F443097

General Info

Members Datasets Scaffolds Average Seq Length
434 234 868 138

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_12747844|Ga0157372_127478441
Length 157
Sequence VKAIVIGCGRVGSSVALQLNISGWDVVALDENEDALSRLGEHWTGGFLVGHGMDLQLLREAGIEDADAVVVTTDGDNSNIVIGQVAQKRFEVPTVVIRVLDPGRAQFYATRGMRVVCPTSSARPSAARARRRSRRGPDRGCARRRTGCRSASARPGR

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
95 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
96 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
97 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
98 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
99 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
102 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
103 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
104 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
105 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
108 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
109 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
123 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
124 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
138 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
141 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
142 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
151 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 1.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 0
Rhizoplane 10.6
Rhizosphere 87.1
Stem 0
Stem Tuber 0
Unclassified 5.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_12747844 3300013307 Bacteria 565
2 Ga0070658_10088665 3300005327 Bacteria 2547
3 Ga0070683_100075756 3300005329 Bacteria 3144
4 Ga0070683_100125349 3300005329 Bacteria 2428
5 Ga0070680_100216179 3300005336 Bacteria 1617
6 Ga0070682_100470923 3300005337 Bacteria 967
7 Ga0068868_100327348 3300005338 Bacteria 1307
8 Ga0068868_101006587 3300005338 Unclassified 763
9 Ga0070660_100005287 3300005339 Bacteria 8930
10 Ga0070660_100132920 3300005339 Bacteria 1992
11 Ga0070660_100195377 3300005339 Bacteria 1640
12 Ga0070661_100009512 3300005344 Bacteria 6733
13 Ga0070661_100818758 3300005344 Bacteria 765
14 Ga0070671_100007854 3300005355 Bacteria 8529
15 Ga0070674_101498838 3300005356 Unclassified 606
16 Ga0070673_100481467 3300005364 Unclassified 1120
17 Ga0070659_100021929 3300005366 Bacteria 4872
18 Ga0070659_100046619 3300005366 Bacteria 3398
19 Ga0070659_100963363 3300005366 Bacteria 748
20 Ga0070667_100005662 3300005367 Bacteria 10434
21 Ga0070701_10605983 3300005438 Bacteria 726
22 Ga0070711_100150751 3300005439 Bacteria 1753
23 Ga0070681_10006682 3300005458 Bacteria 11223
24 Ga0070681_10106769 3300005458 Bacteria 2741
25 Ga0070681_10441940 3300005458 Bacteria 1213
26 Ga0070681_12048707 3300005458 Bacteria 501
27 Ga0070707_101611938 3300005468 Bacteria 616
28 Ga0070679_101781750 3300005530 Bacteria 564
29 Ga0070696_100404184 3300005546 Bacteria 1069
30 Ga0070696_101110697 3300005546 Bacteria 665
31 Ga0070693_101058347 3300005547 Bacteria 617
32 Ga0070704_100956499 3300005549 Bacteria 773
33 Ga0068855_100184770 3300005563 Bacteria 2355
34 Ga0068855_100978929 3300005563 Bacteria 890
35 Ga0070664_100456268 3300005564 Bacteria 1174
36 Ga0068857_100008907 3300005577 Bacteria 8693
37 Ga0081455_10014997 3300005937 Bacteria 7548
38 Ga0081538_10008222 3300005981 Bacteria 8895
39 Ga0070717_10670027 3300006028 Bacteria 942
40 Ga0075365_10101301 3300006038 Bacteria 1972
41 Ga0075363_100120461 3300006048 Bacteria 1465
42 Ga0075364_10085282 3300006051 Bacteria 2091
43 Ga0075432_10272003 3300006058 Bacteria 694
44 Ga0070712_100398595 3300006175 Bacteria 1136
45 Ga0075362_10192197 3300006177 Bacteria 992
46 Ga0075427_10007333 3300006194 Bacteria 1620
47 Ga0097621_101077466 3300006237 Unclassified 754
48 Ga0068871_100692867 3300006358 Bacteria 933
49 Ga0075428_100217168 3300006844 Bacteria 2065
50 Ga0075430_100078609 3300006846 Bacteria 2765
51 Ga0075431_101982323 3300006847 Bacteria 537
52 Ga0068865_100069359 3300006881 Bacteria 2494
53 Ga0111539_10248023 3300009094 Bacteria 2073
54 Ga0105245_10754678 3300009098 Bacteria 1009
55 Ga0105245_10895151 3300009098 Unclassified 929
56 Ga0105245_11160296 3300009098 Bacteria 820
