F443084

General Info

Members Datasets Scaffolds Average Seq Length
434 209 868 300

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10126276|Ga0105243_101262763
Length 339
Sequence MEFALFIRQRLRQLKTEQRDLAAAAQVTESYISQLLTGKKAPPAPERTDIYLRMETYLRLPAGKLAHLADLQRQEVLMRKLAAPPAPLFQEVRELILRKCVAGKRHEIAAIFEREPFGALERLVAQKLLDVVQRMAKEEMEDETWLRLVARLSGRSYEQLRVVALEFLAMDIFNVSAENCVAFLDPLIESWDIDLATFGMEIVLNRRLAPGHPKRFEFVERPPAAPGDEEAGFRAFLQDPSLKGDATAEEIAFLRTLRFGRKRPTALYYYRELQSLRDPLHFHPATTRKTASSLSPWRSSIAPPGRLNHSAASSSAFIARGPTSRSNGKSARRNCNSGG

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
163 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
208 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.53
Rhizosphere 94.47
Stem 0
Stem Tuber 0
Unclassified 26.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10126276 3300009148 Bacteria 2164
2 Ga0065712_10000249 3300005290 Bacteria 50462
3 Ga0065712_10075234 3300005290 Unclassified 3890
4 Ga0065715_10000224 3300005293 Bacteria 33957
5 Ga0065715_10089263 3300005293 Bacteria 11761
6 Ga0065715_10118129 3300005293 Bacteria 2325
7 Ga0065715_10145478 3300005293 Unclassified 1795
8 Ga0065715_10218576 3300005293 Bacteria 1282
9 Ga0065707_10008832 3300005295 Bacteria 3180
10 Ga0065707_10015455 3300005295 Bacteria 1871
11 Ga0065707_10094898 3300005295 Bacteria 3438
12 Ga0065707_10095178 3300005295 Unclassified 3408
13 Ga0065707_10152849 3300005295 Unclassified 1640
14 Ga0065707_10243994 3300005295 Bacteria 1146
15 Ga0065707_10365874 3300005295 Bacteria 897
16 Ga0070676_10077676 3300005328 Archaea 2007
17 Ga0070676_10152027 3300005328 Bacteria 1482
18 Ga0070683_100008830 3300005329 Bacteria 8576
19 Ga0070683_100081997 3300005329 Bacteria 3020
20 Ga0070670_100004310 3300005331 Bacteria 11907
21 Ga0070670_100034437 3300005331 Bacteria 4358
22 Ga0070670_100034950 3300005331 Unclassified 4325
23 Ga0068869_100519377 3300005334 Unclassified 996
24 Ga0070682_100194841 3300005337 Unclassified 1425
25 Ga0068868_100034384 3300005338 Bacteria 3913
26 Ga0070660_100005328 3300005339 Bacteria 8902
27 Ga0070689_100057995 3300005340 Bacteria 3006
28 Ga0070661_100016003 3300005344 Bacteria 5294
29 Ga0070661_100129862 3300005344 Bacteria 1892
30 Ga0070661_100137941 3300005344 Unclassified 1836
31 Ga0070669_100011267 3300005353 Bacteria 6349
32 Ga0070669_100383570 3300005353 Unclassified 1146
33 Ga0070675_100034628 3300005354 Bacteria 4100
34 Ga0070675_100223972 3300005354 Unclassified 1639
35 Ga0070674_100037494 3300005356 Bacteria 3261
36 Ga0070674_100297661 3300005356 Archaea 1285
37 Ga0070688_100085684 3300005365 Unclassified 2048
38 Ga0070659_100071256 3300005366 Unclassified 2763
39 Ga0070659_100510711 3300005366 Unclassified 1025
40 Ga0070667_100145853 3300005367 Archaea 2076
41 Ga0070667_100515856 3300005367 Unclassified 1096
42 Ga0070714_100022382 3300005435 Bacteria 5182
43 Ga0070713_100264481 3300005436 Bacteria 1573
44 Ga0070701_10051865 3300005438 Bacteria 2129
45 Ga0070701_10118423 3300005438 Bacteria 1489
46 Ga0070700_100033814 3300005441 Bacteria 3082
47 Ga0070694_100069392 3300005444 Bacteria 2424
48 Ga0070694_100113278 3300005444 Bacteria 1935
49 Ga0070694_100224811 3300005444 Unclassified 1410
50 Ga0070708_100062712 3300005445 Bacteria 3325
51 Ga0070708_100148453 3300005445 Bacteria 2179
52 Ga0070663_100041363 3300005455 Unclassified 3232
53 Ga0070678_100135987 3300005456 Unclassified 1960
54 Ga0070662_100093464 3300005457 Unclassified 2262
55 Ga0070662_100356647 3300005457 Unclassified 1199
56 Ga0070681_10008601 3300005458 Bacteria 10006
57 Ga0070681_10183978 3300005458 Bacteria 2010
58 Ga0070706_100015556 3300005467 Bacteria 7027
59 Ga0070706_100090231 3300005467 Bacteria 2842
60 Ga0070707_100005858 3300005468 Bacteria 11459
61 Ga0070707_100022997 3300005468 Bacteria 5895
62 Ga0070707_100028786 3300005468 Bacteria 5287
63 Ga0070707_100136993 3300005468 Bacteria 2382
64 Ga0070707_100139559 3300005468 Bacteria 2358
65 Ga0070698_100048956 3300005471 Bacteria 4317
66 Ga0070698_100069820 3300005471 Bacteria 3526
67 Ga0070698_100104275 3300005471 Bacteria 2806
