F442921

General Info

Members Datasets Scaffolds Average Seq Length
433 266 866 221

Family's Representative Sequence

Representative Sequence 3300046506|Ga0495583_0084875|Ga0495583_0084875_366_1127
Length 253
Sequence MAAQAAGADSTPGTVTRIITIDGPSGAGKGTVSRRVAAELKWHLLDSGALYRLVAYEAQSRGVSFDDIVGLVGIAAGLDVTFGADLRGEEQIWLAGREVSHAIRSEQAGDGASRVAAIPAVRSALTARQHAFAGDPGLVADGRDMGTVIFPTAPLKIFLTASAEERARRRYNQLKDKGLGANLAALSLEIAERDRRDANRPVAPLRSAADAVVLDSTALTIDEVVAKVLELAAARFGTNCSGESDESAMTPGP

Samples

Sample ID Description Type Environment
1 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
151 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
152 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
156 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
172 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
179 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
180 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
181 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
182 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
183 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
184 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
185 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
186 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
194 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
237 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
238 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
239 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
240 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
241 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
245 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
259 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
260 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
261 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
262 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
263 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.93
Nodule 0.23
Rhizoplane 3.7
Rhizosphere 90.99
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495583_0084875 3300046506 Bacteria 1371
2 Ga0065704_10001574 3300005289 Bacteria 9012
3 Ga0065707_10083000 3300005295 Bacteria 10931
4 Ga0070676_10030313 3300005328 Bacteria 3084
5 Ga0070683_100121694 3300005329 Bacteria 2466
6 Ga0070683_100486656 3300005329 Bacteria 1178
7 Ga0070683_100669552 3300005329 Bacteria 994
8 Ga0070670_100004055 3300005331 Bacteria 12233
9 Ga0070670_100057682 3300005331 Bacteria 3332
10 Ga0070670_100094403 3300005331 Bacteria 2573
11 Ga0068869_100028552 3300005334 Bacteria 3900
12 Ga0068869_100110918 3300005334 Bacteria 2087
13 Ga0070666_10009736 3300005335 Bacteria 6004
14 Ga0070680_100025672 3300005336 Bacteria 4710
15 Ga0070680_100032804 3300005336 Bacteria 4181
16 Ga0070680_100567084 3300005336 Bacteria 974
17 Ga0070682_100078734 3300005337 Bacteria 2127
18 Ga0070682_100194597 3300005337 Bacteria 1426
19 Ga0068868_100001932 3300005338 Bacteria 14232
20 Ga0070689_100000509 3300005340 Bacteria 22964
21 Ga0070689_100029275 3300005340 Bacteria 4167
22 Ga0070691_10125688 3300005341 Bacteria 1295