57 Ga0105245_12435270 3300009098 Bacteria 577
58 Ga0114129_11303103 3300009147 Archaea 900
59 Ga0105243_10030950 3300009148 Bacteria 4124
60 Ga0105241_10502386 3300009174 Bacteria 1081
61 Ga0105238_10294448 3300009551 Bacteria 1606
62 Ga0105239_10036735 3300010375 Bacteria 5375
63 Ga0105239_10699391 3300010375 Bacteria 1159
64 Ga0105239_11004639 3300010375 Bacteria 959
65 Ga0157321_1014676 3300012487 Bacteria 653
66 Ga0157373_10564471 3300013100 Bacteria 826
67 Ga0157371_11185887 3300013102 Bacteria 588
68 Ga0157370_10050047 3300013104 Bacteria 3996
69 Ga0157370_11069545 3300013104 Bacteria 729
70 Ga0157370_11297172 3300013104 Bacteria 656
71 Ga0157369_10036942 3300013105 Bacteria 5350
72 Ga0157369_10041996 3300013105 Bacteria 4990
73 Ga0157369_10141497 3300013105 Bacteria 2546
74 Ga0157372_12390772 3300013307 Bacteria 607
75 Ga0157375_10108756 3300013308 Bacteria 2868
76 Ga0182008_10288155 3300014497 Unclassified 856
77 Ga0182008_10315772 3300014497 Bacteria 821
78 Ga0157376_11108352 3300014969 Unclassified 817
79 Ga0197907_11258090 3300020069 Bacteria 1485
80 Ga0206356_10060138 3300020070 Bacteria 713
81 Ga0206356_11215031 3300020070 Bacteria 1260
82 Ga0206354_10650624 3300020081 Bacteria 3159
83 Ga0206353_10936454 3300020082 Bacteria 2175
84 Ga0206353_11523693 3300020082 Bacteria 690
85 Ga0213875_10285872 3300021388 Bacteria 779
86 Ga0224712_10281310 3300022467 Bacteria 774
87 Ga0207705_10009261 3300025909 Bacteria 7164
88 Ga0207705_10316143 3300025909 Bacteria 1199
89 Ga0207654_10409559 3300025911 Bacteria 944
90 Ga0207707_10044262 3300025912 Bacteria 3881
91 Ga0207707_10755839 3300025912 Bacteria 813
92 Ga0207707_10978654 3300025912 Bacteria 695
93 Ga0207671_10169881 3300025914 Bacteria 1693
94 Ga0207693_10300015 3300025915 Bacteria 1259
95 Ga0207693_10354720 3300025915 Bacteria 1147
96 Ga0207693_10731801 3300025915 Bacteria 765
97 Ga0207693_10825852 3300025915 Bacteria 714
98 Ga0207663_10144361 3300025916 Bacteria 1662
99 Ga0207663_10337018 3300025916 Bacteria 1138
100 Ga0207663_10387840 3300025916 Unclassified 1065
101 Ga0207660_10042632 3300025917 Bacteria 3186
102 Ga0207660_10174836 3300025917 Bacteria 1664
103 Ga0207657_10010091 3300025919 Bacteria 9442
104 Ga0207657_10022488 3300025919 Bacteria 5896
105 Ga0207649_10137014 3300025920 Bacteria 1670
106 Ga0207652_10351186 3300025921 Bacteria 1331
107 Ga0207652_10462422 3300025921 Bacteria 1143
108 Ga0207646_11251291 3300025922 Bacteria 649
109 Ga0207694_10336303 3300025924 Bacteria 1248
110 Ga0207687_10705375 3300025927 Bacteria 857
111 Ga0207644_10179469 3300025931 Bacteria 1658
112 Ga0207690_10110797 3300025932 Bacteria 1977
113 Ga0207690_10148003 3300025932 Bacteria 1738
114 Ga0207686_10547235 3300025934 Bacteria 904
115 Ga0207709_10254215 3300025935 Bacteria 1285
116 Ga0207665_10133159 3300025939 Unclassified 1767
117 Ga0207711_10292051 3300025941 Bacteria 1503
118 Ga0207661_10044471 3300025944 Bacteria 3510
119 Ga0207661_10169797 3300025944 Bacteria 1898
120 Ga0207667_10133746 3300025949 Bacteria 2554
121 Ga0207667_10472546 3300025949 Bacteria 1273
122 Ga0207651_10420957 3300025960 Unclassified 1140
123 Ga0207658_10004204 3300025986 Bacteria 10031
124 Ga0207677_10214755 3300026023 Bacteria 1539
125 Ga0207677_10909478 3300026023 Bacteria 794
126 Ga0207639_10378594 3300026041 Bacteria 1270
127 Ga0207708_10184992 3300026075 Bacteria 1655
128 Ga0207702_10539791 3300026078 Bacteria 1140
129 Ga0207702_11481865 3300026078 Bacteria 672
130 Ga0207674_10047081 3300026116 Bacteria 4423
131 Ga0207683_10087207 3300026121 Bacteria 2775
132 Ga0207698_11074287 3300026142 Unclassified 817
133 Ga0207428_10078522 3300027907 Bacteria 2583
134 Ga0207428_10091549 3300027907 Bacteria 2361
135 Ga0268266_10434240 3300028379 Bacteria 1246
136 Ga0265319_1001704 3300028563 Bacteria 12683
137 Ga0265319_1028132 3300028563 Bacteria 1985
138 Ga0265334_10018292 3300028573 Bacteria 2890
139 Ga0265334_10041410 3300028573 Bacteria 1801
140 Ga0265334_10056071 3300028573 Bacteria 1497
141 Ga0265318_10000570 3300028577 Bacteria 26016
142 Ga0265318_10007345 3300028577 Bacteria 4989
143 Ga0265318_10041570 3300028577 Bacteria 1747
144 Ga0265318_10062346 3300028577 Bacteria 1388
145 Ga0265323_10062986 3300028653 Unclassified 1285
146 Ga0265323_10078285 3300028653 Bacteria 1120
147 Ga0265322_10002655 3300028654 Bacteria 5488
148 Ga0265322_10025894 3300028654 Bacteria 1676
149 Ga0265336_10179316 3300028666 Bacteria 630
150 Ga0265338_10005891 3300028800 Bacteria 15808
151 Ga0265338_10044381 3300028800 Bacteria 4106
152 Ga0265338_10096260 3300028800 Bacteria 2429
153 Ga0265338_10444693 3300028800 Bacteria 918
154 Ga0265338_10516160 3300028800 Bacteria 840
155 Ga0265338_10729967 3300028800 Bacteria 682
156 Ga0265338_10849378 3300028800 Bacteria 624
157 Ga0265324_10062585 3300029957 Bacteria 1271
158 Ga0265330_10045749 3300031235 Bacteria 1930
159 Ga0265330_10051928 3300031235 Bacteria 1796
160 Ga0265332_10038621 3300031238 Bacteria 2068
161 Ga0265328_10042850 3300031239 Bacteria 1665
162 Ga0265328_10288532 3300031239 Bacteria 632
163 Ga0265320_10008525 3300031240 Bacteria 6268
164 Ga0265320_10129117 3300031240 Bacteria 1149
165 Ga0265320_10150142 3300031240 Unclassified 1052
166 Ga0265325_10007179 3300031241 Bacteria 6701
167 Ga0265325_10027563 3300031241 Bacteria 3069
168 Ga0265329_10015322 3300031242 Bacteria 2680
169 Ga0265329_10025165 3300031242 Bacteria 1971
170 Ga0265340_10045399 3300031247 Bacteria 2147
171 Ga0265340_10078554 3300031247 Bacteria 1556
172 Ga0265340_10133249 3300031247 Unclassified 1138
173 Ga0265339_10023109 3300031249 Bacteria 3597
174 Ga0265339_10122310 3300031249 Unclassified 1336
175 Ga0265331_10060063 3300031250 Bacteria 1796
176 Ga0265327_10002344 3300031251 Bacteria 20191
177 Ga0265327_10029694 3300031251 Bacteria 3105
178 Ga0265327_10124818 3300031251 Bacteria 1216
179 Ga0265316_10004722 3300031344 Bacteria 13494
180 Ga0265316_10142881 3300031344 Bacteria 1796
181 Ga0265316_10145632 3300031344 Bacteria 1777
182 Ga0265313_10001477 3300031595 Bacteria 21902
183 Ga0265313_10012852 3300031595 Bacteria 5079
184 Ga0265314_10007233 3300031711 Bacteria 9650
185 Ga0265314_10044755 3300031711 Bacteria 3134
186 Ga0265342_10069136 3300031712 Bacteria 2062
187 Ga0265342_10182803 3300031712 Unclassified 1147
188 Ga0307407_11609309 3300031903 Unclassified 516
189 Ga0307416_100082492 3300032002 Bacteria 2724
190 Ga0307415_101240844 3300032126 Bacteria 704
191 Ga0373936_0043288 3300035113 Bacteria 1809
192 Ga0373953_0344278 3300035117 Bacteria 653
193 Ga0373954_0047371 3300035118 Bacteria 2012
194 Ga0373956_0427446 3300035119 Bacteria 632
195 Ga0373957_0059127 3300035120 Bacteria 1482
196 Ga0373957_0267875 3300035120 Bacteria 721
197 Ga0373946_0326988 3300035171 Bacteria 763
198 Ga0373955_0190027 3300035172 Bacteria 1221
199 Ga0373933_0009086 3300035724 Bacteria 5425
200 Ga0373933_0265912 3300035724 Bacteria 1106
201 Ga0373947_0003894 3300035725 Bacteria 8777
202 Ga0373937_0056905 3300036401 Bacteria 3591
203 Ga0395899_0098651 3300037312 Bacteria 2111
204 Ga0395899_0313736 3300037312 Bacteria 1058
205 Ga0395900_0073961 3300037418 Bacteria 3504
206 Ga0395898_0624993 3300037466 Bacteria 1020
207 Ga0395898_1607861 3300037466 Bacteria 574
208 Ga0395898_1967728 3300037466 Unclassified 504
209 Ga0395905_1250144 3300037471 Bacteria 646
210 Ga0395905_1420970 3300037471 Bacteria 598
211 Ga0436364_1205416 3300037853 Bacteria 975
212 Ga0395901_0017105 3300038443 Bacteria 7393
213 Ga0395901_0068668 3300038443 Bacteria 3692
214 Ga0395901_0090719 3300038443 Bacteria 3199
215 Ga0395901_0428809 3300038443 Bacteria 1355
216 Ga0395901_0627612 3300038443 Unclassified 1081
217 Ga0395901_1194209 3300038443 Unclassified 727
218 Ga0436365_1667535 3300039437 Bacteria 1323
219 Ga0436360_1161098 3300039438 Bacteria 7397
220 Ga0436362_0937017 3300039453 Bacteria 6117
221 Ga0451835_0420725 3300041492 Bacteria 731
222 Ga0451853_1474618 3300041512 Bacteria 636
223 Ga0450915_002291 3300042119 Bacteria 989
224 Ga0450888_013853 3300042126 Bacteria 971
225 Ga0439459_0085850 3300042438 Unclassified 750
226 Ga0451577_0722641 3300042876 Bacteria 901
227 Ga0466969_0039548 3300044656 Bacteria 2368
228 Ga0466966_0035822 3300044684 Bacteria 3205
229 Ga0466966_0138363 3300044684 Bacteria 1489
230 Ga0466961_0016824 3300044693 Bacteria 4701
231 Ga0466961_0115995 3300044693 Bacteria 1683
232 Ga0466961_0241069 3300044693 Bacteria 1111
233 Ga0466963_0015146 3300044694 Bacteria 4769
234 Ga0466963_0112303 3300044694 Bacteria 1871
235 Ga0466963_0154139 3300044694 Bacteria 1596
236 Ga0466963_0253830 3300044694 Bacteria 1234
237 Ga0466963_0626475 3300044694 Bacteria 759
238 Ga0466964_0003743 3300044706 Bacteria 5568
239 Ga0466964_0003879 3300044706 Bacteria 5492
240 Ga0466964_0008392 3300044706 Bacteria 3881
241 Ga0466964_0099184 3300044706 Bacteria 1281
242 Ga0466964_0693499 3300044706 Bacteria 567
243 Ga0466964_0802114 3300044706 Bacteria 532
244 Ga0453684_0555860 3300044712 Bacteria 1264
245 Ga0466971_0016077 3300044719 Bacteria 3297
246 Ga0466971_0021571 3300044719 Bacteria 2866
247 Ga0466968_0016753 3300044735 Bacteria 2921
248 Ga0466968_0063195 3300044735 Bacteria 1600
249 Ga0466968_0284597 3300044735 Bacteria 792
250 Ga0466970_0120579 3300044765 Bacteria 1436
251 Ga0466957_0021880 3300044842 Bacteria 3770
252 Ga0466957_0095622 3300044842 Bacteria 1866
253 Ga0466957_0538073 3300044842 Bacteria 813
254 Ga0466960_0295158 3300044901 Bacteria 912
255 Ga0466959_0043074 3300045049 Bacteria 3329
256 Ga0466959_0062373 3300045049 Bacteria 2709
257 Ga0466959_0095177 3300045049 Bacteria 2136
258 Ga0451576_0623135 3300045051 Bacteria 1134
259 Ga0466958_0008704 3300045836 Bacteria 5634
260 Ga0466958_0012367 3300045836 Bacteria 4834
261 Ga0466958_0021599 3300045836 Bacteria 3764
262 Ga0466958_0061663 3300045836 Bacteria 2285
263 Ga0466958_0152896 3300045836 Bacteria 1456
264 Ga0466967_0000894 3300045976 Bacteria 15939
265 Ga0466967_0079957 3300045976 Bacteria 2948
266 Ga0466967_0114276 3300045976 Bacteria 2485
267 Ga0466967_0121398 3300045976 Bacteria 2415
268 Ga0466967_0127070 3300045976 Bacteria 2362
269 Ga0466967_0149805 3300045976 Bacteria 2179
270 Ga0466967_0155032 3300045976 Bacteria 2144
271 Ga0466967_0645043 3300045976 Bacteria 1047
272 Ga0466967_0937579 3300045976 Bacteria 861
273 Ga0466967_1178599 3300045976 Bacteria 763
274 Ga0466967_1328552 3300045976 Bacteria 716
275 Ga0495592_0042949 3300046454 Bacteria 3385
276 Ga0495592_0212564 3300046454 Bacteria 1298
277 Ga0495629_0185467 3300046459 Bacteria 1441
278 Ga0495629_0664621 3300046459 Bacteria 693
279 Ga0495641_0037484 3300046461 Bacteria 2271
280 Ga0495641_0181468 3300046461 Bacteria 942
281 Ga0495651_0009103 3300046462 Bacteria 7621
282 Ga0495651_0052242 3300046462 Bacteria 3148
283 Ga0495651_0114801 3300046462 Bacteria 1986
284 Ga0495653_0069467 3300046463 Bacteria 2639
285 Ga0495582_0051585 3300046473 Bacteria 2268
286 Ga0495582_0137379 3300046473 Bacteria 1384
287 Ga0495664_0050975 3300046477 Bacteria 2458
288 Ga0495618_0016842 3300046514 Bacteria 4477
289 Ga0495618_0446228 3300046514 Bacteria 786
290 Ga0495628_0026247 3300046516 Bacteria 4754
291 Ga0495628_0101252 3300046516 Bacteria 2223
292 Ga0495630_0022699 3300046517 Bacteria 4635
293 Ga0495630_0474588 3300046517 Bacteria 959
294 Ga0495630_0535798 3300046517 Bacteria 898
295 Ga0495666_0129479 3300046526 Bacteria 1180
296 Ga0495652_0034928 3300046529 Bacteria 4379
297 Ga0495652_0455155 3300046529 Bacteria 895
298 Ga0495640_0046462 3300046533 Bacteria 3008
299 Ga0495640_0103230 3300046533 Bacteria 1870
300 Ga0495640_0208231 3300046533 Bacteria 1237
301 Ga0495586_0561094 3300046535 Bacteria 659
302 Ga0495587_0131483 3300046536 Bacteria 1430
303 Ga0495645_0026928 3300046543 Bacteria 4176
304 Ga0495645_0829746 3300046543 Bacteria 553
305 Ga0495667_0044662 3300046559 Bacteria 2934
306 Ga0495667_0072330 3300046559 Bacteria 2247
307 Ga0495667_0205845 3300046559 Bacteria 1258
308 Ga0495634_0057982 3300046642 Bacteria 2583
309 Ga0495634_0093506 3300046642 Bacteria 1950
310 Ga0495635_0057745 3300046663 Bacteria 2670
311 Ga0495635_0522823 3300046663 Bacteria 780
312 Ga0495657_0051288 3300046675 Bacteria 2770
313 Ga0495657_0118848 3300046675 Bacteria 1667
314 Ga0495599_0201237 3300046678 Bacteria 1223
315 Ga0495623_0129262 3300046679 Bacteria 1514
316 Ga0495623_0145556 3300046679 Bacteria 1405
317 Ga0495623_0319108 3300046679 Bacteria 854
318 Ga0495646_0191671 3300046680 Bacteria 1117
319 Ga0495646_0220929 3300046680 Bacteria 1025
320 Ga0495658_0039124 3300046683 Bacteria 2630
321 Ga0495658_0136811 3300046683 Bacteria 1495
322 Ga0495613_0155379 3300046689 Bacteria 1630
323 Ga0495613_0383131 3300046689 Bacteria 961
324 Ga0495624_0191480 3300046690 Bacteria 1244
325 Ga0495624_0203094 3300046690 Bacteria 1204
326 Ga0495581_0656729 3300047315 Bacteria 606
327 Ga0495604_0110476 3300047317 Bacteria 2005
328 Ga0495604_0304062 3300047317 Bacteria 1070
329 Ga0495604_0342020 3300047317 Bacteria 996
330 Ga0495604_0951362 3300047317 Bacteria 534
331 Ga0495674_0060970 3300047319 Bacteria 3289
332 Ga0495674_0446132 3300047319 Bacteria 1040
333 Ga0495674_0792460 3300047319 Bacteria 738
334 Ga0495676_0056824 3300047321 Bacteria 3092
335 Ga0495680_0008192 3300047322 Bacteria 9529
336 Ga0495680_0020626 3300047322 Bacteria 5538
337 Ga0495680_0049286 3300047322 Bacteria 3299
338 Ga0495680_0073994 3300047322 Bacteria 2588
339 Ga0495680_0720300 3300047322 Unclassified 657
340 Ga0495675_0153673 3300047444 Bacteria 1420
341 Ga0495684_0014709 3300047471 Bacteria 6024
342 Ga0495593_0156905 3300047673 Bacteria 1150
343 Ga0495602_0098760 3300048088 Bacteria 2402
344 Ga0495602_0499575 3300048088 Bacteria 850
345 Ga0495602_0537444 3300048088 Bacteria 812
346 Ga0496100_0009726 3300048903 Bacteria 5411
347 Ga0496100_1188716 3300048903 Unclassified 601
348 Ga0496101_0011797 3300048904 Bacteria 5812
349 Ga0496101_0082754 3300048904 Bacteria 2375
350 Ga0496101_0209315 3300048904 Bacteria 1510
351 Ga0496101_0461829 3300048904 Bacteria 1002
352 Ga0496101_0890441 3300048904 Bacteria 701
353 Ga0496102_0041207 3300048905 Bacteria 4180
354 Ga0496102_1024288 3300048905 Bacteria 746
355 Ga0496103_0062054 3300048906 Bacteria 2326
356 Ga0496103_0174623 3300048906 Bacteria 1380
357 Ga0496103_1069754 3300048906 Bacteria 500
358 Ga0496104_0065186 3300048907 Bacteria 3456
359 Ga0496104_0207678 3300048907 Bacteria 1870
360 Ga0496104_1610782 3300048907 Bacteria 552
361 Ga0496105_0042274 3300048908 Bacteria 3756
362 Ga0496105_0257458 3300048908 Bacteria 1412
363 Ga0496106_0005057 3300048909 Bacteria 9760
364 Ga0496107_0003284 3300048910 Bacteria 10792
365 Ga0496107_0089508 3300048910 Bacteria 2247
366 Ga0496107_0158230 3300048910 Bacteria 1678
367 Ga0496108_0063785 3300048911 Bacteria 3103
368 Ga0496108_0247765 3300048911 Bacteria 1550
369 Ga0496109_0038177 3300048912 Bacteria 4341
370 Ga0496109_0576767 3300048912 Bacteria 1060
371 Ga0496110_0109709 3300048913 Bacteria 2478
372 Ga0496110_0604408 3300048913 Bacteria 995
373 Ga0496111_0070021 3300048914 Bacteria 2551
374 Ga0496111_0135968 3300048914 Bacteria 1821
375 Ga0496111_1197389 3300048914 Bacteria 538
376 Ga0496112_0074787 3300048915 Bacteria 3350
377 Ga0496112_0134514 3300048915 Archaea 2443
378 Ga0496112_0255862 3300048915 Bacteria 1701
379 Ga0496112_0972789 3300048915 Bacteria 769
380 Ga0496113_0281900 3300048916 Bacteria 1329
381 Ga0496113_0771931 3300048916 Bacteria 765
382 Ga0496114_0012301 3300048917 Bacteria 6847
383 Ga0496114_0016898 3300048917 Bacteria 5884
384 Ga0496114_0083172 3300048917 Bacteria 2708
385 Ga0496114_0100186 3300048917 Bacteria 2472
386 Ga0496114_0292427 3300048917 Bacteria 1437
387 Ga0496115_0001782 3300048918 Bacteria 15400
388 Ga0496115_0014642 3300048918 Bacteria 5940
389 Ga0496115_0294930 3300048918 Bacteria 1329
390 Ga0496115_0394906 3300048918 Bacteria 1123
391 Ga0496115_0639185 3300048918 Bacteria 842
392 Ga0501034_0025651 3300049571 Bacteria 6003
393 Ga0501042_0207826 3300049578 Bacteria 1412
394 Ga0501047_0513077 3300049581 Bacteria 1025
395 Ga0501068_0177485 3300049584 Bacteria 1346
396 Ga0501070_0000865 3300049586 Bacteria 27548
397 Ga0501070_0025422 3300049586 Bacteria 4966
398 Ga0501070_0245341 3300049586 Bacteria 1466
399 Ga0501070_0413906 3300049586 Bacteria 1089
400 Ga0501070_0517511 3300049586 Bacteria 957
401 Ga0501072_0004984 3300049588 Bacteria 10101
402 Ga0501073_0620543 3300049589 Bacteria 746
403 Ga0501074_0084130 3300049590 Bacteria 2280
404 Ga0501076_1503796 3300049592 Bacteria 553
405 Ga0501076_1708740 3300049592 Bacteria 516
406 Ga0501079_0021471 3300049741 Bacteria 4939
407 Ga0501079_0310162 3300049741 Bacteria 1234
408 Ga0501079_0650272 3300049741 Bacteria 830
409 Ga0501079_1250027 3300049741 Bacteria 585
410 Ga0501080_0003281 3300049742 Bacteria 14291
411 Ga0501080_0094305 3300049742 Bacteria 2779
412 Ga0501080_0470510 3300049742 Bacteria 1125