68 Ga0070698_100105783 3300005471 Bacteria 2783
69 Ga0070698_100287914 3300005471 Bacteria 1574
70 Ga0070699_100000020 3300005518 Bacteria 182025
71 Ga0070699_100008457 3300005518 Bacteria 8914
72 Ga0070699_100010851 3300005518 Bacteria 7883
73 Ga0070679_100045366 3300005530 Bacteria 4380
74 Ga0070679_100082126 3300005530 Bacteria 3213
75 Ga0070684_100037921 3300005535 Unclassified 4137
76 Ga0070684_100050726 3300005535 Unclassified 3605
77 Ga0070697_100014018 3300005536 Bacteria 6295
78 Ga0070697_100018393 3300005536 Bacteria 5509
79 Ga0070697_100038737 3300005536 Bacteria 3852
80 Ga0070697_100040394 3300005536 Bacteria 3774
81 Ga0070697_100041061 3300005536 Unclassified 3743
82 Ga0070697_100058918 3300005536 Bacteria 3125
83 Ga0070697_100162501 3300005536 Bacteria 1887
84 Ga0070697_100176547 3300005536 Unclassified 1810
85 Ga0070697_100238949 3300005536 Bacteria 1551
86 Ga0070697_100379223 3300005536 Bacteria 1225
87 Ga0070697_100432232 3300005536 Bacteria 1145
88 Ga0070697_100481956 3300005536 Bacteria 1083
89 Ga0068853_100030091 3300005539 Bacteria 4584
90 Ga0070672_100033575 3300005543 Bacteria 3887
91 Ga0070686_100164776 3300005544 Unclassified 1563
92 Ga0070695_100020203 3300005545 Unclassified 4065
93 Ga0070695_100135271 3300005545 Bacteria 1703
94 Ga0070696_100193614 3300005546 Bacteria 1514
95 Ga0070696_100207018 3300005546 Unclassified 1467
96 Ga0070693_100024345 3300005547 Bacteria 3246
97 Ga0070665_100013025 3300005548 Bacteria 8376
98 Ga0070704_100200278 3300005549 Bacteria 1611
99 Ga0068855_100049926 3300005563 Bacteria 4932
100 Ga0070664_100018329 3300005564 Bacteria 5748
101 Ga0070664_100042793 3300005564 Unclassified 3822
102 Ga0070664_100106670 3300005564 Unclassified 2441
103 Ga0068857_100024305 3300005577 Bacteria 5332
104 Ga0068857_100283163 3300005577 Bacteria 1525
105 Ga0068857_100368772 3300005577 Unclassified 1332
106 Ga0068854_100025413 3300005578 Unclassified 4063
107 Ga0068856_100013452 3300005614 Bacteria 7919
108 Ga0068856_100081519 3300005614 Unclassified 3210
109 Ga0068852_100023895 3300005616 Bacteria 4930
110 Ga0068859_100190307 3300005617 Bacteria 2136
111 Ga0068859_100386273 3300005617 Bacteria 1496
112 Ga0068861_100033416 3300005719 Bacteria 3794
113 Ga0068861_100264349 3300005719 Bacteria 1474
114 Ga0068851_10023537 3300005834 Bacteria 3011
115 Ga0068851_10151485 3300005834 Unclassified 1268
116 Ga0068863_100201166 3300005841 Bacteria 1916
117 Ga0068863_100408762 3300005841 Unclassified 1328
118 Ga0068858_100321748 3300005842 Bacteria 1478
119 Ga0068858_100455456 3300005842 Unclassified 1233
120 Ga0068860_100021567 3300005843 Bacteria 6238
121 Ga0068860_100071494 3300005843 Unclassified 3297
122 Ga0068862_100011574 3300005844 Bacteria 7277
123 Ga0068862_100058717 3300005844 Bacteria 3301
124 Ga0068862_100147313 3300005844 Bacteria 2093
125 Ga0070716_100000225 3300006173 Bacteria 22684
126 Ga0097621_100010109 3300006237 Bacteria 6886
127 Ga0068871_100000420 3300006358 Bacteria 29371
128 Ga0068871_100094498 3300006358 Unclassified 2496
129 Ga0075428_100028371 3300006844 Bacteria 6191
130 Ga0075428_100042799 3300006844 Bacteria 4979
131 Ga0075428_100294157 3300006844 Bacteria 1746
132 Ga0075430_100055405 3300006846 Bacteria 3334
133 Ga0075430_100232586 3300006846 Bacteria 1528
134 Ga0075431_100097691 3300006847 Bacteria 3033
135 Ga0075433_10012605 3300006852 Bacteria 6838
136 Ga0075433_10150134 3300006852 Unclassified 2073
137 Ga0075433_10157118 3300006852 Unclassified 2023
138 Ga0075433_10159615 3300006852 Unclassified 2006
139 Ga0075433_10208327 3300006852 Unclassified 1738
140 Ga0075434_100046969 3300006871 Bacteria 4285
141 Ga0075434_100097406 3300006871 Bacteria 2946
142 Ga0075434_100191567 3300006871 Unclassified 2065
143 Ga0075434_100332476 3300006871 Unclassified 1540
144 Ga0075434_100351957 3300006871 Bacteria 1494
145 Ga0075434_100352079 3300006871 Bacteria 1494
146 Ga0075429_100034007 3300006880 Bacteria 4429
147 Ga0075429_100185007 3300006880 Bacteria 1825
148 Ga0068865_100045860 3300006881 Bacteria 2997
149 Ga0075436_100013812 3300006914 Bacteria 5530