23 Ga0070687_100021739 3300005343 Bacteria 3021
24 Ga0070661_100004656 3300005344 Bacteria 9448
25 Ga0070661_100383142 3300005344 Bacteria 1109
26 Ga0070692_10141793 3300005345 Bacteria 1361
27 Ga0070692_10301239 3300005345 Bacteria 979
28 Ga0070668_100011369 3300005347 Bacteria 6630
29 Ga0070668_100011721 3300005347 Bacteria 6526
30 Ga0070669_100139871 3300005353 Bacteria 1865
31 Ga0070675_100000139 3300005354 Bacteria 43853
32 Ga0070675_100009664 3300005354 Bacteria 7508
33 Ga0070675_100257669 3300005354 Bacteria 1528
34 Ga0070671_100010215 3300005355 Bacteria 7537
35 Ga0070671_100013221 3300005355 Bacteria 6649
36 Ga0070671_100066649 3300005355 Bacteria 3001
37 Ga0070674_100113757 3300005356 Bacteria 1992
38 Ga0070674_100151234 3300005356 Bacteria 1752
39 Ga0070673_100008271 3300005364 Bacteria 6910
40 Ga0070673_100078996 3300005364 Bacteria 2663
41 Ga0070688_100097964 3300005365 Bacteria 1928
42 Ga0070659_100245908 3300005366 Bacteria 1482
43 Ga0070667_100017036 3300005367 Bacteria 6017
44 Ga0070711_100483460 3300005439 Bacteria 1018
45 Ga0070705_100050756 3300005440 Bacteria 2415
46 Ga0070705_100054359 3300005440 Bacteria 2348
47 Ga0070700_100010490 3300005441 Bacteria 5118
48 Ga0070700_100232557 3300005441 Bacteria 1313
49 Ga0070700_100305003 3300005441 Bacteria 1164
50 Ga0070663_100157545 3300005455 Bacteria 1746
51 Ga0070663_100344871 3300005455 Bacteria 1204
52 Ga0070663_100605440 3300005455 Unclassified 922
53 Ga0070678_100060227 3300005456 Bacteria 2793
54 Ga0070662_100059963 3300005457 Bacteria 2773
55 Ga0070681_10247947 3300005458 Bacteria 1694
56 Ga0070681_10314744 3300005458 Bacteria 1475
57 Ga0068867_100077481 3300005459 Bacteria 2498
58 Ga0070706_100294401 3300005467 Bacteria 1515
59 Ga0070679_100273489 3300005530 Bacteria 1643
60 Ga0070684_100024241 3300005535 Bacteria 5087
61 Ga0070684_100124195 3300005535 Bacteria 2324
62 Ga0070697_100001631 3300005536 Bacteria 17092
63 Ga0068853_100366741 3300005539 Bacteria 1343
64 Ga0070672_100015640 3300005543 Bacteria 5412
65 Ga0070672_100200258 3300005543 Bacteria 1670
66 Ga0070672_100413433 3300005543 Bacteria 1158
67 Ga0070686_100070506 3300005544 Bacteria 2286
68 Ga0070695_100002214 3300005545 Bacteria 11144
69 Ga0070695_100034297 3300005545 Bacteria 3181
70 Ga0070696_100092534 3300005546 Bacteria 2155
71 Ga0070693_100268387 3300005547 Bacteria 1138
72 Ga0070665_100004473 3300005548 Bacteria 14685
73 Ga0070665_100118337 3300005548 Bacteria 2651
74 Ga0070665_100816098 3300005548 Bacteria 946
75 Ga0070704_100103611 3300005549 Bacteria 2150
76 Ga0070704_100114505 3300005549 Bacteria 2058
77 Ga0070704_100254639 3300005549 Bacteria 1443
78 Ga0070664_100000585 3300005564 Bacteria 27773
79 Ga0070664_100004247 3300005564 Bacteria 11523
80 Ga0068854_100134879 3300005578 Bacteria 1889
81 Ga0070702_100010032 3300005615 Bacteria 4652
82 Ga0070702_100013200 3300005615 Bacteria 4164
83 Ga0068852_100355864 3300005616 Bacteria 1431
84 Ga0068859_100006281 3300005617 Bacteria 12057
85 Ga0068859_100040768 3300005617 Bacteria 4662
86 Ga0068864_100002385 3300005618 Bacteria 15526
87 Ga0068864_100016468 3300005618 Bacteria 6153
88 Ga0068864_100039469 3300005618 Bacteria 4036
89 Ga0068866_10120090 3300005718 Bacteria 1480
90 Ga0068861_100009443 3300005719 Bacteria 6735
91 Ga0068861_100060717 3300005719 Bacteria 2899
92 Ga0068861_100087267 3300005719 Bacteria 2455
93 Ga0068861_100125242 3300005719 Bacteria 2078
94 Ga0068870_10054981 3300005840 Bacteria 2119
95 Ga0068870_10341518 3300005840 Bacteria 958
96 Ga0068863_100001178 3300005841 Bacteria 26137
97 Ga0068863_100013555 3300005841 Bacteria 7865
98 Ga0068863_100226181 3300005841 Bacteria 1803
99 Ga0068858_100004429 3300005842 Bacteria 13775
100 Ga0068858_100014809 3300005842 Bacteria 7338
101 Ga0068860_100020030 3300005843 Bacteria 6482
102 Ga0068860_100105925 3300005843 Bacteria 2685
103 Ga0068860_100175888 3300005843 Bacteria 2069
104 Ga0068862_100000707 3300005844 Bacteria 34098
105 Ga0070715_10066745 3300006163 Bacteria 1596
106 Ga0070716_100189002 3300006173 Bacteria 1359
107 Ga0075362_10002026 3300006177 Bacteria 6670
108 Ga0075367_10048989 3300006178 Bacteria 2490
109 Ga0068871_100073153 3300006358 Bacteria 2825
110 Ga0068871_100090581 3300006358 Bacteria 2547
111 Ga0075428_100168398 3300006844 Bacteria 2376
112 Ga0075428_100428290 3300006844 Bacteria 1418
113 Ga0075428_100921025 3300006844 Bacteria 927
114 Ga0075430_100013189 3300006846 Bacteria 7041
115 Ga0075430_100099091 3300006846 Bacteria 2434
116 Ga0075431_100000938 3300006847 Bacteria 25747
117 Ga0075431_100003513 3300006847 Bacteria 15182
118 Ga0075431_100039026 3300006847 Bacteria 4891
119 Ga0075431_100148537 3300006847 Bacteria 2414
120 Ga0075434_100396708 3300006871 Bacteria 1400
121 Ga0075434_100939353 3300006871 Bacteria 879
122 Ga0075429_100006127 3300006880 Bacteria 10395
123 Ga0075429_100044479 3300006880 Bacteria 3862
124 Ga0075429_100081425 3300006880 Bacteria 2823
125 Ga0068865_100116553 3300006881 Bacteria 1979
126 Ga0068865_100472462 3300006881 Bacteria 1041
127 Ga0075436_100008836 3300006914 Bacteria 6889
128 Ga0097620_100006281 3300006931 Bacteria 12057
129 Ga0097620_100040769 3300006931 Bacteria 4662
130 Ga0075435_100043513 3300007076 Bacteria 3595
131 Ga0099794_10137021 3300007265 Bacteria 1238
132 Ga0105250_10143789 3300009092 Bacteria 990
133 Ga0105240_11256613 3300009093 Bacteria 782
134 Ga0111539_10049296 3300009094 Bacteria 5023
135 Ga0111539_10189180 3300009094 Bacteria 2402
136 Ga0111539_10241831 3300009094 Bacteria 2101
137 Ga0105245_10001944 3300009098 Bacteria 18766
138 Ga0105247_10045738 3300009101 Bacteria 2686
139 Ga0105247_10136560 3300009101 Bacteria 1603
140 Ga0105247_10182015 3300009101 Bacteria 1403
141 Ga0114129_10002722 3300009147 Bacteria 24631
142 Ga0114129_10004060 3300009147 Bacteria 20667
143 Ga0114129_10641288 3300009147 Bacteria 1372
144 Ga0105243_10530377 3300009148 Bacteria 1121
145 Ga0105242_10544537 3300009176 Bacteria 1112
146 Ga0105248_10009220 3300009177 Bacteria 10855
147 Ga0105248_10103746 3300009177 Bacteria 3205
148 Ga0105248_10291584 3300009177 Bacteria 1837
149 Ga0105237_10235926 3300009545 Bacteria 1830
150 Ga0105237_10246019 3300009545 Bacteria 1790
151 Ga0105238_10142132 3300009551 Bacteria 2376