413 Ga0501083_0002683 3300049744 Bacteria 12261
414 Ga0501044_0354663 3300049823 Bacteria 1386
415 nmdc:mga03n38_198905_c1 3300050490 Bacteria 1036
416 nmdc:mga05p37_1203293_c1 3300050507 Bacteria 783
417 nmdc:mga05p37_1828175_c1 3300050507 Bacteria 584
418 nmdc:mga05p37_193472_c1 3300050507 Bacteria 2468
419 nmdc:mga0qj67_213550_c1 3300050509 Bacteria 1567
420 nmdc:mga06r32_722560_c1 3300050510 Bacteria 961
421 nmdc:mga08y16_116518_c1 3300050511 Bacteria 2781
422 nmdc:mga08y16_687014_c1 3300050511 Bacteria 1025
423 nmdc:mga0n895_806345_c1 3300050512 Bacteria 929
424 Ga0495601_0015482 3300053077 Bacteria 4608
425 Ga0495601_0200164 3300053077 Bacteria 1305
426 Ga0495601_0447774 3300053077 Bacteria 835
427 Ga0495601_0746803 3300053077 Bacteria 623
428 Ga0495595_0084805 3300053084 Bacteria 1514
429 Ga0495619_0012190 3300053085 Bacteria 5411
430 Ga0495619_0136246 3300053085 Bacteria 1689
431 Ga0495619_0840896 3300053085 Bacteria 619
432 Ga0501084_0740712 3300054114 Bacteria 828
433 Ga0501082_0050009 3300060353 Bacteria 3605
434 Ga0466962_0053929 3300061719 Bacteria 1921
435 Ga0157372_12747844
436 Ga0070658_10088665
437 Ga0070683_100075756
438 Ga0070683_100125349
439 Ga0070680_100216179
440 Ga0070682_100470923
441 Ga0068868_100327348
442 Ga0068868_101006587
443 Ga0070660_100005287
444 Ga0070660_100132920
445 Ga0070660_100195377
446 Ga0070661_100009512
447 Ga0070661_100818758
448 Ga0070671_100007854
449 Ga0070674_101498838
450 Ga0070673_100481467
451 Ga0070659_100021929
452 Ga0070659_100046619
453 Ga0070659_100963363
454 Ga0070667_100005662
455 Ga0070701_10605983
456 Ga0070711_100150751
457 Ga0070681_10006682
458 Ga0070681_10106769
459 Ga0070681_10441940
460 Ga0070681_12048707
461 Ga0070707_101611938
462 Ga0070679_101781750
463 Ga0070696_100404184
464 Ga0070696_101110697
465 Ga0070693_101058347
466 Ga0070704_100956499
467 Ga0068855_100184770
468 Ga0068855_100978929
469 Ga0070664_100456268
470 Ga0068857_100008907
471 Ga0081455_10014997
472 Ga0081538_10008222
473 Ga0070717_10670027
474 Ga0075365_10101301
475 Ga0075363_100120461
476 Ga0075364_10085282
477 Ga0075432_10272003
478 Ga0070712_100398595
479 Ga0075362_10192197
480 Ga0075427_10007333
481 Ga0097621_101077466
482 Ga0068871_100692867
483 Ga0075428_100217168
484 Ga0075430_100078609
485 Ga0075431_101982323
486 Ga0068865_100069359
487 Ga0111539_10248023
488 Ga0105245_10754678
489 Ga0105245_10895151
490 Ga0105245_11160296
491 Ga0105245_12435270
492 Ga0114129_11303103
493 Ga0105243_10030950
494 Ga0105241_10502386
495 Ga0105238_10294448
496 Ga0105239_10036735
497 Ga0105239_10699391
498 Ga0105239_11004639
499 Ga0157321_1014676
500 Ga0157373_10564471
501 Ga0157371_11185887
502 Ga0157370_10050047
503 Ga0157370_11069545
504 Ga0157370_11297172
505 Ga0157369_10036942
506 Ga0157369_10041996
507 Ga0157369_10141497
508 Ga0157372_12390772
509 Ga0157375_10108756
510 Ga0182008_10288155
511 Ga0182008_10315772
512 Ga0157376_11108352
513 Ga0197907_11258090
514 Ga0206356_10060138
515 Ga0206356_11215031
516 Ga0206354_10650624
517 Ga0206353_10936454
518 Ga0206353_11523693
519 Ga0213875_10285872
520 Ga0224712_10281310
521 Ga0207705_10009261
522 Ga0207705_10316143
523 Ga0207654_10409559
524 Ga0207707_10044262
525 Ga0207707_10755839
526 Ga0207707_10978654
527 Ga0207671_10169881
528 Ga0207693_10300015
529 Ga0207693_10354720
530 Ga0207693_10731801
531 Ga0207693_10825852
532 Ga0207663_10144361
533 Ga0207663_10337018
534 Ga0207663_10387840
535 Ga0207660_10042632
536 Ga0207660_10174836
537 Ga0207657_10010091
538 Ga0207657_10022488
539 Ga0207649_10137014
540 Ga0207652_10351186
541 Ga0207652_10462422
542 Ga0207646_11251291
543 Ga0207694_10336303
544 Ga0207687_10705375
545 Ga0207644_10179469
546 Ga0207690_10110797
547 Ga0207690_10148003
548 Ga0207686_10547235
549 Ga0207709_10254215
550 Ga0207665_10133159
551 Ga0207711_10292051
552 Ga0207661_10044471
553 Ga0207661_10169797
554 Ga0207667_10133746
555 Ga0207667_10472546
556 Ga0207651_10420957
557 Ga0207658_10004204
558 Ga0207677_10214755
559 Ga0207677_10909478
560 Ga0207639_10378594
561 Ga0207708_10184992
562 Ga0207702_10539791
563 Ga0207702_11481865
564 Ga0207674_10047081
565 Ga0207683_10087207
566 Ga0207698_11074287
567 Ga0207428_10078522
568 Ga0207428_10091549
569 Ga0268266_10434240
570 Ga0265319_1001704
571 Ga0265319_1028132
572 Ga0265334_10018292
573 Ga0265334_10041410
574 Ga0265334_10056071
575 Ga0265318_10000570
576 Ga0265318_10007345
577 Ga0265318_10041570
578 Ga0265318_10062346
579 Ga0265323_10062986
580 Ga0265323_10078285
581 Ga0265322_10002655
582 Ga0265322_10025894
583 Ga0265336_10179316
584 Ga0265338_10005891
585 Ga0265338_10044381
586 Ga0265338_10096260
587 Ga0265338_10444693
588 Ga0265338_10516160
589 Ga0265338_10729967
590 Ga0265338_10849378
591 Ga0265324_10062585
592 Ga0265330_10045749
593 Ga0265330_10051928
594 Ga0265332_10038621
595 Ga0265328_10042850
596 Ga0265328_10288532
597 Ga0265320_10008525
598 Ga0265320_10129117
599 Ga0265320_10150142
600 Ga0265325_10007179
601 Ga0265325_10027563
602 Ga0265329_10015322
603 Ga0265329_10025165
604 Ga0265340_10045399
605 Ga0265340_10078554
606 Ga0265340_10133249
607 Ga0265339_10023109
608 Ga0265339_10122310
609 Ga0265331_10060063
610 Ga0265327_10002344
611 Ga0265327_10029694
612 Ga0265327_10124818
613 Ga0265316_10004722
614 Ga0265316_10142881
615 Ga0265316_10145632
616 Ga0265313_10001477
617 Ga0265313_10012852
618 Ga0265314_10007233
619 Ga0265314_10044755
620 Ga0265342_10069136
621 Ga0265342_10182803
622 Ga0307407_11609309
623 Ga0307416_100082492
624 Ga0307415_101240844
625 Ga0373936_0043288
626 Ga0373953_0344278
627 Ga0373954_0047371
628 Ga0373956_0427446
629 Ga0373957_0059127
630 Ga0373957_0267875
631 Ga0373946_0326988
632 Ga0373955_0190027
633 Ga0373933_0009086
634 Ga0373933_0265912
635 Ga0373947_0003894
636 Ga0373937_0056905
637 Ga0395899_0098651
638 Ga0395899_0313736
639 Ga0395900_0073961
640 Ga0395898_0624993
641 Ga0395898_1607861
642 Ga0395898_1967728
643 Ga0395905_1250144
644 Ga0395905_1420970
645 Ga0436364_1205416
646 Ga0395901_0017105
647 Ga0395901_0068668
648 Ga0395901_0090719
649 Ga0395901_0428809
650 Ga0395901_0627612
651 Ga0395901_1194209
652 Ga0436365_1667535
653 Ga0436360_1161098
654 Ga0436362_0937017
655 Ga0451835_0420725
656 Ga0451853_1474618
657 Ga0450915_002291
658 Ga0450888_013853
659 Ga0439459_0085850
660 Ga0451577_0722641
661 Ga0466969_0039548
662 Ga0466966_0035822
663 Ga0466966_0138363
664 Ga0466961_0016824
665 Ga0466961_0115995
666 Ga0466961_0241069
667 Ga0466963_0015146
668 Ga0466963_0112303
669 Ga0466963_0154139
670 Ga0466963_0253830
671 Ga0466963_0626475
672 Ga0466964_0003743
673 Ga0466964_0003879
674 Ga0466964_0008392
675 Ga0466964_0099184
676 Ga0466964_0693499
677 Ga0466964_0802114
678 Ga0453684_0555860
679 Ga0466971_0016077
680 Ga0466971_0021571
681 Ga0466968_0016753
682 Ga0466968_0063195
683 Ga0466968_0284597
684 Ga0466970_0120579
685 Ga0466957_0021880
686 Ga0466957_0095622
687 Ga0466957_0538073
688 Ga0466960_0295158
689 Ga0466959_0043074
690 Ga0466959_0062373
691 Ga0466959_0095177
692 Ga0451576_0623135
693 Ga0466958_0008704
694 Ga0466958_0012367
695 Ga0466958_0021599
696 Ga0466958_0061663
697 Ga0466958_0152896
698 Ga0466967_0000894
699 Ga0466967_0079957
700 Ga0466967_0114276
701 Ga0466967_0121398
702 Ga0466967_0127070
703 Ga0466967_0149805
704 Ga0466967_0155032
705 Ga0466967_0645043
706 Ga0466967_0937579
707 Ga0466967_1178599
708 Ga0466967_1328552
709 Ga0495592_0042949
710 Ga0495592_0212564
711 Ga0495629_0185467
712 Ga0495629_0664621
713 Ga0495641_0037484
714 Ga0495641_0181468
715 Ga0495651_0009103
716 Ga0495651_0052242
717 Ga0495651_0114801
718 Ga0495653_0069467
719 Ga0495582_0051585
720 Ga0495582_0137379
721 Ga0495664_0050975
722 Ga0495618_0016842
723 Ga0495618_0446228
724 Ga0495628_0026247
725 Ga0495628_0101252
726 Ga0495630_0022699
727 Ga0495630_0474588
728 Ga0495630_0535798
729 Ga0495666_0129479
730 Ga0495652_0034928
731 Ga0495652_0455155
732 Ga0495640_0046462
733 Ga0495640_0103230
734 Ga0495640_0208231
735 Ga0495586_0561094
736 Ga0495587_0131483
737 Ga0495645_0026928
738 Ga0495645_0829746
739 Ga0495667_0044662
740 Ga0495667_0072330
741 Ga0495667_0205845
742 Ga0495634_0057982
743 Ga0495634_0093506
744 Ga0495635_0057745
745 Ga0495635_0522823
746 Ga0495657_0051288
747 Ga0495657_0118848
748 Ga0495599_0201237
749 Ga0495623_0129262
750 Ga0495623_0145556
751 Ga0495623_0319108
752 Ga0495646_0191671
753 Ga0495646_0220929
754 Ga0495658_0039124
755 Ga0495658_0136811
756 Ga0495613_0155379
757 Ga0495613_0383131
