724 | 2 | 292 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar