F443133

General Info

Members Datasets Scaffolds Average Seq Length
434 249 418 298

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0018987|Ga0395900_0018987_3558_4526
Length 322
Sequence VIRTQGAEPPFRNVALIGLGLIGSSIARGVAEAMPEVELRGYDCDPDVRRRAASLGLVDLLAEDPAAAVAGADLVIFCVPVGAMAGAARSVGPHLAPGAVVSDVGSCKGPVLEALRETLPRAAIVPAHPIAGTENSGPEAGFAALFRNRWCILTPEIADPSADRLAAFWTALGARVEIMDAKRHDLVLAVTSHLPHLIAYTIVGTASHLEAVTEGEVIKYSAGGFRDFTRIAASDPTMWRDIFLSNRGAVLEILGRFLDDLEQLSDAIRDGDGDLLFDWFSRTRAIRRAIVQEGEAAPVPNIPAPGGEGAVGRRRSAAPAPD

Samples

Sample ID Description Type Environment
1 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
2 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
3 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
4 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
5 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
6 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
7 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
8 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
9 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
10 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
11 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
12 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
13 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
14 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
15 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
16 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
17 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
18 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
19 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
20 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
21 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
22 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
23 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
24 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
25 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
26 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
27 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
28 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
29 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
86 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
123 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
146 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
147 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
148 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
149 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
150 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
166 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
167 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
168 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
171 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
172 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
173 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
174 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
175 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
189 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
204 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
205 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
206 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
207 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
217 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
218 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
219 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
220 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
221 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
222 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
223 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
226 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
229 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
235 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
236 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
237 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
238 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
239 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
240 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
241 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
242 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
243 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
244 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
245 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
246 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
247 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
248 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
249 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.31
Metatranscriptomes 0
Isolates 3.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.91
Nodule 0
Rhizoplane 4.15
Rhizosphere 80.41
Stem 0
Stem Tuber 0
Unclassified 8.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000464 3300001904 Bacteria 7616
2 JGI24736J21556_1001337 3300001904 Bacteria 4509
3 JGI24741J21665_1000069 3300001915 Bacteria 25234
4 JGI24752J21851_1000454 3300001976 Bacteria 5534
5 JGI24740J21852_10002676 3300001979 Bacteria 7995
6 JGI24740J21852_10020243 3300001979 Bacteria 2325
7 JGI24740J21852_10040483 3300001979 Bacteria 1412
8 JGI24739J22299_10000697 3300001989 Bacteria 12185
9 JGI24739J22299_10002049 3300001989 Bacteria 7713
10 JGI24737J22298_10002270 3300001990 Bacteria 6847
11 JGI24737J22298_10003279 3300001990 Bacteria 5737
12 JGI24737J22298_10010614 3300001990 Bacteria 3036
13 JGI24735J21928_10000951 3300002067 Bacteria 10337
14 JGI24735J21928_10002415 3300002067 Bacteria 6495
15 JGI24750J21931_1000400 3300002070 Bacteria 7332
16 JGI24748J21848_1000030 3300002074 Bacteria 85078
17 JGI24738J21930_10000736 3300002075 Bacteria 9422
18 JGI24034J26672_10000014 3300002239 Bacteria 139881
19 JGI24034J26672_10000046 3300002239 Bacteria 63764
20 JGI24751J29686_10000210 3300002459 Bacteria 25006
21 Ga0055534_1020815 3300003784 Bacteria 1104
22 Ga0065704_10070376 3300005289 Bacteria 28305
23 Ga0065704_10075413 3300005289 Bacteria 5605
24 Ga0070658_10007890 3300005327 Bacteria 8572
25 Ga0070658_10026116 3300005327 Bacteria 4685
26 Ga0070658_10039513 3300005327 Bacteria 3807
27 Ga0070690_100000005 3300005330 Bacteria 142006
28 Ga0070670_100004743 3300005331 Bacteria 11413
29 Ga0070670_100019456 3300005331 Bacteria 5827
30 Ga0070670_100052532 3300005331 Bacteria 3499
31 Ga0070670_100053433 3300005331 Bacteria 3469
32 Ga0070666_10000011 3300005335 Bacteria 261736
33 Ga0070666_10155096 3300005335 Bacteria 1599
34 Ga0070660_100091405 3300005339 Bacteria 2401
35 Ga0070668_100000025 3300005347 Bacteria 93131
36 Ga0070668_100031943 3300005347 Bacteria 4006
37 Ga0070669_100000123 3300005353 Bacteria 71501
38 Ga0070669_100051879 3300005353 Bacteria 2999
39 Ga0070669_100061661 3300005353 Bacteria 2756
40 Ga0070669_100329049 3300005353 Bacteria 1235
41 Ga0070671_100001385 3300005355 Bacteria 18115
42 Ga0070671_100002401 3300005355 Bacteria 14479
43 Ga0070671_100148934 3300005355 Bacteria 1976
44 Ga0070688_100002976 3300005365 Bacteria 8634
45 Ga0070659_100012883 3300005366 Bacteria 6215
46 Ga0070659_100017500 3300005366 Bacteria 5398
47 Ga0070659_100079655 3300005366 Bacteria 2615
48 Ga0070667_100000006 3300005367 Bacteria 336732
49 Ga0070667_100000660 3300005367 Bacteria 33497
50 Ga0070667_100009763 3300005367 Bacteria 7959
51 Ga0070667_100252145 3300005367 Bacteria 1578
52 Ga0070663_100039233 3300005455 Bacteria 3308
53 Ga0070663_100149583 3300005455 Bacteria 1789
54 Ga0070662_100134343 3300005457 Bacteria 1911
55 Ga0068867_100142521 3300005459 Bacteria 1875
56 Ga0070685_10001167 3300005466 Bacteria 14058
57 Ga0070685_10020959 3300005466 Bacteria 3545
58 Ga0068853_100103499 3300005539 Bacteria 2520
59 Ga0068853_100232830 3300005539 Bacteria 1686
60 Ga0068853_100294024 3300005539 Bacteria 1500
61 Ga0070686_100000001 3300005544 Bacteria 515830
62 Ga0070686_100000259 3300005544 Bacteria 36127
63 Ga0070665_100000004 3300005548 Bacteria 785500
64 Ga0070665_100000078 3300005548 Bacteria 188101
65 Ga0070665_100002184 3300005548 Bacteria 21806
66 Ga0070665_100130227 3300005548 Bacteria 2518
67 Ga0070665_100202588 3300005548 Bacteria 1985
68 Ga0070664_100031094 3300005564 Bacteria 4457
69 Ga0070664_100252178 3300005564 Bacteria 1586
70 Ga0068857_100001897 3300005577 Bacteria 16857
71 Ga0068857_100053886 3300005577 Bacteria 3568
72 Ga0068856_100009259 3300005614 Bacteria 9568
73 Ga0068864_100001665 3300005618 Bacteria 18296
74 Ga0068864_100008568 3300005618 Bacteria 8440
75 Ga0068864_100019929 3300005618 Bacteria 5607
76 Ga0068861_100009524 3300005719 Bacteria 6712
77 Ga0068863_100000046 3300005841 Bacteria 143895
78 Ga0068863_100000058 3300005841 Bacteria 123096
79 Ga0068863_100007173 3300005841 Bacteria 10935
80 Ga0068863_100010071 3300005841 Bacteria 9199
81 Ga0068863_100079946 3300005841 Bacteria 3096
82 Ga0068858_100000969 3300005842 Bacteria 29675
83 Ga0068858_100024081 3300005842 Bacteria 5673
84 Ga0068860_100000030 3300005843 Bacteria 256364
85 Ga0068860_100000057 3300005843 Bacteria 201847
86 Ga0068860_100000074 3300005843 Bacteria 173022
87 Ga0068862_100000360 3300005844 Bacteria 49364
88 Ga0068862_100001011 3300005844 Bacteria 27000
89 Ga0068862_100138066 3300005844 Bacteria 2162
90 Ga0081539_10003935 3300005985 Bacteria 17233
91 Ga0075368_10000565 3300006042 Bacteria 11108
92 Ga0075367_10007298 3300006178 Bacteria 5652
93 Ga0097621_100039192 3300006237 Bacteria 3805
94 Ga0075370_10031257 3300006353 Bacteria 2972
95 Ga0075431_100035703 3300006847 Bacteria 5118
96 Ga0075434_100063434 3300006871 Bacteria 3677
97 Ga0105251_10007138 3300009011 Bacteria 6952
98 Ga0105250_10049618 3300009092 Bacteria 1684
99 Ga0114129_10551038 3300009147 Bacteria 1499
100 Ga0105241_10002141 3300009174 Bacteria 14918
101 Ga0105248_10459944 3300009177 Bacteria 1434
102 Ga0105237_10072875 3300009545 Bacteria 3427
103 Ga0105238_10291451 3300009551 Bacteria 1614
104 Ga0105249_10000016 3300009553 Bacteria 278643
105 Ga0105148_100361 3300009978 Bacteria 5140
106 Ga0105239_10538009 3300010375 Bacteria 1330
107 Ga0157373_10123191 3300013100 Bacteria 1822
108 Ga0157371_10073522 3300013102 Bacteria 2421
109 Ga0157371_10085725 3300013102 Bacteria 2231
110 Ga0157371_10299381 3300013102 Bacteria 1164
111 Ga0157370_10107037 3300013104 Bacteria 2616
112 Ga0157369_10044451 3300013105 Bacteria 4834
113 Ga0163162_10098740 3300013306 Bacteria 3010
114 Ga0157372_10129606 3300013307 Bacteria 2901
115 Ga0163163_10036223 3300014325 Bacteria 4793
116 Ga0163163_10048140 3300014325 Bacteria 4191
117 Ga0157380_10000454 3300014326 Bacteria 25013
118 Ga0157379_10003523 3300014968 Bacteria 13255
119 Ga0163161_10000037 3300017792 Bacteria 150124
120 Ga0163161_10048288 3300017792 Bacteria 3074
121 Ga0213872_10006794 3300021361 Bacteria 5696
122 Ga0213872_10040170 3300021361 Bacteria 2136
123 Ga0213872_10042646 3300021361 Bacteria 2068
124 Ga0209147_100882 3300025229 Bacteria 13811
125 Ga0207680_10000008 3300025903 Bacteria 518177
126 Ga0207680_10015956 3300025903 Bacteria 3933
127 Ga0207680_10248745 3300025903 Bacteria 1227
128 Ga0207647_10000301 3300025904 Bacteria 40628
129 Ga0207647_10214948 3300025904 Bacteria 1109
130 Ga0207705_10068816 3300025909 Bacteria 2564
131 Ga0207705_10082407 3300025909 Bacteria 2346
132 Ga0207705_10221174 3300025909 Bacteria 1438
133 Ga0207654_10006583 3300025911 Bacteria 5841
134 Ga0207695_10002890 3300025913 Bacteria 24889
135 Ga0207695_10018738 3300025913 Bacteria 7991
136 Ga0207671_10000592 3300025914 Bacteria 48411
137 Ga0207671_10152696 3300025914 Bacteria 1785
138 Ga0207657_10020085 3300025919 Bacteria 6325
139 Ga0207657_10039417 3300025919 Bacteria 4199
140 Ga0207649_10197479 3300025920 Bacteria 1419
141 Ga0207681_10000038 3300025923 Bacteria 153694
142 Ga0207681_10063203 3300025923 Bacteria 2552
143 Ga0207681_10122480 3300025923 Bacteria 1909
144 Ga0207681_10126323 3300025923 Bacteria 1884
145 Ga0207681_10190650 3300025923 Bacteria 1568
146 Ga0207694_10001595 3300025924 Bacteria 19193
147 Ga0207694_10071656 3300025924 Bacteria 2708
148 Ga0207694_10071728 3300025924 Bacteria 2707
149 Ga0207650_10017809 3300025925 Bacteria 4976
150 Ga0207650_10021560 3300025925 Bacteria 4552
151 Ga0207650_10116051 3300025925 Bacteria 2079
152 Ga0207650_10164214 3300025925 Bacteria 1761
153 Ga0207687_10434060 3300025927 Bacteria 1086
154 Ga0207644_10000421 3300025931 Bacteria 27476
155 Ga0207644_10001279 3300025931 Bacteria 16188
156 Ga0207644_10034430 3300025931 Bacteria 3544
157 Ga0207706_10007461 3300025933 Bacteria 10114
158 Ga0207706_10008272 3300025933 Bacteria 9600
159 Ga0207706_10069642 3300025933 Bacteria 3094
160 Ga0207679_10235530 3300025945 Bacteria 1548
161 Ga0207667_10000716 3300025949 Bacteria 43016
162 Ga0207667_10191039 3300025949 Bacteria 2101
163 Ga0207712_10000009 3300025961 Bacteria 518177
164 Ga0207668_10000134 3300025972 Bacteria 52027
165 Ga0207668_10016808 3300025972 Bacteria 4575
166 Ga0207640_10089368 3300025981 Bacteria 2129
167 Ga0207640_10218915 3300025981 Bacteria 1456
168 Ga0207658_10000105 3300025986 Bacteria 91475
169 Ga0207658_10005320 3300025986 Bacteria 8847
170 Ga0207658_10008033 3300025986 Bacteria 7188
171 Ga0207703_10000210 3300026035 Bacteria 68170
172 Ga0207703_10003301 3300026035 Bacteria 13539
173 Ga0207703_10006485 3300026035 Bacteria 9341
174 Ga0207639_10003214 3300026041 Bacteria 10985
175 Ga0207639_10255578 3300026041 Bacteria 1530
176 Ga0207678_10000079 3300026067 Bacteria 78764
177 Ga0207678_10006391 3300026067 Bacteria 10465
178 Ga0207702_10000727 3300026078 Bacteria 35312
179 Ga0207702_10041333 3300026078 Bacteria 3866
180 Ga0207641_10000145 3300026088 Bacteria 100817
181 Ga0207641_10003855 3300026088 Bacteria 13129
182 Ga0207641_10008513 3300026088 Bacteria 8478
183 Ga0207641_10040734 3300026088 Bacteria 3891
184 Ga0207641_10082808 3300026088 Bacteria 2788
185 Ga0207641_10128705 3300026088 Unclassified 2270
186 Ga0207676_10001812 3300026095 Bacteria 15661
187 Ga0207676_10018759 3300026095 Bacteria 5036
188 Ga0207676_10063365 3300026095 Bacteria 2936
189 Ga0207674_10001036 3300026116 Bacteria 36260
190 Ga0207674_10011366 3300026116 Bacteria 10004
191 Ga0207674_10044060 3300026116 Bacteria 4598
192 Ga0207674_10148655 3300026116 Bacteria 2300
193 Ga0207675_100001977 3300026118 Bacteria 20443
194 Ga0207698_10059579 3300026142 Bacteria 2965
195 Ga0209813_10001114 3300027866 Bacteria 5991
196 Ga0268266_10000009 3300028379 Bacteria 1097737
197 Ga0268266_10000131 3300028379 Bacteria 146628
198 Ga0268266_10002579 3300028379 Bacteria 19230
199 Ga0268266_10019026 3300028379 Bacteria 5850
200 Ga0268265_10001399 3300028380 Bacteria 20452
201 Ga0268265_10005805 3300028380 Bacteria 8421
202 Ga0268265_10139881 3300028380 Bacteria 2025
203 Ga0268264_10000003 3300028381 Bacteria 1141976
204 Ga0268264_10000070 3300028381 Bacteria 268524
205 Ga0268264_10000078 3300028381 Bacteria 249595
206 Ga0316177_1038734 3300030731 Bacteria 1470
207 Ga0307408_100014585 3300031548 Bacteria 5222
208 Ga0307408_100025861 3300031548 Bacteria 4023
209 Ga0307408_100062557 3300031548 Bacteria 2720
210 Ga0307508_10012591 3300031616 Bacteria 7737
211 Ga0316576_10116908 3300031727 Bacteria 2001
212 Ga0307405_10008734 3300031731 Bacteria 5152
213 Ga0307405_10009874 3300031731 Bacteria 4913
214 Ga0307406_10011396 3300031901 Bacteria 5045
215 Ga0307406_10050193 3300031901 Bacteria 2643
216 Ga0307412_10070655 3300031911 Bacteria 2380
217 Ga0307416_100085937 3300032002 Bacteria 2679
218 Ga0316583_10003009 3300032133 Bacteria 5924
219 Ga0307510_10091365 3300033180 Bacteria 2887
220 Ga0373936_0069810 3300035113 Bacteria 1446
221 Ga0373941_0068317 3300035115 Bacteria 1174
222 Ga0373943_0027566 3300035170 Bacteria 2670
223 Ga0373935_0013438 3300035692 Bacteria 4939
224 Ga0373927_0047944 3300035695 Bacteria 2763
225 Ga0373947_0001499 3300035725 Bacteria 14324
226 Ga0373937_0106581 3300036401 Bacteria 2605
227 Ga0316584_0060786 3300036712 Bacteria 2830
228 Ga0373925_0005204 3300037068 Bacteria 9727
229 Ga0395899_0029687 3300037312 Bacteria 4113
230 Ga0395899_0031471 3300037312 Bacteria 3987
231 Ga0395900_0004338 3300037418 Bacteria 15047
232 Ga0395900_0012537 3300037418 Bacteria 8672
233 Ga0395900_0018987 3300037418 Bacteria 7012
234 Ga0395900_0021088 3300037418 Bacteria 6659
235 Ga0395900_0082516 3300037418 Bacteria 3303
236 Ga0395900_0123944 3300037418 Bacteria 2650
237 Ga0395900_0181694 3300037418 Bacteria 2137
238 Ga0395900_0303787 3300037418 Bacteria 1581
239 Ga0395898_0017964 3300037466 Bacteria 7216
240 Ga0395898_0047178 3300037466 Bacteria 4228
241 Ga0395898_0125839 3300037466 Bacteria 2455
242 Ga0395905_0000967 3300037471 Bacteria 36867
243 Ga0395905_0004248 3300037471 Bacteria 14961
244 Ga0395905_0012219 3300037471 Bacteria 8270
245 Ga0395905_0019295 3300037471 Bacteria 6464
246 Ga0395905_0019322 3300037471 Bacteria 6460
247 Ga0395905_0092411 3300037471 Bacteria 2837
248 Ga0395905_0092673 3300037471 Bacteria 2833
249 Ga0395905_0112290 3300037471 Bacteria 2559
250 Ga0395905_0143436 3300037471 Bacteria 2247
251 Ga0395905_0160612 3300037471 Bacteria 2112
252 Ga0395905_0170521 3300037471 Bacteria 2044
253 Ga0395905_0225126 3300037471 Bacteria 1755
254 Ga0395901_0014221 3300038443 Bacteria 8103
255 Ga0395901_0035946 3300038443 Bacteria 5118
256 Ga0395901_0054591 3300038443 Bacteria 4153
257 Ga0395901_0075844 3300038443 Bacteria 3508
258 Ga0395901_0129869 3300038443 Bacteria 2647
259 Ga0395901_0135599 3300038443 Bacteria 2587
260 Ga0395901_0145707 3300038443 Bacteria 2489
261 Ga0395901_0227641 3300038443 Bacteria 1947
262 Ga0395901_0394830 3300038443 Bacteria 1422
263 Ga0395901_0424259 3300038443 Bacteria 1363
264 Ga0436361_0033754 3300039447 Bacteria 8967
265 Ga0436361_0201739 3300039447 Bacteria 8461
266 Ga0436361_0512068 3300039447 Bacteria 1593
267 Ga0436361_0939956 3300039447 Bacteria 3097
268 Ga0436361_1219833 3300039447 Bacteria 21424
269 Ga0439436_0041375 3300041404 Bacteria 1319
270 Ga0439461_0000005 3300041410 Bacteria 28399
271 Ga0439445_0000595 3300042004 Bacteria 7415
272 Ga0439448_0009999 3300042005 Bacteria 2803
273 Ga0439455_0017331 3300042012 Bacteria 1677
274 Ga0439458_0000419 3300042157 Bacteria 10686
275 Ga0439458_0005492 3300042157 Bacteria 2850
276 Ga0451576_0000017 3300045051 Bacteria 558261
277 Ga0466967_0314874 3300045976 Bacteria 1508
278 Ga0495627_000336 3300046453 Bacteria 44344
279 Ga0495603_0000026 3300046455 Bacteria 61348
280 Ga0495629_0001467 3300046459 Bacteria 18588
281 Ga0495638_0000068 3300046460 Bacteria 167596
282 Ga0495641_0006743 3300046461 Bacteria 7370
283 Ga0495580_0010350 3300046472 Bacteria 7270
284 Ga0495582_0000526 3300046473 Bacteria 21123
285 Ga0495639_0000233 3300046475 Bacteria 27728
286 Ga0495639_0065680 3300046475 Bacteria 1669
287 Ga0495584_0012679 3300046491 Bacteria 4301
288 Ga0495594_0000255 3300046499 Bacteria 25909
289 Ga0495583_0000269 3300046506 Bacteria 85380
290 Ga0495583_0016466 3300046506 Bacteria 3971
291 Ga0495608_0112815 3300046511 Bacteria 1747
292 Ga0495610_0000083 3300046512 Bacteria 112946
293 Ga0495616_0000010 3300046513 Bacteria 224378
294 Ga0495632_0000047 3300046519 Bacteria 138951
295 Ga0495632_0001120 3300046519 Bacteria 22955
296 Ga0495637_0000387 3300046520 Bacteria 32696
297 Ga0495643_0000031 3300046522 Bacteria 257820
298 Ga0495643_0050258 3300046522 Bacteria 2246
299 Ga0495648_0000046 3300046524 Bacteria 167725
300 Ga0495648_0000114 3300046524 Bacteria 98677
301 Ga0495648_0003922 3300046524 Bacteria 12881
302 Ga0495648_0021285 3300046524 Bacteria 4495
303 Ga0495663_0000017 3300046525 Bacteria 138955
304 Ga0495654_0033032 3300046530 Bacteria 2621
305 Ga0495609_0056731 3300046538 Bacteria 1735
306 Ga0495597_0013574 3300046542 Bacteria 3897
307 Ga0495622_0000481 3300046557 Bacteria 25103
308 Ga0495633_0000496 3300046558 Bacteria 39673
309 Ga0495633_0000929 3300046558 Bacteria 24783
310 Ga0495634_0002955 3300046642 Bacteria 13884
311 Ga0495625_0037418 3300046660 Bacteria 3561
312 Ga0495588_0001982 3300046674 Bacteria 8756
313 Ga0495647_0002262 3300046681 Bacteria 6040
314 Ga0495658_0006290 3300046683 Bacteria 5835
315 Ga0495669_0009610 3300046684 Bacteria 4081
316 Ga0495613_0000386 3300046689 Bacteria 38025
317 Ga0495671_0000021 3300046692 Bacteria 257820
318 Ga0495671_0000057 3300046692 Bacteria 114166
319 Ga0495581_0000121 3300047315 Bacteria 33464
320 Ga0495672_0021578 3300047320 Bacteria 4199
321 Ga0495676_0020217 3300047321 Bacteria 5847
322 Ga0495673_0000110 3300047469 Bacteria 166127
323 Ga0495673_0066762 3300047469 Bacteria 1524
324 Ga0495681_0000036 3300047470 Bacteria 124207
325 Ga0495681_0001006 3300047470 Bacteria 21606
326 Ga0495681_0099809 3300047470 Bacteria 1270
327 Ga0495686_0000281 3300047472 Bacteria 89475
328 Ga0495686_0009998 3300047472 Bacteria 6779
329 Ga0495686_0031802 3300047472 Bacteria 3418
330 Ga0495593_0000434 3300047673 Bacteria 23326
331 Ga0495614_0009176 3300048089 Bacteria 4382
332 Ga0496102_0000022 3300048905 Bacteria 246314
333 Ga0496102_0102348 3300048905 Bacteria 2662
334 Ga0496103_0000167 3300048906 Bacteria 68561
335 Ga0496103_0079021 3300048906 Bacteria 2066
336 Ga0496104_0001962 3300048907 Bacteria 17811
337 Ga0496104_0030371 3300048907 Bacteria 5021
338 Ga0496105_0000479 3300048908 Bacteria 26244
339 Ga0496105_0037628 3300048908 Bacteria 3985
340 Ga0496107_0064865 3300048910 Bacteria 2648
341 Ga0496108_0000270 3300048911 Bacteria 44669
342 Ga0496108_0066267 3300048911 Bacteria 3045
343 Ga0496110_0018059 3300048913 Bacteria 5908
344 Ga0496110_0051447 3300048913 Bacteria 3620
345 Ga0496110_0077507 3300048913 Bacteria 2957
346 Ga0496110_0328962 3300048913 Bacteria 1392
347 Ga0496113_0059257 3300048916 Bacteria 2884
348 Ga0496114_0002987 3300048917 Bacteria 12971
349 Ga0496115_0000029 3300048918 Bacteria 141359
350 Ga0496116_0008266 3300048919 Bacteria 9052
351 Ga0496116_0024547 3300048919 Bacteria 4455
352 Ga0496117_0000260 3300048920 Bacteria 99636
353 Ga0496117_0012209 3300048920 Bacteria 7598
354 Ga0496117_0063836 3300048920 Bacteria 2515
355 Ga0496117_0099965 3300048920 Bacteria 1838
356 Ga0496118_0000039 3300048921 Bacteria 305458
357 Ga0496118_0016400 3300048921 Bacteria 6799
358 Ga0496118_0041843 3300048921 Bacteria 3621
359 Ga0496119_0010119 3300048922 Bacteria 7964
360 Ga0496119_0026738 3300048922 Bacteria 3991
361 Ga0496120_0017516 3300048923 Bacteria 4642
362 Ga0496121_0000683 3300048924 Bacteria 63257
363 Ga0496121_0001144 3300048924 Bacteria 46508
364 Ga0496121_0003936 3300048924 Bacteria 20562
365 Ga0496122_0026031 3300048925 Bacteria 5061
366 Ga0496122_0037986 3300048925 Bacteria 3866
367 Ga0496122_0163263 3300048925 Bacteria 1355
368 Ga0496123_0034180 3300048926 Bacteria 3646
369 Ga0496123_0103020 3300048926 Bacteria 1655
370 Ga0496124_0000076 3300048927 Bacteria 215767
371 Ga0496124_0019841 3300048927 Bacteria 6237
372 Ga0496125_0000505 3300048928 Bacteria 67726
373 Ga0496125_0059705 3300048928 Bacteria 3070
374 Ga0496126_0000469 3300048929 Bacteria 80156
375 Ga0496126_0020335 3300048929 Bacteria 6514
376 Ga0496126_0033481 3300048929 Bacteria 4834
377 Ga0496126_0075554 3300048929 Bacteria 2990
378 Ga0495678_026408 3300049459 Bacteria 2480
379 Ga0501034_0164253 3300049571 Bacteria 2190
380 Ga0501211_002826 3300049658 Bacteria 1819
381 Ga0501223_000054 3300049663 Bacteria 38195
382 Ga0501224_015571 3300049664 Bacteria 1127
383 Ga0501235_003549 3300049669 Bacteria 3372
384 Ga0501246_000807 3300049676 Bacteria 2321
385 Ga0501225_0000004 3300049705 Bacteria 140738
386 Ga0501225_0049060 3300049705 Bacteria 1173
387 Ga0501234_001459 3300049707 Bacteria 3712
388 Ga0501282_009656 3300049778 Bacteria 1036
389 Ga0501044_0012999 3300049823 Bacteria 9012
390 nmdc:mga03683_757_c1 3300050489 Bacteria 9260
391 nmdc:mga03n38_30699_c1 3300050490 Bacteria 2261
392 nmdc:mga06z11_119_c1 3300050494 Bacteria 32670
393 nmdc:mga04h51_37_c1 3300050495 Bacteria 45941
394 nmdc:mga07m45_22875_c1 3300050496 Bacteria 3413
395 nmdc:mga0qj67_527803_c1 3300050509 Unclassified 948
396 nmdc:mga06r32_6191_c1 3300050510 Bacteria 10741
397 nmdc:mga0n895_44670_c1 3300050512 Bacteria 4320
398 nmdc:mga0n895_582937_c1 3300050512 Bacteria 1122
399 Ga0495619_0067280 3300053085 Bacteria 2391
400 Ga0500643_000134 3300053087 Bacteria 75321
401 Ga0500651_0023412 3300053093 Bacteria 3868
402 Ga0500641_0047782 3300053096 Bacteria 1751
403 Ga0500562_005025 3300053108 Bacteria 3327
404 Ga0500592_000167 3300053116 Bacteria 13144
405 Ga0500608_000042 3300053122 Bacteria 56626
406 Ga0500655_000111 3300053133 Bacteria 21178
407 Ga0500590_000373 3300053148 Bacteria 14845
408 Ga0500590_006730 3300053148 Bacteria 5618
409 Ga0500604_0000031 3300053151 Bacteria 57942
410 Ga0500624_000005 3300053157 Bacteria 187122
411 Ga0500627_0000078 3300053158 Bacteria 36296
412 Ga0500627_0031816 3300053158 Bacteria 2219
413 Ga0500627_0058707 3300053158 Bacteria 1689
414 Ga0500639_019031 3300053163 Bacteria 3622
415 Ga0500567_000588 3300053723 Bacteria 12916
416 Ga0500570_000123 3300053724 Bacteria 22515
417 Ga0500625_000157 3300053729 Bacteria 14392
418 Ga0500645_026954 3300053730 Bacteria 1745

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0314874 Ga0466967_0314874_266_1171 242
2 3300050509 nmdc:mga0qj67_527803_c1 nmdc:mga0qj67_527803_c1_170_934 252
3 3300041404 Ga0439436_0041375 Ga0439436_0041375_30_860 266
4 3300048905 Ga0496102_0000022 Ga0496102_0000022_138800_139708 268
5 3300048906 Ga0496103_0000167 Ga0496103_0000167_42983_43891 268
6 3300048907 Ga0496104_0001962 Ga0496104_0001962_2857_3765 268
7 3300048908 Ga0496105_0000479 Ga0496105_0000479_22554_23462 268
8 3300048910 Ga0496107_0064865 Ga0496107_0064865_927_1835 268
9 3300048913 Ga0496110_0051447 Ga0496110_0051447_420_1328 268
10 3300048917 Ga0496114_0002987 Ga0496114_0002987_2295_3203 268
11 3300048918 Ga0496115_0000029 Ga0496115_0000029_97132_98040 268
12 3300048919 Ga0496116_0008266 Ga0496116_0008266_5280_6188 268
13 3300048920 Ga0496117_0000260 Ga0496117_0000260_61518_62426 268
14 3300048921 Ga0496118_0000039 Ga0496118_0000039_229694_230602 268
15 3300048922 Ga0496119_0010119 Ga0496119_0010119_2703_3611 268
16 3300048923 Ga0496120_0017516 Ga0496120_0017516_699_1607 268
17 3300048924 Ga0496121_0000683 Ga0496121_0000683_37261_38169 268
18 3300048927 Ga0496124_0000076 Ga0496124_0000076_75766_76674 268
19 3300048929 Ga0496126_0000469 Ga0496126_0000469_43229_44137 268
20 3300049778 Ga0501282_009656 Ga0501282_009656_105_1013 269
21 3300046524 Ga0495648_0000114 Ga0495648_0000114_59842_60750 270
22 3300048925 Ga0496122_0037986 Ga0496122_0037986_116_1024 270
23 3300048926 Ga0496123_0034180 Ga0496123_0034180_166_1074 270
24 3300048928 Ga0496125_0000505 Ga0496125_0000505_57801_58709 270
25 3300046506 Ga0495583_0016466 Ga0495583_0016466_1712_2620 271
26 3300031548 Ga0307408_100062557 Ga0307408_1000625572 272
27 3300026116 Ga0207674_10011366 Ga0207674_100113668 273
28 3300038443 Ga0395901_0014221 Ga0395901_0014221_4842_5750 273
29 3300005327 Ga0070658_10039513 Ga0070658_100395132 274
30 3300025909 Ga0207705_10082407 Ga0207705_100824072 274
31 3300050510 nmdc:mga06r32_6191_c1 nmdc:mga06r32_6191_c1_190_1020 274
32 3300014325 Ga0163163_10048140 Ga0163163_100481405 275
33 3300049658 Ga0501211_002826 Ga0501211_002826_977_1804 275
34 3300037312 Ga0395899_0031471 Ga0395899_0031471_2684_3610 277
35 3300037466 Ga0395898_0125839 Ga0395898_0125839_81_1007 277
36 3300005331 Ga0070670_100004743 Ga0070670_1000047435 279
37 3300005347 Ga0070668_100000025 Ga0070668_10000002531 279
38 3300005355 Ga0070671_100001385 Ga0070671_1000013859 279
39 3300005367 Ga0070667_100000006 Ga0070667_100000006301 279
40 3300005842 Ga0068858_100000969 Ga0068858_10000096923 279
41 3300005843 Ga0068860_100000074 Ga0068860_100000074142 279
42 3300005844 Ga0068862_100000360 Ga0068862_10000036011 279
43 3300025903 Ga0207680_10015956 Ga0207680_100159563 279
44 3300025925 Ga0207650_10021560 Ga0207650_100215605 279
45 3300025931 Ga0207644_10000421 Ga0207644_1000042122 279
46 3300025972 Ga0207668_10000134 Ga0207668_1000013413 279
47 3300025986 Ga0207658_10000105 Ga0207658_1000010557 279
48 3300026035 Ga0207703_10006485 Ga0207703_100064859 279
49 3300026088 Ga0207641_10082808 Ga0207641_100828084 279
50 3300028380 Ga0268265_10001399 Ga0268265_1000139916 279
51 3300028381 Ga0268264_10000070 Ga0268264_10000070238 279
52 3300006847 Ga0075431_100035703 Ga0075431_1000357036 280
53 3300006871 Ga0075434_100063434 Ga0075434_1000634343 280
54 3300050512 nmdc:mga0n895_44670_c1 nmdc:mga0n895_44670_c1_202_1113 280
55 3300005841 Ga0068863_100007173 Ga0068863_1000071734 281
56 3300026088 Ga0207641_10128705 Ga0207641_101287053 281
57 3300005331 Ga0070670_100052532 Ga0070670_1000525322 282
58 3300005353 Ga0070669_100329049 Ga0070669_1003290492 282
59 3300005366 Ga0070659_100079655 Ga0070659_1000796552 282
60 3300005577 Ga0068857_100001897 Ga0068857_10000189715 282
61 3300005618 Ga0068864_100019929 Ga0068864_1000199292 282
62 3300014325 Ga0163163_10036223 Ga0163163_100362234 282
63 3300025923 Ga0207681_10126323 Ga0207681_101263232 282
64 3300026088 Ga0207641_10008513 Ga0207641_100085133 282
65 3300026095 Ga0207676_10018759 Ga0207676_100187594 282
66 3300026116 Ga0207674_10001036 Ga0207674_1000103638 282
67 3300005548 Ga0070665_100000078 Ga0070665_1000000784 287
68 3300028379 Ga0268266_10000131 Ga0268266_1000013158 287
69 3300035170 Ga0373943_0027566 Ga0373943_0027566_1627_2553 287
70 3300035692 Ga0373935_0013438 Ga0373935_0013438_2926_3852 287
71 3300035695 Ga0373927_0047944 Ga0373927_0047944_584_1510 287
72 3300035725 Ga0373947_0001499 Ga0373947_0001499_12579_13505 287
73 3300036401 Ga0373937_0106581 Ga0373937_0106581_1086_2012 287
74 3300037068 Ga0373925_0005204 Ga0373925_0005204_7807_8733 287
75 3300046455 Ga0495603_0000026 Ga0495603_0000026_33591_34517 287
76 3300046459 Ga0495629_0001467 Ga0495629_0001467_3125_4051 287
77 3300046461 Ga0495641_0006743 Ga0495641_0006743_6276_7202 287
78 3300046472 Ga0495580_0010350 Ga0495580_0010350_3220_4146 287
79 3300046473 Ga0495582_0000526 Ga0495582_0000526_788_1714 287
80 3300046475 Ga0495639_0000233 Ga0495639_0000233_17806_18732 287
81 3300046499 Ga0495594_0000255 Ga0495594_0000255_14830_15756 287
82 3300046511 Ga0495608_0112815 Ga0495608_0112815_224_1150 287
83 3300046557 Ga0495622_0000481 Ga0495622_0000481_13548_14474 287
84 3300046642 Ga0495634_0002955 Ga0495634_0002955_364_1290 287
85 3300046674 Ga0495588_0001982 Ga0495588_0001982_6851_7777 287
86 3300046681 Ga0495647_0002262 Ga0495647_0002262_588_1514 287
87 3300046683 Ga0495658_0006290 Ga0495658_0006290_1037_1963 287
88 3300046689 Ga0495613_0000386 Ga0495613_0000386_9245_10171 287
89 3300047315 Ga0495581_0000121 Ga0495581_0000121_23440_24366 287
90 3300047321 Ga0495676_0020217 Ga0495676_0020217_4371_5297 287
91 3300047673 Ga0495593_0000434 Ga0495593_0000434_17357_18283 287
92 3300048089 Ga0495614_0009176 Ga0495614_0009176_2854_3780 287
93 3300053085 Ga0495619_0067280 Ga0495619_0067280_1383_2309 287
94 3300049707 Ga0501234_001459 Ga0501234_001459_1579_2448 288
95 3300005459 Ga0068867_100142521 Ga0068867_1001425213 289
96 3300005985 Ga0081539_10003935 Ga0081539_1000393515 289
97 3300050490 nmdc:mga03n38_30699_c1 nmdc:mga03n38_30699_c1_775_1659 289
98 3300021361 Ga0213872_10006794 Ga0213872_100067942 291
99 3300021361 Ga0213872_10040170 Ga0213872_100401702 291
100 3300021361 Ga0213872_10042646 Ga0213872_100426462 291
101 3300035113 Ga0373936_0069810 Ga0373936_0069810_120_1028 291
102 3300039447 Ga0436361_0033754 Ga0436361_0033754_315_1196 291
103 3300039447 Ga0436361_0201739 Ga0436361_0201739_3911_4792 291
104 3300039447 Ga0436361_0512068 Ga0436361_0512068_539_1420 291
105 3300039447 Ga0436361_0939956 Ga0436361_0939956_780_1661 291
106 3300039447 Ga0436361_1219833 Ga0436361_1219833_13952_14830 291
107 3300041410 Ga0439461_0000005 Ga0439461_0000005_8120_9028 292
108 3300005841 Ga0068863_100079946 Ga0068863_1000799463 294
109 3300025925 Ga0207650_10116051 Ga0207650_101160514 294
110 3300026088 Ga0207641_10040734 Ga0207641_100407344 294
111 3300049571 Ga0501034_0164253 Ga0501034_0164253_762_1682 295
112 iso_pu_bacteria 2882806704 2882808796 296
113 iso_pu_bacteria 2512564014 2512644621 297
114 iso_pu_bacteria 2582581305 2585263149 297
115 iso_pu_bacteria 2775507255 2778125709 297
116 iso_pu_bacteria 2808606401 2809065127 297
117 iso_pu_bacteria 2808606404 2809081094 297
118 iso_pu_bacteria 2808606405 2809085459 297
119 iso_pu_bacteria 2880518877 2880520738 297
120 iso_pu_bacteria 2919709256 2919712535 297
121 3300003784 Ga0055534_1020815 Ga0055534_10208151 298
122 3300031727 Ga0316576_10116908 Ga0316576_101169082 298
123 3300005539 Ga0068853_100232830 Ga0068853_1002328302 299
124 3300005539 Ga0068853_100294024 Ga0068853_1002940242 299
125 3300025904 Ga0207647_10214948 Ga0207647_102149481 299
126 3300030731 Ga0316177_1038734 Ga0316177_10387342 299
127 3300037418 Ga0395900_0018987 Ga0395900_0018987_3558_4526 299
128 3300037466 Ga0395898_0017964 Ga0395898_0017964_1529_2497 299
129 3300038443 Ga0395901_0227641 Ga0395901_0227641_595_1563 299
130 iso_pu_bacteria 2738541275 2738710666 299
131 iso_pu_bacteria 2738541301 2738849091 299
132 iso_pu_bacteria 2738541304 2738864820 299
133 iso_pu_bacteria 2738543022 2739297338 299
134 iso_pu_bacteria 2738543033 2739359016 299
135 iso_pu_bacteria 2928100450 2928100767 299
136 iso_pu_bacteria 2928959182 2928960830 299
137 3300002459 JGI24751J29686_10000210 JGI24751J29686_1000021023 300
138 3300006237 Ga0097621_100039192 Ga0097621_1000391925 300
139 3300013102 Ga0157371_10085725 Ga0157371_100857252 300
140 3300031616 Ga0307508_10012591 Ga0307508_100125913 300
141 3300045051 Ga0451576_0000017 Ga0451576_0000017_340121_341029 300
142 3300049664 Ga0501224_015571 Ga0501224_015571_69_974 300
143 3300053151 Ga0500604_0000031 Ga0500604_0000031_32540_33448 300
144 3300001904 JGI24736J21556_1000464 JGI24736J21556_10004642 301
145 3300001904 JGI24736J21556_1001337 JGI24736J21556_10013374 301
146 3300001915 JGI24741J21665_1000069 JGI24741J21665_10000694 301
147 3300001976 JGI24752J21851_1000454 JGI24752J21851_10004544 301
148 3300001979 JGI24740J21852_10002676 JGI24740J21852_100026762 301
149 3300001979 JGI24740J21852_10020243 JGI24740J21852_100202432 301
150 3300001979 JGI24740J21852_10040483 JGI24740J21852_100404832 301
151 3300001989 JGI24739J22299_10000697 JGI24739J22299_1000069717 301
152 3300001989 JGI24739J22299_10002049 JGI24739J22299_100020496 301
153 3300001990 JGI24737J22298_10002270 JGI24737J22298_100022702 301
154 3300001990 JGI24737J22298_10003279 JGI24737J22298_100032792 301
155 3300001990 JGI24737J22298_10010614 JGI24737J22298_100106144 301
156 3300002067 JGI24735J21928_10000951 JGI24735J21928_100009518 301
157 3300002067 JGI24735J21928_10002415 JGI24735J21928_100024152 301
158 3300002070 JGI24750J21931_1000400 JGI24750J21931_10004006 301
159 3300002074 JGI24748J21848_1000030 JGI24748J21848_100003031 301
160 3300002075 JGI24738J21930_10000736 JGI24738J21930_1000073610 301
161 3300002239 JGI24034J26672_10000014 JGI24034J26672_100000148 301
162 3300002239 JGI24034J26672_10000046 JGI24034J26672_1000004648 301
163 3300005289 Ga0065704_10070376 Ga0065704_1007037611 301
164 3300005289 Ga0065704_10075413 Ga0065704_100754132 301
165 3300005327 Ga0070658_10007890 Ga0070658_100078905 301
166 3300005327 Ga0070658_10026116 Ga0070658_100261161 301
167 3300005330 Ga0070690_100000005 Ga0070690_10000000524 301
168 3300005331 Ga0070670_100019456 Ga0070670_1000194567 301
169 3300005331 Ga0070670_100053433 Ga0070670_1000534333 301
170 3300005335 Ga0070666_10000011 Ga0070666_10000011243 301
171 3300005335 Ga0070666_10155096 Ga0070666_101550962 301
172 3300005339 Ga0070660_100091405 Ga0070660_1000914052 301
173 3300005347 Ga0070668_100031943 Ga0070668_1000319431 301
174 3300005353 Ga0070669_100000123 Ga0070669_10000012320 301
175 3300005353 Ga0070669_100051879 Ga0070669_1000518794 301
176 3300005353 Ga0070669_100061661 Ga0070669_1000616613 301
177 3300005355 Ga0070671_100002401 Ga0070671_1000024015 301
178 3300005355 Ga0070671_100148934 Ga0070671_1001489342 301
179 3300005365 Ga0070688_100002976 Ga0070688_1000029768 301
180 3300005366 Ga0070659_100012883 Ga0070659_1000128833 301
181 3300005366 Ga0070659_100017500 Ga0070659_1000175003 301
182 3300005367 Ga0070667_100000660 Ga0070667_10000066027 301
183 3300005367 Ga0070667_100009763 Ga0070667_1000097638 301
184 3300005367 Ga0070667_100252145 Ga0070667_1002521452 301
185 3300005455 Ga0070663_100039233 Ga0070663_1000392334 301
186 3300005455 Ga0070663_100149583 Ga0070663_1001495832 301
187 3300005457 Ga0070662_100134343 Ga0070662_1001343432 301
188 3300005466 Ga0070685_10001167 Ga0070685_1000116710 301
189 3300005466 Ga0070685_10020959 Ga0070685_100209594 301
190 3300005539 Ga0068853_100103499 Ga0068853_1001034993 301
191 3300005544 Ga0070686_100000001 Ga0070686_100000001277 301
192 3300005544 Ga0070686_100000259 Ga0070686_1000002594 301
193 3300005548 Ga0070665_100000004 Ga0070665_1000000048 301
194 3300005548 Ga0070665_100002184 Ga0070665_10000218411 301
195 3300005548 Ga0070665_100130227 Ga0070665_1001302273 301
196 3300005548 Ga0070665_100202588 Ga0070665_1002025882 301
197 3300005564 Ga0070664_100031094 Ga0070664_1000310944 301
198 3300005564 Ga0070664_100252178 Ga0070664_1002521782 301
199 3300005577 Ga0068857_100053886 Ga0068857_1000538862 301
200 3300005614 Ga0068856_100009259 Ga0068856_10000925910 301
201 3300005618 Ga0068864_100001665 Ga0068864_10000166510 301
202 3300005618 Ga0068864_100008568 Ga0068864_1000085689 301
203 3300005719 Ga0068861_100009524 Ga0068861_1000095249 301
204 3300005841 Ga0068863_100000046 Ga0068863_100000046114 301
205 3300005841 Ga0068863_100000058 Ga0068863_10000005890 301
206 3300005841 Ga0068863_100010071 Ga0068863_1000100712 301
207 3300005842 Ga0068858_100024081 Ga0068858_1000240812 301
208 3300005843 Ga0068860_100000030 Ga0068860_10000003017 301
209 3300005843 Ga0068860_100000057 Ga0068860_100000057186 301
210 3300005844 Ga0068862_100001011 Ga0068862_10000101124 301
211 3300005844 Ga0068862_100138066 Ga0068862_1001380662 301
212 3300006042 Ga0075368_10000565 Ga0075368_1000056511 301
213 3300006178 Ga0075367_10007298 Ga0075367_100072986 301
214 3300006353 Ga0075370_10031257 Ga0075370_100312572 301
215 3300009011 Ga0105251_10007138 Ga0105251_100071382 301
216 3300009092 Ga0105250_10049618 Ga0105250_100496182 301
217 3300009147 Ga0114129_10551038 Ga0114129_105510381 301
218 3300009174 Ga0105241_10002141 Ga0105241_1000214113 301
219 3300009177 Ga0105248_10459944 Ga0105248_104599442 301
220 3300009545 Ga0105237_10072875 Ga0105237_100728754 301
221 3300009551 Ga0105238_10291451 Ga0105238_102914512 301
222 3300009553 Ga0105249_10000016 Ga0105249_1000001617 301
223 3300009978 Ga0105148_100361 Ga0105148_1003613 301
224 3300010375 Ga0105239_10538009 Ga0105239_105380092 301
225 3300013100 Ga0157373_10123191 Ga0157373_101231912 301
226 3300013102 Ga0157371_10073522 Ga0157371_100735222 301
227 3300013102 Ga0157371_10299381 Ga0157371_102993811 301
228 3300013104 Ga0157370_10107037 Ga0157370_101070372 301
229 3300013105 Ga0157369_10044451 Ga0157369_100444513 301
230 3300013306 Ga0163162_10098740 Ga0163162_100987404 301
231 3300013307 Ga0157372_10129606 Ga0157372_101296063 301
232 3300014326 Ga0157380_10000454 Ga0157380_1000045413 301
233 3300014968 Ga0157379_10003523 Ga0157379_100035239 301
234 3300017792 Ga0163161_10000037 Ga0163161_10000037138 301
235 3300017792 Ga0163161_10048288 Ga0163161_100482883 301
236 3300025229 Ga0209147_100882 Ga0209147_1008828 301
237 3300025903 Ga0207680_10000008 Ga0207680_10000008269 301
238 3300025903 Ga0207680_10248745 Ga0207680_102487451 301
239 3300025904 Ga0207647_10000301 Ga0207647_100003018 301
240 3300025909 Ga0207705_10068816 Ga0207705_100688162 301
241 3300025909 Ga0207705_10221174 Ga0207705_102211742 301
242 3300025911 Ga0207654_10006583 Ga0207654_100065834 301
243 3300025913 Ga0207695_10002890 Ga0207695_100028907 301
244 3300025913 Ga0207695_10018738 Ga0207695_1001873811 301
245 3300025914 Ga0207671_10000592 Ga0207671_1000059225 301
246 3300025914 Ga0207671_10152696 Ga0207671_101526961 301
247 3300025919 Ga0207657_10020085 Ga0207657_100200856 301
248 3300025919 Ga0207657_10039417 Ga0207657_100394174 301
249 3300025920 Ga0207649_10197479 Ga0207649_101974792 301
250 3300025923 Ga0207681_10000038 Ga0207681_1000003829 301
251 3300025923 Ga0207681_10063203 Ga0207681_100632033 301
252 3300025923 Ga0207681_10122480 Ga0207681_101224802 301
253 3300025923 Ga0207681_10190650 Ga0207681_101906502 301
254 3300025924 Ga0207694_10001595 Ga0207694_100015958 301
255 3300025924 Ga0207694_10071656 Ga0207694_100716562 301
256 3300025924 Ga0207694_10071728 Ga0207694_100717283 301
257 3300025925 Ga0207650_10017809 Ga0207650_100178096 301
258 3300025925 Ga0207650_10164214 Ga0207650_101642142 301
259 3300025927 Ga0207687_10434060 Ga0207687_104340601 301
260 3300025931 Ga0207644_10001279 Ga0207644_100012797 301
261 3300025931 Ga0207644_10034430 Ga0207644_100344303 301
262 3300025933 Ga0207706_10007461 Ga0207706_100074614 301
263 3300025933 Ga0207706_10008272 Ga0207706_100082723 301
264 3300025933 Ga0207706_10069642 Ga0207706_100696422 301
265 3300025945 Ga0207679_10235530 Ga0207679_102355302 301
266 3300025949 Ga0207667_10000716 Ga0207667_100007166 301
267 3300025949 Ga0207667_10191039 Ga0207667_101910392 301
268 3300025961 Ga0207712_10000009 Ga0207712_10000009269 301
269 3300025972 Ga0207668_10016808 Ga0207668_100168085 301
270 3300025981 Ga0207640_10089368 Ga0207640_100893682 301
271 3300025981 Ga0207640_10218915 Ga0207640_102189152 301
272 3300025986 Ga0207658_10005320 Ga0207658_100053202 301
273 3300025986 Ga0207658_10008033 Ga0207658_100080332 301
274 3300026035 Ga0207703_10000210 Ga0207703_1000021036 301
275 3300026035 Ga0207703_10003301 Ga0207703_100033014 301
276 3300026041 Ga0207639_10003214 Ga0207639_100032145 301
277 3300026041 Ga0207639_10255578 Ga0207639_102555782 301
278 3300026067 Ga0207678_10000079 Ga0207678_1000007945 301
279 3300026067 Ga0207678_10006391 Ga0207678_100063917 301
280 3300026078 Ga0207702_10000727 Ga0207702_1000072737 301
281 3300026078 Ga0207702_10041333 Ga0207702_100413332 301
282 3300026088 Ga0207641_10000145 Ga0207641_1000014575 301
283 3300026088 Ga0207641_10003855 Ga0207641_100038552 301
284 3300026095 Ga0207676_10001812 Ga0207676_100018125 301
285 3300026095 Ga0207676_10063365 Ga0207676_100633652 301
286 3300026116 Ga0207674_10044060 Ga0207674_100440603 301
287 3300026116 Ga0207674_10148655 Ga0207674_101486552 301
288 3300026118 Ga0207675_100001977 Ga0207675_10000197717 301
289 3300026142 Ga0207698_10059579 Ga0207698_100595791 301
290 3300027866 Ga0209813_10001114 Ga0209813_100011143 301
291 3300028379 Ga0268266_10000009 Ga0268266_10000009781 301
292 3300028379 Ga0268266_10002579 Ga0268266_1000257912 301
293 3300028379 Ga0268266_10019026 Ga0268266_100190262 301
294 3300028380 Ga0268265_10005805 Ga0268265_100058059 301
295 3300028380 Ga0268265_10139881 Ga0268265_101398812 301
296 3300028381 Ga0268264_10000003 Ga0268264_10000003891 301
297 3300028381 Ga0268264_10000078 Ga0268264_100000788 301
298 3300031548 Ga0307408_100014585 Ga0307408_1000145855 301
299 3300031548 Ga0307408_100025861 Ga0307408_1000258613 301
300 3300031731 Ga0307405_10008734 Ga0307405_100087345 301
301 3300031731 Ga0307405_10009874 Ga0307405_100098745 301
302 3300031901 Ga0307406_10011396 Ga0307406_100113964 301
303 3300031901 Ga0307406_10050193 Ga0307406_100501933 301
304 3300031911 Ga0307412_10070655 Ga0307412_100706552 301
305 3300032002 Ga0307416_100085937 Ga0307416_1000859371 301
306 3300032133 Ga0316583_10003009 Ga0316583_100030092 301
307 3300033180 Ga0307510_10091365 Ga0307510_100913652 301
308 3300035115 Ga0373941_0068317 Ga0373941_0068317_161_1141 301
309 3300036712 Ga0316584_0060786 Ga0316584_0060786_1859_2782 301
310 3300037312 Ga0395899_0029687 Ga0395899_0029687_2976_3905 301
311 3300037418 Ga0395900_0004338 Ga0395900_0004338_6115_7044 301
312 3300037418 Ga0395900_0012537 Ga0395900_0012537_4282_5211 301
313 3300037418 Ga0395900_0021088 Ga0395900_0021088_1944_2873 301
314 3300037418 Ga0395900_0082516 Ga0395900_0082516_951_1880 301
315 3300037418 Ga0395900_0123944 Ga0395900_0123944_860_1789 301
316 3300037418 Ga0395900_0181694 Ga0395900_0181694_508_1437 301
317 3300037418 Ga0395900_0303787 Ga0395900_0303787_267_1184 301
318 3300037466 Ga0395898_0047178 Ga0395898_0047178_3208_4137 301
319 3300037471 Ga0395905_0000967 Ga0395905_0000967_871_1800 301
320 3300037471 Ga0395905_0004248 Ga0395905_0004248_6049_6978 301
321 3300037471 Ga0395905_0012219 Ga0395905_0012219_1411_2334 301
322 3300037471 Ga0395905_0019295 Ga0395905_0019295_3813_4742 301
323 3300037471 Ga0395905_0019322 Ga0395905_0019322_956_1885 301
324 3300037471 Ga0395905_0092411 Ga0395905_0092411_989_1918 301
325 3300037471 Ga0395905_0092673 Ga0395905_0092673_1015_1944 301
326 3300037471 Ga0395905_0112290 Ga0395905_0112290_914_1843 301
327 3300037471 Ga0395905_0143436 Ga0395905_0143436_739_1668 301
328 3300037471 Ga0395905_0160612 Ga0395905_0160612_636_1565 301
329 3300037471 Ga0395905_0170521 Ga0395905_0170521_270_1178 301
330 3300037471 Ga0395905_0225126 Ga0395905_0225126_626_1534 301
331 3300038443 Ga0395901_0035946 Ga0395901_0035946_3163_4092 301
332 3300038443 Ga0395901_0054591 Ga0395901_0054591_729_1658 301
333 3300038443 Ga0395901_0075844 Ga0395901_0075844_1680_2609 301
334 3300038443 Ga0395901_0129869 Ga0395901_0129869_743_1672 301
335 3300038443 Ga0395901_0135599 Ga0395901_0135599_1185_2114 301
336 3300038443 Ga0395901_0145707 Ga0395901_0145707_908_1837 301
337 3300038443 Ga0395901_0394830 Ga0395901_0394830_327_1244 301
338 3300038443 Ga0395901_0424259 Ga0395901_0424259_355_1284 301
339 3300042004 Ga0439445_0000595 Ga0439445_0000595_2202_3128 301
340 3300042005 Ga0439448_0009999 Ga0439448_0009999_195_1124 301
341 3300042012 Ga0439455_0017331 Ga0439455_0017331_179_1108 301
342 3300042157 Ga0439458_0000419 Ga0439458_0000419_8912_9841 301
343 3300042157 Ga0439458_0005492 Ga0439458_0005492_933_1862 301
344 3300046453 Ga0495627_000336 Ga0495627_000336_8813_9718 301
345 3300046460 Ga0495638_0000068 Ga0495638_0000068_68051_68962 301
346 3300046475 Ga0495639_0065680 Ga0495639_0065680_124_1053 301
347 3300046491 Ga0495584_0012679 Ga0495584_0012679_379_1284 301
348 3300046506 Ga0495583_0000269 Ga0495583_0000269_14373_15284 301
349 3300046512 Ga0495610_0000083 Ga0495610_0000083_43182_44087 301
350 3300046513 Ga0495616_0000010 Ga0495616_0000010_118342_119247 301
351 3300046519 Ga0495632_0000047 Ga0495632_0000047_44950_45855 301
352 3300046519 Ga0495632_0001120 Ga0495632_0001120_14573_15484 301
353 3300046520 Ga0495637_0000387 Ga0495637_0000387_2716_3621 301
354 3300046522 Ga0495643_0000031 Ga0495643_0000031_131387_132292 301
355 3300046522 Ga0495643_0050258 Ga0495643_0050258_37_942 301
356 3300046524 Ga0495648_0000046 Ga0495648_0000046_68014_68925 301
357 3300046524 Ga0495648_0003922 Ga0495648_0003922_222_1127 301
358 3300046524 Ga0495648_0021285 Ga0495648_0021285_2204_3109 301
359 3300046525 Ga0495663_0000017 Ga0495663_0000017_44956_45861 301
360 3300046530 Ga0495654_0033032 Ga0495654_0033032_877_1785 301
361 3300046538 Ga0495609_0056731 Ga0495609_0056731_398_1303 301
362 3300046542 Ga0495597_0013574 Ga0495597_0013574_2623_3528 301
363 3300046558 Ga0495633_0000496 Ga0495633_0000496_27500_28405 301
364 3300046558 Ga0495633_0000929 Ga0495633_0000929_8420_9325 301
365 3300046660 Ga0495625_0037418 Ga0495625_0037418_2092_2997 301
366 3300046684 Ga0495669_0009610 Ga0495669_0009610_2046_2951 301
367 3300046692 Ga0495671_0000021 Ga0495671_0000021_125529_126434 301
368 3300046692 Ga0495671_0000057 Ga0495671_0000057_14580_15491 301
369 3300047320 Ga0495672_0021578 Ga0495672_0021578_2091_2996 301
370 3300047469 Ga0495673_0000110 Ga0495673_0000110_66598_67509 301
371 3300047469 Ga0495673_0066762 Ga0495673_0066762_471_1376 301
372 3300047470 Ga0495681_0000036 Ga0495681_0000036_111674_112579 301
373 3300047470 Ga0495681_0001006 Ga0495681_0001006_7814_8719 301
374 3300047470 Ga0495681_0099809 Ga0495681_0099809_38_943 301
375 3300047472 Ga0495686_0000281 Ga0495686_0000281_63776_64684 301
376 3300047472 Ga0495686_0009998 Ga0495686_0009998_1721_2629 301
377 3300047472 Ga0495686_0031802 Ga0495686_0031802_1043_1948 301
378 3300048905 Ga0496102_0102348 Ga0496102_0102348_1651_2556 301
379 3300048906 Ga0496103_0079021 Ga0496103_0079021_1055_1960 301
380 3300048907 Ga0496104_0030371 Ga0496104_0030371_229_1134 301
381 3300048908 Ga0496105_0037628 Ga0496105_0037628_1705_2613 301
382 3300048911 Ga0496108_0000270 Ga0496108_0000270_7596_8501 301
383 3300048911 Ga0496108_0066267 Ga0496108_0066267_533_1438 301
384 3300048913 Ga0496110_0018059 Ga0496110_0018059_195_1100 301
385 3300048913 Ga0496110_0077507 Ga0496110_0077507_1803_2708 301
386 3300048913 Ga0496110_0328962 Ga0496110_0328962_337_1242 301
387 3300048916 Ga0496113_0059257 Ga0496113_0059257_1875_2780 301
388 3300048919 Ga0496116_0024547 Ga0496116_0024547_1375_2280 301
389 3300048920 Ga0496117_0012209 Ga0496117_0012209_4958_5863 301
390 3300048920 Ga0496117_0063836 Ga0496117_0063836_1424_2329 301
391 3300048920 Ga0496117_0099965 Ga0496117_0099965_99_1004 301
392 3300048921 Ga0496118_0016400 Ga0496118_0016400_1371_2279 301
393 3300048921 Ga0496118_0041843 Ga0496118_0041843_524_1429 301
394 3300048922 Ga0496119_0026738 Ga0496119_0026738_2720_3625 301
395 3300048924 Ga0496121_0001144 Ga0496121_0001144_16783_17691 301
396 3300048924 Ga0496121_0003936 Ga0496121_0003936_19471_20376 301
397 3300048925 Ga0496122_0026031 Ga0496122_0026031_70_975 301
398 3300048925 Ga0496122_0163263 Ga0496122_0163263_171_1076 301
399 3300048926 Ga0496123_0103020 Ga0496123_0103020_271_1176 301
400 3300048927 Ga0496124_0019841 Ga0496124_0019841_934_1839 301
401 3300048928 Ga0496125_0059705 Ga0496125_0059705_1372_2277 301
402 3300048929 Ga0496126_0020335 Ga0496126_0020335_3690_4595 301
403 3300048929 Ga0496126_0033481 Ga0496126_0033481_2506_3411 301
404 3300048929 Ga0496126_0075554 Ga0496126_0075554_1446_2363 301
405 3300049459 Ga0495678_026408 Ga0495678_026408_797_1702 301
406 3300049663 Ga0501223_000054 Ga0501223_000054_19707_20612 301
407 3300049669 Ga0501235_003549 Ga0501235_003549_1604_2509 301
408 3300049676 Ga0501246_000807 Ga0501246_000807_1119_2024 301
409 3300049705 Ga0501225_0000004 Ga0501225_0000004_90165_91070 301
410 3300049705 Ga0501225_0049060 Ga0501225_0049060_242_1147 301
411 3300049823 Ga0501044_0012999 Ga0501044_0012999_88_1053 301
412 3300050489 nmdc:mga03683_757_c1 nmdc:mga03683_757_c1_4225_5151 301
413 3300050494 nmdc:mga06z11_119_c1 nmdc:mga06z11_119_c1_1727_2632 301
414 3300050495 nmdc:mga04h51_37_c1 nmdc:mga04h51_37_c1_43310_44215 301
415 3300050496 nmdc:mga07m45_22875_c1 nmdc:mga07m45_22875_c1_381_1286 301
416 3300050512 nmdc:mga0n895_582937_c1 nmdc:mga0n895_582937_c1_76_1002 301
417 3300053087 Ga0500643_000134 Ga0500643_000134_20132_21040 301
418 3300053093 Ga0500651_0023412 Ga0500651_0023412_498_1403 301
419 3300053096 Ga0500641_0047782 Ga0500641_0047782_185_1090 301
420 3300053108 Ga0500562_005025 Ga0500562_005025_1538_2443 301
421 3300053116 Ga0500592_000167 Ga0500592_000167_9461_10369 301
422 3300053122 Ga0500608_000042 Ga0500608_000042_11220_12149 301
423 3300053133 Ga0500655_000111 Ga0500655_000111_16888_17793 301
424 3300053148 Ga0500590_000373 Ga0500590_000373_6295_7200 301
425 3300053148 Ga0500590_006730 Ga0500590_006730_1022_1936 301
426 3300053157 Ga0500624_000005 Ga0500624_000005_31454_32362 301
427 3300053158 Ga0500627_0000078 Ga0500627_0000078_4406_5314 301
428 3300053158 Ga0500627_0031816 Ga0500627_0031816_1025_1933 301
429 3300053158 Ga0500627_0058707 Ga0500627_0058707_65_970 301
430 3300053163 Ga0500639_019031 Ga0500639_019031_1896_2801 301
431 3300053723 Ga0500567_000588 Ga0500567_000588_10360_11289 301
432 3300053724 Ga0500570_000123 Ga0500570_000123_7578_8483 301
433 3300053729 Ga0500625_000157 Ga0500625_000157_10395_11324 301
434 3300053730 Ga0500645_026954 Ga0500645_026954_619_1524 301