150 Ga0075436_100051391 3300006914 Bacteria 2845
151 Ga0075436_100055272 3300006914 Bacteria 2741
152 Ga0075436_100094619 3300006914 Unclassified 2077
153 Ga0075436_100146858 3300006914 Unclassified 1658
154 Ga0097620_100190302 3300006931 Bacteria 2136
155 Ga0097620_100386253 3300006931 Bacteria 1496
156 Ga0075435_100143675 3300007076 Unclassified 2003
157 Ga0075435_100156057 3300007076 Bacteria 1920
158 Ga0075435_100209325 3300007076 Bacteria 1654
159 Ga0099794_10009219 3300007265 Bacteria 4137
160 Ga0099794_10010788 3300007265 Unclassified 3888
161 Ga0099794_10011296 3300007265 Bacteria 3818
162 Ga0099795_10011274 3300007788 Bacteria 2666
163 Ga0105240_10028460 3300009093 Bacteria 7299
164 Ga0105240_10037210 3300009093 Bacteria 6255
165 Ga0105240_10066188 3300009093 Bacteria 4484
166 Ga0111539_10000960 3300009094 Bacteria 37825
167 Ga0111539_10011930 3300009094 Bacteria 10892
168 Ga0111539_10094016 3300009094 Bacteria 3522
169 Ga0111539_10572650 3300009094 Bacteria 1315
170 Ga0105245_10084115 3300009098 Bacteria 2914
171 Ga0105245_10129486 3300009098 Bacteria 2366
172 Ga0105247_10133873 3300009101 Bacteria 1618
173 Ga0105247_10245241 3300009101 Unclassified 1222
174 Ga0114129_10004001 3300009147 Bacteria 20820
175 Ga0114129_10080526 3300009147 Bacteria 4526
176 Ga0114129_10118965 3300009147 Plasmid 3639
177 Ga0114129_10125609 3300009147 Unclassified 3527
178 Ga0114129_10169812 3300009147 Bacteria 2974
179 Ga0114129_10308337 3300009147 Bacteria 2108
180 Ga0114129_10396931 3300009147 Unclassified 1818
181 Ga0114129_10613714 3300009147 Bacteria 1408
182 Ga0105243_10251322 3300009148 Bacteria 1578
183 Ga0105241_10009894 3300009174 Bacteria 7010
184 Ga0105241_10015465 3300009174 Bacteria 5590
185 Ga0105242_10004613 3300009176 Bacteria 10683
186 Ga0105242_10009540 3300009176 Bacteria 7436
187 Ga0105242_10715826 3300009176 Unclassified 981
188 Ga0105248_10008673 3300009177 Bacteria 11171
189 Ga0105248_10036231 3300009177 Bacteria 5517
190 Ga0105248_10064256 3300009177 Bacteria 4120
191 Ga0105248_10086142 3300009177 Bacteria 3535
192 Ga0105237_10013165 3300009545 Bacteria 8678
193 Ga0105238_10034107 3300009551 Bacteria 5179
194 Ga0105238_10144865 3300009551 Bacteria 2352
195 Ga0105249_10001218 3300009553 Bacteria 22696
196 Ga0105249_10006035 3300009553 Bacteria 10499
197 Ga0105249_10054931 3300009553 Bacteria 3642
198 Ga0105249_10142733 3300009553 Unclassified 2298
199 Ga0105239_10088877 3300010375 Unclassified 3406
200 Ga0105239_10306683 3300010375 Bacteria 1788
201 Ga0105239_10637870 3300010375 Unclassified 1216
202 Ga0105246_10031122 3300011119 Bacteria 3529
203 Ga0157373_10002394 3300013100 Bacteria 14240
204 Ga0157373_10028046 3300013100 Bacteria 4062
205 Ga0157370_10034167 3300013104 Bacteria 4954
206 Ga0157370_10036963 3300013104 Bacteria 4736
207 Ga0157369_10122552 3300013105 Unclassified 2758
208 Ga0157374_10045825 3300013296 Unclassified 4047
209 Ga0157374_10123674 3300013296 Bacteria 2499
210 Ga0157378_10000114 3300013297 Bacteria 77298
211 Ga0157378_10003574 3300013297 Bacteria 13763
212 Ga0157378_10031926 3300013297 Bacteria 4652
213 Ga0163162_10014433 3300013306 Bacteria 7720
214 Ga0163162_10077162 3300013306 Bacteria 3395
215 Ga0163162_10257690 3300013306 Bacteria 1876
216 Ga0163162_10523758 3300013306 Unclassified 1315
217 Ga0157372_10023811 3300013307 Bacteria 6643
218 Ga0157372_10141616 3300013307 Bacteria 2771
219 Ga0157375_10103895 3300013308 Unclassified 2929
220 Ga0157375_10164667 3300013308 Bacteria 2362
221 Ga0157375_10239316 3300013308 Bacteria 1975
222 Ga0163163_10013737 3300014325 Bacteria 7421
223 Ga0163163_10054374 3300014325 Bacteria 3955
224 Ga0163163_10167375 3300014325 Bacteria 2244
225 Ga0157379_10060304 3300014968 Unclassified 3392
226 Ga0157379_10194544 3300014968 Bacteria 1833
227 Ga0157376_10000051 3300014969 Bacteria 102604
228 Ga0157376_10417772 3300014969 Unclassified 1301
229 Ga0207656_10051904 3300025321 Bacteria 1774
230 Ga0207688_10023651 3300025901 Bacteria 3367
231 Ga0207688_10065725 3300025901 Unclassified 2050
232 Ga0207680_10052563 3300025903 Unclassified 2442
233 Ga0207645_10016378 3300025907 Bacteria 4908
234 Ga0207645_10078010 3300025907 Bacteria 2122
235 Ga0207643_10060389 3300025908 Unclassified 2164
236 Ga0207684_10009039 3300025910 Bacteria 8828
237 Ga0207684_10013624 3300025910 Bacteria 7027
238 Ga0207684_10081022 3300025910 Bacteria 2762
239 Ga0207684_10120797 3300025910 Bacteria 2246
240 Ga0207654_10031409 3300025911 Unclassified 2924
241 Ga0207707_10038548 3300025912 Bacteria 4175
242 Ga0207707_10142861 3300025912 Unclassified 2092
243 Ga0207695_10073934 3300025913 Bacteria 3471
244 Ga0207695_10192299 3300025913 Unclassified 1958
245 Ga0207671_10028231 3300025914 Bacteria 4194
246 Ga0207693_10027106 3300025915 Bacteria 4531
247 Ga0207693_10142305 3300025915 Bacteria 1886
248 Ga0207660_10057063 3300025917 Bacteria 2796
249 Ga0207662_10011497 3300025918 Bacteria 4913
250 Ga0207657_10010379 3300025919 Bacteria 9296
251 Ga0207649_10004666 3300025920 Bacteria 7415
252 Ga0207649_10078165 3300025920 Unclassified 2134
253 Ga0207652_10126305 3300025921 Unclassified 2279
254 Ga0207652_10249224 3300025921 Unclassified 1602
255 Ga0207646_10000152 3300025922 Bacteria 95335
256 Ga0207646_10000479 3300025922 Bacteria 53461
257 Ga0207646_10025578 3300025922 Bacteria 5399
258 Ga0207646_10037311 3300025922 Bacteria 4382
259 Ga0207646_10048510 3300025922 Bacteria 3806
260 Ga0207646_10073474 3300025922 Unclassified 3054
261 Ga0207646_10240425 3300025922 Bacteria 1636
262 Ga0207681_10032013 3300025923 Unclassified 3439
263 Ga0207694_10008770 3300025924 Bacteria 7629
264 Ga0207650_10006984 3300025925 Bacteria 7701
265 Ga0207650_10051775 3300025925 Unclassified 3040
266 Ga0207650_10289866 3300025925 Bacteria 1334
267 Ga0207659_10043069 3300025926 Bacteria 3168
268 Ga0207687_10191122 3300025927 Bacteria 1594
269 Ga0207664_10022595 3300025929 Bacteria 4700
270 Ga0207664_10518372 3300025929 Bacteria 1068
271 Ga0207690_10177871 3300025932 Bacteria 1599
272 Ga0207706_10191539 3300025933 Bacteria 1795
273 Ga0207686_10051162 3300025934 Bacteria 2572
274 Ga0207686_10304671 3300025934 Unclassified 1184
275 Ga0207709_10112555 3300025935 Bacteria 1823
276 Ga0207709_10182062 3300025935 Bacteria 1485
277 Ga0207669_10072240 3300025937 Bacteria 2172
278 Ga0207704_10054234 3300025938 Bacteria 2443
279 Ga0207704_10241066 3300025938 Bacteria 1351
280 Ga0207665_10000073 3300025939 Bacteria 65369
281 Ga0207691_10020221 3300025940 Bacteria 6296
282 Ga0207711_10010180 3300025941 Bacteria 7806
283 Ga0207711_10020096 3300025941 Bacteria 5565
284 Ga0207711_10067186 3300025941 Bacteria 3103
285 Ga0207661_10017306 3300025944 Bacteria 5330
286 Ga0207661_10077023 3300025944 Unclassified 2741
287 Ga0207679_10005755 3300025945 Bacteria 7780
288 Ga0207679_10112168 3300025945 Unclassified 2154
289 Ga0207679_10311465 3300025945 Bacteria 1360
290 Ga0207667_10014007 3300025949 Bacteria 9156
291 Ga0207651_10012640 3300025960 Bacteria 4788
292 Ga0207712_10078622 3300025961 Bacteria 2394
293 Ga0207712_10084891 3300025961 Bacteria 2315
294 Ga0207712_10093956 3300025961 Unclassified 2214
295 Ga0207668_10243514 3300025972 Bacteria 1456
296 Ga0207640_10115928 3300025981 Bacteria 1909
297 Ga0207658_10082435 3300025986 Bacteria 2470
298 Ga0207658_10187384 3300025986 Bacteria 1717
299 Ga0207677_10089742 3300026023 Bacteria 2232
300 Ga0207639_10013302 3300026041 Bacteria 5756
301 Ga0207678_10035880 3300026067 Bacteria 4317
302 Ga0207678_10058367 3300026067 Unclassified 3321
303 Ga0207708_10010659 3300026075 Bacteria 6826
304 Ga0207702_10014853 3300026078 Bacteria 6459
305 Ga0207702_10020821 3300026078 Bacteria 5425
306 Ga0207641_10032514 3300026088 Bacteria 4331
307 Ga0207641_10226276 3300026088 Unclassified 1737
308 Ga0207648_10011059 3300026089 Bacteria 8515
309 Ga0207674_10003281 3300026116 Bacteria 19894
310 Ga0207674_10018352 3300026116 Bacteria 7606
311 Ga0207675_100048351 3300026118 Bacteria 3970
312 Ga0207675_100369801 3300026118 Bacteria 1408
313 Ga0207683_10013202 3300026121 Bacteria 7046
314 Ga0207683_10113445 3300026121 Bacteria 2427
315 Ga0207698_10219023 3300026142 Bacteria 1718
316 Ga0207698_10254536 3300026142 Unclassified 1609
317 Ga0209179_1000746 3300027512 Bacteria 3529
318 Ga0209588_1005317 3300027671 Unclassified 3681
319 Ga0209588_1037899 3300027671 Bacteria 1553
320 Ga0207428_10002518 3300027907 Bacteria 18290
321 Ga0207428_10003103 3300027907 Bacteria 16331
322 Ga0207428_10249655 3300027907 Unclassified 1323
323 Ga0268265_10032050 3300028380 Bacteria 3803
324 Ga0268265_10045312 3300028380 Bacteria 3281
325 Ga0268265_10052316 3300028380 Bacteria 3088
326 Ga0268264_10019149 3300028381 Bacteria 5595
327 Ga0268264_10062538 3300028381 Unclassified 3126
328 Ga0373946_0084476 3300035171 Unclassified 1396
329 Ga0373935_0064954 3300035692 Bacteria 2341
330 Ga0373927_0001112 3300035695 Bacteria 20423
331 Ga0373927_0001561 3300035695 Bacteria 17166
332 Ga0373933_0013206 3300035724 Unclassified 4575
333 Ga0373947_0005049 3300035725 Bacteria 7729
334 Ga0373947_0008096 3300035725 Bacteria 6060
335 Ga0373937_0016957 3300036401 Bacteria 6477
336 Ga0373925_0003455 3300037068 Bacteria 12218
337 Ga0373925_0010535 3300037068 Bacteria 6706
338 Ga0395900_0238156 3300037418 Bacteria 1827
339 Ga0395905_0500907 3300037471 Unclassified 1115
340 Ga0439433_0042714 3300041999 Bacteria 1057
341 Ga0439446_0008738 3300042156 Bacteria 2698
342 Ga0451577_0020579 3300042876 Bacteria 6051
343 Ga0451577_0152808 3300042876 Bacteria 2077
344 Ga0451577_0165263 3300042876 Bacteria 1993
345 Ga0453683_0003038 3300044673 Bacteria 12560
346 Ga0453683_0025800 3300044673 Bacteria 3731
347 Ga0453683_0073293 3300044673 Bacteria 2143
348 Ga0453684_0017202 3300044712 Bacteria 11227
349 Ga0453684_0291556 3300044712 Bacteria 1858
350 Ga0451576_0019812 3300045051 Bacteria 7338
351 Ga0451576_0023820 3300045051 Bacteria 6624
352 Ga0495603_0046864 3300046455 Unclassified 2575
353 Ga0495580_0107887 3300046472 Unclassified 1933
354 Ga0495580_0178920 3300046472 Bacteria 1465
355 Ga0495594_0029175 3300046499 Unclassified 2981
356 Ga0495630_0094578 3300046517 Unclassified 2259
357 Ga0495630_0217915 3300046517 Bacteria 1457
358 Ga0495665_0105325 3300046531 Bacteria 1480
359 Ga0495659_0104768 3300046664 Bacteria 1099
360 Ga0495588_0001729 3300046674 Bacteria 9298
361 Ga0495624_0190337 3300046690 Unclassified 1248
362 Ga0495581_0166481 3300047315 Unclassified 1289
363 Ga0495676_0079177 3300047321 Unclassified 2499
364 Ga0495676_0146260 3300047321 Bacteria 1688
365 Ga0495684_0133941 3300047471 Bacteria 1860
366 Ga0496101_0055654 3300048904 Archaea 2858
367 Ga0496102_0006239 3300048905 Bacteria 10163
368 Ga0496102_0510808 3300048905 Unclassified 1124
369 Ga0496104_0004618 3300048907 Bacteria 12003
370 Ga0496104_0021641 3300048907 Bacteria 5905
371 Ga0496105_0080352 3300048908 Unclassified 2693
372 Ga0496105_0329591 3300048908 Archaea 1222
373 Ga0496106_0040499 3300048909 Bacteria 3490
374 Ga0496107_0104280 3300048910 Bacteria 2081
375 Ga0496108_0009067 3300048911 Bacteria 8059
376 Ga0496108_0032720 3300048911 Unclassified 4319
377 Ga0496109_0000620 3300048912 Bacteria 29596
378 Ga0496109_0012780 3300048912 Bacteria 7258
379 Ga0496109_0363670 3300048912 Unclassified 1367
380 Ga0496110_0000742 3300048913 Bacteria 22522
381 Ga0496110_0048020 3300048913 Unclassified 3740
382 Ga0496111_0003713 3300048914 Bacteria 9496
383 Ga0496112_0003666 3300048915 Bacteria 12797
384 Ga0496112_0070379 3300048915 Bacteria 3457
385 Ga0496113_0001710 3300048916 Bacteria 12422
386 Ga0496113_0500545 3300048916 Unclassified 975
387 Ga0496114_0169562 3300048917 Unclassified 1902
388 Ga0496115_0008220 3300048918 Bacteria 7710
389 Ga0496115_0165706 3300048918 Bacteria 1828
390 Ga0501041_0196858 3300049577 Bacteria 1263
391 Ga0501072_0232098 3300049588 Bacteria 1470
392 Ga0501075_0238492 3300049591 Bacteria 1386
393 Ga0501081_0446697 3300049743 Unclassified 960
394 Ga0501045_0296237 3300049824 Bacteria 1204
395 nmdc:mga05p37_111419_c1 3300050507 Unclassified 3366
396 nmdc:mga05p37_169966_c1 3300050507 Unclassified 2659
397 nmdc:mga05p37_269206_c1 3300050507 Bacteria 2036
398 nmdc:mga05p37_28462_c1 3300050507 Bacteria 6813
399 nmdc:mga05p37_366759_c1 3300050507 Bacteria 1691
400 nmdc:mga05p37_82705_c1 3300050507 Unclassified 3956
401 nmdc:mga05p37_97751_c1 3300050507 Bacteria 3616
402 nmdc:mga09592_126902_c1 3300050508 Bacteria 1762
403 nmdc:mga0qj67_467746_c1 3300050509 Unclassified 1015
404 nmdc:mga0qj67_64430_c1 3300050509 Bacteria 2915
405 nmdc:mga06r32_267766_c1 3300050510 Bacteria 1696
406 nmdc:mga08y16_170949_c1 3300050511 Bacteria 2257
407 nmdc:mga08y16_19236_c1 3300050511 Bacteria 7197
408 nmdc:mga08y16_393073_c1 3300050511 Bacteria 1420
409 nmdc:mga08y16_448_c1 3300050511 Bacteria 38218
410 nmdc:mga0n895_192463_c1 3300050512 Unclassified 2071
411 nmdc:mga0n895_296047_c1 3300050512 Unclassified 1641
412 nmdc:mga0n895_329777_c1 3300050512 Bacteria 1546
413 nmdc:mga0n895_411387_c1 3300050512 Bacteria 1368
414 nmdc:mga0n895_42803_c1 3300050512 Bacteria 4408
415 nmdc:mga0n895_74752_c1 3300050512 Plasmid 3367
416 nmdc:mga0n895_88735_c1 3300050512 Bacteria 3092
417 nmdc:mga0rr50_115651_c1 3300050513 Unclassified 2129
418 nmdc:mga0rr50_387860_c1 3300050513 Unclassified 1178
419 nmdc:mga0rr50_99566_c1 3300050513 Bacteria 2281
420 nmdc:mga08x19_170382_c1 3300050514 Unclassified 1483
421 nmdc:mga08x19_23205_c1 3300050514 Bacteria 3848
422 nmdc:mga08x19_27136_c1 3300050514 Bacteria 3580
423 nmdc:mga08x19_364_c1 3300050514 Bacteria 32099
424 nmdc:mga08x19_57520_c1 3300050514 Bacteria 2513
425 nmdc:mga08x19_60345_c1 3300050514 Bacteria 2456
426 nmdc:mga08x19_68573_c1 3300050514 Unclassified 2308
427 nmdc:mga0a205_125027_c1 3300050515 Unclassified 2471
428 nmdc:mga0a205_25412_c1 3300050515 Bacteria 5643
429 nmdc:mga0a205_306038_c1 3300050515 Bacteria 1462
430 nmdc:mga0a205_40417_c1 3300050515 Unclassified 4490
431 nmdc:mga0a205_75138_c1 3300050515 Plasmid 3265
432 Ga0495601_0110503 3300053077 Unclassified 1780
433 Ga0495612_0029191 3300053078 Unclassified 2221
434 Ga0501084_0126260 3300054114 Bacteria 2153
435 Ga0105243_10126276
436 Ga0065712_10000249
437 Ga0065712_10075234
438 Ga0065715_10000224
439 Ga0065715_10089263
440 Ga0065715_10118129
441 Ga0065715_10145478
442 Ga0065715_10218576
443 Ga0065707_10008832
444 Ga0065707_10015455
445 Ga0065707_10094898
446 Ga0065707_10095178
447 Ga0065707_10152849
448 Ga0065707_10243994
449 Ga0065707_10365874
450 Ga0070676_10077676
451 Ga0070676_10152027
452 Ga0070683_100008830
453 Ga0070683_100081997
454 Ga0070670_100004310
455 Ga0070670_100034437
456 Ga0070670_100034950
457 Ga0068869_100519377
458 Ga0070682_100194841
459 Ga0068868_100034384
460 Ga0070660_100005328
461 Ga0070689_100057995
462 Ga0070661_100016003
463 Ga0070661_100129862
464 Ga0070661_100137941
465 Ga0070669_100011267
466 Ga0070669_100383570
467 Ga0070675_100034628
468 Ga0070675_100223972
469 Ga0070674_100037494
470 Ga0070674_100297661
471 Ga0070688_100085684
472 Ga0070659_100071256
473 Ga0070659_100510711
474 Ga0070667_100145853
475 Ga0070667_100515856
476 Ga0070714_100022382
477 Ga0070713_100264481
478 Ga0070701_10051865
479 Ga0070701_10118423
480 Ga0070700_100033814
481 Ga0070694_100069392
482 Ga0070694_100113278
483 Ga0070694_100224811
484 Ga0070708_100062712
485 Ga0070708_100148453
486 Ga0070663_100041363
487 Ga0070678_100135987
488 Ga0070662_100093464
489 Ga0070662_100356647
490 Ga0070681_10008601
491 Ga0070681_10183978
492 Ga0070706_100015556
493 Ga0070706_100090231
494 Ga0070707_100005858
495 Ga0070707_100022997
496 Ga0070707_100028786
497 Ga0070707_100136993
498 Ga0070707_100139559
499 Ga0070698_100048956
500 Ga0070698_100069820
501 Ga0070698_100104275
502 Ga0070698_100105783
503 Ga0070698_100287914
504 Ga0070699_100000020
505 Ga0070699_100008457
506 Ga0070699_100010851
507 Ga0070679_100045366
508 Ga0070679_100082126
509 Ga0070684_100037921
510 Ga0070684_100050726
511 Ga0070697_100014018
512 Ga0070697_100018393
513 Ga0070697_100038737
514 Ga0070697_100040394
515 Ga0070697_100041061
516 Ga0070697_100058918
517 Ga0070697_100162501
518 Ga0070697_100176547
519 Ga0070697_100238949
520 Ga0070697_100379223
521 Ga0070697_100432232
522 Ga0070697_100481956
523 Ga0068853_100030091
524 Ga0070672_100033575
525 Ga0070686_100164776
526 Ga0070695_100020203
527 Ga0070695_100135271
528 Ga0070696_100193614
529 Ga0070696_100207018
530 Ga0070693_100024345
531 Ga0070665_100013025
532 Ga0070704_100200278
533 Ga0068855_100049926
534 Ga0070664_100018329
535 Ga0070664_100042793
536 Ga0070664_100106670
537 Ga0068857_100024305
538 Ga0068857_100283163
539 Ga0068857_100368772
540 Ga0068854_100025413
541 Ga0068856_100013452
542 Ga0068856_100081519
543 Ga0068852_100023895
544 Ga0068859_100190307
545 Ga0068859_100386273
546 Ga0068861_100033416
547 Ga0068861_100264349
548 Ga0068851_10023537
549 Ga0068851_10151485
550 Ga0068863_100201166
551 Ga0068863_100408762
552 Ga0068858_100321748
553 Ga0068858_100455456
554 Ga0068860_100021567
555 Ga0068860_100071494
556 Ga0068862_100011574
557 Ga0068862_100058717
558 Ga0068862_100147313
559 Ga0070716_100000225
560 Ga0097621_100010109
561 Ga0068871_100000420
562 Ga0068871_100094498
563 Ga0075428_100028371
564 Ga0075428_100042799
565 Ga0075428_100294157
566 Ga0075430_100055405
567 Ga0075430_100232586
568 Ga0075431_100097691
569 Ga0075433_10012605
570 Ga0075433_10150134
571 Ga0075433_10157118
572 Ga0075433_10159615
573 Ga0075433_10208327
574 Ga0075434_100046969
575 Ga0075434_100097406
576 Ga0075434_100191567
577 Ga0075434_100332476
578 Ga0075434_100351957
579 Ga0075434_100352079
580 Ga0075429_100034007
581 Ga0075429_100185007
582 Ga0068865_100045860
583 Ga0075436_100013812
584 Ga0075436_100051391
585 Ga0075436_100055272
586 Ga0075436_100094619
587 Ga0075436_100146858
588 Ga0097620_100190302
589 Ga0097620_100386253
590 Ga0075435_100143675
591 Ga0075435_100156057
592 Ga0075435_100209325
593 Ga0099794_10009219
594 Ga0099794_10010788
595 Ga0099794_10011296
596 Ga0099795_10011274
597 Ga0105240_10028460
598 Ga0105240_10037210
599 Ga0105240_10066188
600 Ga0111539_10000960
601 Ga0111539_10011930
602 Ga0111539_10094016
603 Ga0111539_10572650
604 Ga0105245_10084115
605 Ga0105245_10129486
606 Ga0105247_10133873
607 Ga0105247_10245241
608 Ga0114129_10004001
609 Ga0114129_10080526
610 Ga0114129_10118965
611 Ga0114129_10125609
612 Ga0114129_10169812
613 Ga0114129_10308337
614 Ga0114129_10396931
615 Ga0114129_10613714
616 Ga0105243_10251322
617 Ga0105241_10009894
618 Ga0105241_10015465
619 Ga0105242_10004613
620 Ga0105242_10009540
621 Ga0105242_10715826
622 Ga0105248_10008673
623 Ga0105248_10036231
624 Ga0105248_10064256
625 Ga0105248_10086142
626 Ga0105237_10013165
627 Ga0105238_10034107
628 Ga0105238_10144865
629 Ga0105249_10001218
630 Ga0105249_10006035
631 Ga0105249_10054931
632 Ga0105249_10142733
633 Ga0105239_10088877
634 Ga0105239_10306683
635 Ga0105239_10637870
636 Ga0105246_10031122
637 Ga0157373_10002394
638 Ga0157373_10028046
639 Ga0157370_10034167
640 Ga0157370_10036963
641 Ga0157369_10122552
642 Ga0157374_10045825
643 Ga0157374_10123674
644 Ga0157378_10000114
645 Ga0157378_10003574
646 Ga0157378_10031926
647 Ga0163162_10014433
648 Ga0163162_10077162
649 Ga0163162_10257690
650 Ga0163162_10523758
651 Ga0157372_10023811
652 Ga0157372_10141616
653 Ga0157375_10103895
654 Ga0157375_10164667
655 Ga0157375_10239316
656 Ga0163163_10013737
657 Ga0163163_10054374
658 Ga0163163_10167375
659 Ga0157379_10060304
660 Ga0157379_10194544
661 Ga0157376_10000051
662 Ga0157376_10417772
663 Ga0207656_10051904
664 Ga0207688_10023651
665 Ga0207688_10065725
666 Ga0207680_10052563
667 Ga0207645_10016378
668 Ga0207645_10078010
669 Ga0207643_10060389
670 Ga0207684_10009039
671 Ga0207684_10013624
672 Ga0207684_10081022
673 Ga0207684_10120797
674 Ga0207654_10031409
675 Ga0207707_10038548
676 Ga0207707_10142861
677 Ga0207695_10073934
678 Ga0207695_10192299
679 Ga0207671_10028231
680 Ga0207693_10027106
681 Ga0207693_10142305
682 Ga0207660_10057063
683 Ga0207662_10011497
684 Ga0207657_10010379
685 Ga0207649_10004666
686 Ga0207649_10078165
687 Ga0207652_10126305
688 Ga0207652_10249224
689 Ga0207646_10000152
690 Ga0207646_10000479
691 Ga0207646_10025578
692 Ga0207646_10037311
693 Ga0207646_10048510
694 Ga0207646_10073474
695 Ga0207646_10240425
696 Ga0207681_10032013
697 Ga0207694_10008770
698 Ga0207650_10006984