758 Ga0495624_0191480
759 Ga0495624_0203094
760 Ga0495581_0656729
761 Ga0495604_0110476
762 Ga0495604_0304062
763 Ga0495604_0342020
764 Ga0495604_0951362
765 Ga0495674_0060970
766 Ga0495674_0446132
767 Ga0495674_0792460
768 Ga0495676_0056824
769 Ga0495680_0008192
770 Ga0495680_0020626
771 Ga0495680_0049286
772 Ga0495680_0073994
773 Ga0495680_0720300
774 Ga0495675_0153673
775 Ga0495684_0014709
776 Ga0495593_0156905
777 Ga0495602_0098760
778 Ga0495602_0499575
779 Ga0495602_0537444
780 Ga0496100_0009726
781 Ga0496100_1188716
782 Ga0496101_0011797
783 Ga0496101_0082754
784 Ga0496101_0209315
785 Ga0496101_0461829
786 Ga0496101_0890441
787 Ga0496102_0041207
788 Ga0496102_1024288
789 Ga0496103_0062054
790 Ga0496103_0174623
791 Ga0496103_1069754
792 Ga0496104_0065186
793 Ga0496104_0207678
794 Ga0496104_1610782
795 Ga0496105_0042274
796 Ga0496105_0257458
797 Ga0496106_0005057
798 Ga0496107_0003284
799 Ga0496107_0089508
800 Ga0496107_0158230
801 Ga0496108_0063785
802 Ga0496108_0247765
803 Ga0496109_0038177
804 Ga0496109_0576767
805 Ga0496110_0109709
806 Ga0496110_0604408
807 Ga0496111_0070021
808 Ga0496111_0135968
809 Ga0496111_1197389
810 Ga0496112_0074787
811 Ga0496112_0134514
812 Ga0496112_0255862
813 Ga0496112_0972789
814 Ga0496113_0281900
815 Ga0496113_0771931
816 Ga0496114_0012301
817 Ga0496114_0016898
818 Ga0496114_0083172
819 Ga0496114_0100186
820 Ga0496114_0292427
821 Ga0496115_0001782
822 Ga0496115_0014642
823 Ga0496115_0294930
824 Ga0496115_0394906
825 Ga0496115_0639185
826 Ga0501034_0025651
827 Ga0501042_0207826
828 Ga0501047_0513077
829 Ga0501068_0177485
830 Ga0501070_0000865
831 Ga0501070_0025422
832 Ga0501070_0245341
833 Ga0501070_0413906
834 Ga0501070_0517511
835 Ga0501072_0004984
836 Ga0501073_0620543
837 Ga0501074_0084130
838 Ga0501076_1503796
839 Ga0501076_1708740
840 Ga0501079_0021471
841 Ga0501079_0310162
842 Ga0501079_0650272
843 Ga0501079_1250027
844 Ga0501080_0003281
845 Ga0501080_0094305
846 Ga0501080_0470510
847 Ga0501083_0002683
848 Ga0501044_0354663
849 nmdc:mga03n38_198905_c1
850 nmdc:mga05p37_1203293_c1
851 nmdc:mga05p37_1828175_c1
852 nmdc:mga05p37_193472_c1
853 nmdc:mga0qj67_213550_c1
854 nmdc:mga06r32_722560_c1
855 nmdc:mga08y16_116518_c1
856 nmdc:mga08y16_687014_c1
857 nmdc:mga0n895_806345_c1
858 Ga0495601_0015482
859 Ga0495601_0200164
860 Ga0495601_0447774
861 Ga0495601_0746803
862 Ga0495595_0084805
863 Ga0495619_0012190
864 Ga0495619_0136246
865 Ga0495619_0840896
866 Ga0501084_0740712
867 Ga0501082_0050009
868 Ga0466962_0053929

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02254

TrkA_N

TrkA-N domain

3

118

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7exs-assembly1.cif.gz_A thermomicrobium roseum sarcosine oxidase mutant - s320r 1 1 31
7bkd-assembly1.cif.gz_a formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (heterodislfide reductase core and mobile arm in conformational state 1, composite structure) 0.99 2 32
6j38-assembly1.cif.gz_B-2 crystal structure of cmis2 0.9863 1 32
6j39-assembly1.cif.gz_A crystal structure of cmis2 with inhibitor 0.9843 1 32
3alm-assembly2.cif.gz_B crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase, mutant c294a 0.9833 2 32
ID Description Score Start End Superfamily
af_A0A1D6HRY4_17_247_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 1.008 2 29 3.50.50.60
af_A4HWA7_1_176_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 1.005 2 30 3.50.50.60
3zdnC01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.994 2 31 3.50.50.60
af_Q8VYV2_23_370_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9901 4 32 3.50.50.60
af_A0A0P0WM81_180_403_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9896 2 31 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A538I817-F1-model_v4 TrkA family potassium uptake protein 0.9959 1 131 GO:0005886
GO:0015079
AF-A0A537WX76-F1-model_v4 TrkA family potassium uptake protein 0.9932 2 131 GO:0005886
GO:0015079
AF-A0A7W0UFI5-F1-model_v4 TrkA family potassium uptake protein 0.9915 1 134 GO:0005886
GO:0015079
AF-A0A4P5QVA9-F1-model_v4 Trk system potassium uptake protein TrkA 0.9897 7 130 GO:0006813
GO:0008324
AF-A0A1J4VSA4-F1-model_v4 Trk system potassium uptake protein TrkA 0.9893 3 120 GO:0005886
GO:0015079

Map