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02153

PDH_N

Prephenate dehydrogenase, nucleotide-binding domain

26

178

0.96

PF20463

PDH_C

Prephenate dehydrogenase, dimerization domain

180

282

0.94

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

13

106

0.89

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

13

141

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wji-assembly1.cif.gz_A-2 crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with nadp and tyrosine 0.9568 1 292
8gqr-assembly1.cif.gz_A crystal structure of viod with fad 0.9533 5 39
4wji-assembly1.cif.gz_A-2 crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with nadp and tyrosine 0.9505 1 292
6qgm-assembly2.cif.gz_e virx1 apo structure 0.9242 4 39
3kd9-assembly2.cif.gz_C-2 crystal structure of pyridine nucleotide disulfide oxidoreductase from pyrococcus horikoshii 0.9225 5 39
ID Description Score Start End Superfamily
af_P40012_11_539_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9549 5 39 3.50.50.60
af_Q0E3X3_17_318_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9497 4 39 3.50.50.100
af_A0A0R4IEI2_4_483_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9497 6 39 3.50.50.60
af_Q2FV16_5_493_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9478 5 36 3.50.50.60
af_Q10062_1_488_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9466 6 39 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A520HM71-F1-model_v4 Prephenate dehydrogenase/arogenate dehydrogenase family protein 0.9971 1 138 GO:0004665
GO:0006571
GO:0008977
GO:0070403
AF-A0A350KVM2-F1-model_v4 deleted 0.9946 4 110
AF-A0A1F2ZZQ4-F1-model_v4 Prephenate/arogenate dehydrogenase domain-containing protein 0.9736 4 291 GO:0004665
GO:0006571
GO:0008977
GO:0070403
AF-A0A353IQS3-F1-model_v4 Prephenate/arogenate dehydrogenase family protein 0.9728 2 279 GO:0004665
GO:0006571
GO:0008977
GO:0070403
AF-A0A4Q1U7U3-F1-model_v4 deleted 0.9724 2 292

Feature Viewer

pLDDT pTM Quality
89.86 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map