152 Ga0105249_10147503 3300009553 Bacteria 2262
153 Ga0105249_10362487 3300009553 Bacteria 1471
154 Ga0105249_10621407 3300009553 Bacteria 1136
155 Ga0105249_11343858 3300009553 Bacteria 786
156 Ga0105239_10033072 3300010375 Bacteria 5680
157 Ga0105239_10231070 3300010375 Bacteria 2075
158 Ga0105239_11319700 3300010375 Bacteria 832
159 Ga0105246_10028423 3300011119 Bacteria 3673
160 Ga0157374_10005133 3300013296 Bacteria 10982
161 Ga0163162_10006973 3300013306 Bacteria 10957
162 Ga0163162_10421484 3300013306 Bacteria 1467
163 Ga0157372_10108359 3300013307 Bacteria 3179
164 Ga0157372_10113944 3300013307 Bacteria 3099
165 Ga0157375_10242164 3300013308 Bacteria 1963
166 Ga0157375_10751668 3300013308 Bacteria 1126
167 Ga0163163_10004084 3300014325 Bacteria 12449
168 Ga0163163_10015972 3300014325 Bacteria 6958
169 Ga0163163_10035246 3300014325 Bacteria 4853
170 Ga0157380_10062055 3300014326 Bacteria 2993
171 Ga0157380_10245260 3300014326 Bacteria 1618
172 Ga0157377_10109203 3300014745 Bacteria 1660
173 Ga0157377_10222330 3300014745 Bacteria 1209
174 Ga0157376_10014190 3300014969 Bacteria 5970
175 Ga0157376_10326676 3300014969 Bacteria 1460
176 Ga0163161_10032366 3300017792 Bacteria 3733
177 Ga0209258_101988 3300025242 Bacteria 5927
178 Ga0207682_10015630 3300025893 Bacteria 2956
179 Ga0207710_10034068 3300025900 Bacteria 2236
180 Ga0207710_10130512 3300025900 Bacteria 1207
181 Ga0207688_10076315 3300025901 Bacteria 1908
182 Ga0207680_10031275 3300025903 Bacteria 3014
183 Ga0207685_10012326 3300025905 Bacteria 2604
184 Ga0207645_10014836 3300025907 Bacteria 5199
185 Ga0207645_10226122 3300025907 Bacteria 1234
186 Ga0207643_10011710 3300025908 Bacteria 4739
187 Ga0207643_10055515 3300025908 Bacteria 2252
188 Ga0207643_10258493 3300025908 Bacteria 1075
189 Ga0207707_10189901 3300025912 Bacteria 1792
190 Ga0207707_10637209 3300025912 Bacteria 899
191 Ga0207671_10145793 3300025914 Bacteria 1826
192 Ga0207671_10554063 3300025914 Bacteria 916
193 Ga0207660_10076280 3300025917 Bacteria 2451
194 Ga0207662_10034123 3300025918 Bacteria 2970
195 Ga0207657_10463157 3300025919 Bacteria 994
196 Ga0207649_10062609 3300025920 Bacteria 2346
197 Ga0207649_10117405 3300025920 Bacteria 1788
198 Ga0207652_10020985 3300025921 Bacteria 5387
199 Ga0207694_10189206 3300025924 Bacteria 1671
200 Ga0207650_10035885 3300025925 Bacteria 3604
201 Ga0207687_10021120 3300025927 Bacteria 4322
202 Ga0207644_10065241 3300025931 Bacteria 2647
203 Ga0207644_10147388 3300025931 Bacteria 1818
204 Ga0207706_10053706 3300025933 Bacteria 3556
205 Ga0207686_10503955 3300025934 Bacteria 940
206 Ga0207709_10377483 3300025935 Bacteria 1078
207 Ga0207670_10001481 3300025936 Bacteria 12331
208 Ga0207670_10036841 3300025936 Bacteria 3184
209 Ga0207669_10022215 3300025937 Bacteria 3366
210 Ga0207669_10045563 3300025937 Bacteria 2585
211 Ga0207704_10045567 3300025938 Bacteria 2606
212 Ga0207665_10028412 3300025939 Bacteria 3694
213 Ga0207691_10019835 3300025940 Bacteria 6360
214 Ga0207691_10088886 3300025940 Bacteria 2771
215 Ga0207691_10290801 3300025940 Bacteria 1405
216 Ga0207711_10011326 3300025941 Bacteria 7409
217 Ga0207711_10030955 3300025941 Bacteria 4514
218 Ga0207689_10028547 3300025942 Bacteria 4667
219 Ga0207661_10286588 3300025944 Bacteria 1473
220 Ga0207679_10000656 3300025945 Bacteria 23166
221 Ga0207679_10068179 3300025945 Bacteria 2672
222 Ga0207679_10237830 3300025945 Bacteria 1541
223 Ga0207651_10009962 3300025960 Bacteria 5238
224 Ga0207651_10039827 3300025960 Bacteria 3102
225 Ga0207712_10170649 3300025961 Bacteria 1700
226 Ga0207712_10843136 3300025961 Bacteria 807
227 Ga0207668_10001362 3300025972 Bacteria 14434
228 Ga0207658_10018034 3300025986 Bacteria 4867
229 Ga0207658_10096027 3300025986 Bacteria 2311
230 Ga0207677_10004570 3300026023 Bacteria 7441
231 Ga0207677_10014385 3300026023 Bacteria 4619
232 Ga0207703_10039466 3300026035 Bacteria 3773
233 Ga0207703_10073373 3300026035 Bacteria 2831
234 Ga0207639_10326414 3300026041 Bacteria 1364
235 Ga0207678_10060585 3300026067 Bacteria 3255
236 Ga0207678_10619135 3300026067 Bacteria 950
237 Ga0207708_10044154 3300026075 Bacteria 3396
238 Ga0207708_10230432 3300026075 Bacteria 1487
239 Ga0207641_10033871 3300026088 Bacteria 4245
240 Ga0207641_10112585 3300026088 Bacteria 2415
241 Ga0207648_10014770 3300026089 Bacteria 7204
242 Ga0207676_10004599 3300026095 Bacteria 9772
243 Ga0207676_10009011 3300026095 Bacteria 7102
244 Ga0207676_10050360 3300026095 Bacteria 3247
245 Ga0207674_10105072 3300026116 Bacteria 2802
246 Ga0207675_100009531 3300026118 Bacteria 9080
247 Ga0207675_100018139 3300026118 Bacteria 6562
248 Ga0207675_100118569 3300026118 Bacteria 2503
249 Ga0207683_10005258 3300026121 Bacteria 11110
250 Ga0207683_10038849 3300026121 Bacteria 4151
251 Ga0207698_10193387 3300026142 Bacteria 1815
252 Ga0207698_10321348 3300026142 Bacteria 1450
253 Ga0209282_1130270 3300027666 Bacteria 1244
254 Ga0207428_10002056 3300027907 Bacteria 20304
255 Ga0265356_1000953 3300028017 Bacteria 4644
256 Ga0268266_10053092 3300028379 Bacteria 3481
257 Ga0268266_10071344 3300028379 Bacteria 3010
258 Ga0268266_10123975 3300028379 Bacteria 2303
259 Ga0268266_10243243 3300028379 Bacteria 1661
260 Ga0268266_10246003 3300028379 Bacteria 1652
261 Ga0268265_10001803 3300028380 Bacteria 17141
262 Ga0268265_10008677 3300028380 Bacteria 6870
263 Ga0268265_10035768 3300028380 Bacteria 3632
264 Ga0268264_10019528 3300028381 Bacteria 5536
265 Ga0268264_10031481 3300028381 Bacteria 4348
266 Ga0268264_10077459 3300028381 Bacteria 2832
267 Ga0265328_10074726 3300031239 Bacteria 1247
268 Ga0265320_10076680 3300031240 Bacteria 1566
269 Ga0265316_10212814 3300031344 Bacteria 1429
270 Ga0307509_10001782 3300031507 Bacteria 35739
271 Ga0307408_100186266 3300031548 Bacteria 1669
272 Ga0307408_100367694 3300031548 Bacteria 1225
273 Ga0307408_100902707 3300031548 Bacteria 809
274 Ga0316575_10042443 3300031665 Bacteria 1801
275 Ga0316575_10048859 3300031665 Bacteria 1683
276 Ga0316575_10062520 3300031665 Bacteria 1489
277 Ga0316578_10149727 3300031728 Bacteria 1406
278 Ga0307516_10380067 3300031730 Bacteria 1074
279 Ga0307405_10804757 3300031731 Bacteria 788
280 Ga0307413_10011950 3300031824 Bacteria 4297