699 Ga0207650_10051775
700 Ga0207650_10289866
701 Ga0207659_10043069
702 Ga0207687_10191122
703 Ga0207664_10022595
704 Ga0207664_10518372
705 Ga0207690_10177871
706 Ga0207706_10191539
707 Ga0207686_10051162
708 Ga0207686_10304671
709 Ga0207709_10112555
710 Ga0207709_10182062
711 Ga0207669_10072240
712 Ga0207704_10054234
713 Ga0207704_10241066
714 Ga0207665_10000073
715 Ga0207691_10020221
716 Ga0207711_10010180
717 Ga0207711_10020096
718 Ga0207711_10067186
719 Ga0207661_10017306
720 Ga0207661_10077023
721 Ga0207679_10005755
722 Ga0207679_10112168
723 Ga0207679_10311465
724 Ga0207667_10014007
725 Ga0207651_10012640
726 Ga0207712_10078622
727 Ga0207712_10084891
728 Ga0207712_10093956
729 Ga0207668_10243514
730 Ga0207640_10115928
731 Ga0207658_10082435
732 Ga0207658_10187384
733 Ga0207677_10089742
734 Ga0207639_10013302
735 Ga0207678_10035880
736 Ga0207678_10058367
737 Ga0207708_10010659
738 Ga0207702_10014853
739 Ga0207702_10020821
740 Ga0207641_10032514
741 Ga0207641_10226276
742 Ga0207648_10011059
743 Ga0207674_10003281
744 Ga0207674_10018352
745 Ga0207675_100048351
746 Ga0207675_100369801
747 Ga0207683_10013202
748 Ga0207683_10113445
749 Ga0207698_10219023
750 Ga0207698_10254536
751 Ga0209179_1000746
752 Ga0209588_1005317
753 Ga0209588_1037899
754 Ga0207428_10002518
755 Ga0207428_10003103
756 Ga0207428_10249655
757 Ga0268265_10032050
758 Ga0268265_10045312
759 Ga0268265_10052316
760 Ga0268264_10019149
761 Ga0268264_10062538
762 Ga0373946_0084476
763 Ga0373935_0064954
764 Ga0373927_0001112
765 Ga0373927_0001561
766 Ga0373933_0013206
767 Ga0373947_0005049
768 Ga0373947_0008096
769 Ga0373937_0016957
770 Ga0373925_0003455
771 Ga0373925_0010535
772 Ga0395900_0238156
773 Ga0395905_0500907
774 Ga0439433_0042714
775 Ga0439446_0008738
776 Ga0451577_0020579
777 Ga0451577_0152808
778 Ga0451577_0165263
779 Ga0453683_0003038
780 Ga0453683_0025800
781 Ga0453683_0073293
782 Ga0453684_0017202
783 Ga0453684_0291556
784 Ga0451576_0019812
785 Ga0451576_0023820
786 Ga0495603_0046864
787 Ga0495580_0107887
788 Ga0495580_0178920
789 Ga0495594_0029175
790 Ga0495630_0094578
791 Ga0495630_0217915
792 Ga0495665_0105325
793 Ga0495659_0104768
794 Ga0495588_0001729
795 Ga0495624_0190337
796 Ga0495581_0166481
797 Ga0495676_0079177
798 Ga0495676_0146260
799 Ga0495684_0133941
800 Ga0496101_0055654
801 Ga0496102_0006239
802 Ga0496102_0510808
803 Ga0496104_0004618
804 Ga0496104_0021641
805 Ga0496105_0080352
806 Ga0496105_0329591
807 Ga0496106_0040499
808 Ga0496107_0104280
809 Ga0496108_0009067
810 Ga0496108_0032720
811 Ga0496109_0000620
812 Ga0496109_0012780
813 Ga0496109_0363670
814 Ga0496110_0000742
815 Ga0496110_0048020
816 Ga0496111_0003713
817 Ga0496112_0003666
818 Ga0496112_0070379
819 Ga0496113_0001710
820 Ga0496113_0500545
821 Ga0496114_0169562
822 Ga0496115_0008220
823 Ga0496115_0165706
824 Ga0501041_0196858
825 Ga0501072_0232098
826 Ga0501075_0238492
827 Ga0501081_0446697
828 Ga0501045_0296237
829 nmdc:mga05p37_111419_c1
830 nmdc:mga05p37_169966_c1
831 nmdc:mga05p37_269206_c1
832 nmdc:mga05p37_28462_c1
833 nmdc:mga05p37_366759_c1
834 nmdc:mga05p37_82705_c1
835 nmdc:mga05p37_97751_c1
836 nmdc:mga09592_126902_c1
837 nmdc:mga0qj67_467746_c1
838 nmdc:mga0qj67_64430_c1
839 nmdc:mga06r32_267766_c1
840 nmdc:mga08y16_170949_c1
841 nmdc:mga08y16_19236_c1
842 nmdc:mga08y16_393073_c1
843 nmdc:mga08y16_448_c1
844 nmdc:mga0n895_192463_c1
845 nmdc:mga0n895_296047_c1
846 nmdc:mga0n895_329777_c1
847 nmdc:mga0n895_411387_c1
848 nmdc:mga0n895_42803_c1
849 nmdc:mga0n895_74752_c1
850 nmdc:mga0n895_88735_c1
851 nmdc:mga0rr50_115651_c1
852 nmdc:mga0rr50_387860_c1
853 nmdc:mga0rr50_99566_c1
854 nmdc:mga08x19_170382_c1
855 nmdc:mga08x19_23205_c1
856 nmdc:mga08x19_27136_c1
857 nmdc:mga08x19_364_c1
858 nmdc:mga08x19_57520_c1
859 nmdc:mga08x19_60345_c1
860 nmdc:mga08x19_68573_c1
861 nmdc:mga0a205_125027_c1
862 nmdc:mga0a205_25412_c1
863 nmdc:mga0a205_306038_c1
864 nmdc:mga0a205_40417_c1
865 nmdc:mga0a205_75138_c1
866 Ga0495601_0110503
867 Ga0495612_0029191
868 Ga0501084_0126260

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

7

47

0.9

Map