281 Ga0307413_10097143 3300031824 Bacteria 1936
282 Ga0307413_10329918 3300031824 Bacteria 1169
283 Ga0307413_10685476 3300031824 Bacteria 849
284 Ga0307410_10025962 3300031852 Bacteria 3681
285 Ga0307410_10191040 3300031852 Bacteria 1557
286 Ga0307407_10020798 3300031903 Bacteria 3370
287 Ga0307407_10141220 3300031903 Bacteria 1554
288 Ga0307407_10292324 3300031903 Bacteria 1133
289 Ga0307407_10320861 3300031903 Bacteria 1087
290 Ga0307409_100017692 3300031995 Bacteria 4761
291 Ga0307409_100045073 3300031995 Bacteria 3327
292 Ga0307409_100115151 3300031995 Bacteria 2263
293 Ga0307416_100004425 3300032002 Bacteria 8469
294 Ga0307414_10083418 3300032004 Bacteria 2347
295 Ga0307414_10200945 3300032004 Bacteria 1621
296 Ga0307414_10366597 3300032004 Bacteria 1241
297 Ga0307411_10226030 3300032005 Bacteria 1455
298 Ga0307415_100585611 3300032126 Bacteria 990
299 Ga0373954_0079082 3300035118 Bacteria 1570
300 Ga0373956_0078974 3300035119 Unclassified 1508
301 Ga0373957_0224525 3300035120 Bacteria 787
302 Ga0373955_0416480 3300035172 Bacteria 817
303 Ga0373942_0034318 3300035207 Bacteria 1357
304 Ga0316574_0125606 3300035398 Bacteria 1649
305 Ga0373931_0063380 3300035691 Bacteria 1998
306 Ga0373931_0249846 3300035691 Bacteria 1078
307 Ga0373933_0143645 3300035724 Bacteria 1508
308 Ga0373937_0037248 3300036401 Bacteria 4432
309 Ga0373937_0303243 3300036401 Bacteria 1510
310 Ga0436365_0868875 3300039437 Bacteria 2613
311 Ga0451853_3406862 3300041512 Bacteria 1360
312 Ga0439442_008201 3300042002 Bacteria 2109
313 Ga0439448_0016040 3300042005 Bacteria 2276
314 Ga0439455_0054735 3300042012 Bacteria 1048
315 Ga0450914_001601 3300042118 Bacteria 1461
316 Ga0450888_005862 3300042126 Bacteria 1322
317 Ga0450897_018945 3300042128 Bacteria 725
318 Ga0439435_0150920 3300042436 Bacteria 745
319 Ga0439444_0045983 3300042437 Bacteria 873
320 Ga0450918_008135 3300042531 Bacteria 1846
321 Ga0451577_0040235 3300042876 Bacteria 4197
322 Ga0451577_0241227 3300042876 Bacteria 1635
323 Ga0451576_0059650 3300045051 Bacteria 3982
324 Ga0495603_0080960 3300046455 Bacteria 1903
325 Ga0495638_0001328 3300046460 Bacteria 22737
326 Ga0495638_0038204 3300046460 Bacteria 3053
327 Ga0495641_0128544 3300046461 Bacteria 1131
328 Ga0495651_0240363 3300046462 Bacteria 1242
329 Ga0495650_0024862 3300046471 Bacteria 2821
330 Ga0495639_0081503 3300046475 Bacteria 1508
331 Ga0495608_0402861 3300046511 Bacteria 836
332 Ga0495616_0167956 3300046513 Bacteria 983
333 Ga0495630_0160652 3300046517 Bacteria 1711
334 Ga0495632_0205861 3300046519 Bacteria 894
335 Ga0495652_0285641 3300046529 Bacteria 1206
336 Ga0495622_0113658 3300046557 Bacteria 1239
337 Ga0495667_0233704 3300046559 Bacteria 1172
338 Ga0495634_0097571 3300046642 Bacteria 1902
339 Ga0495611_0054301 3300046648 Bacteria 1811
340 Ga0495625_0016351 3300046660 Bacteria 5842
341 Ga0495623_0111232 3300046679 Bacteria 1660
342 Ga0495658_0180937 3300046683 Bacteria 1308
343 Ga0495672_0142224 3300047320 Bacteria 1252
344 Ga0495675_0279501 3300047444 Bacteria 996
345 Ga0496102_0137493 3300048905 Bacteria 2290
346 Ga0496104_0065115 3300048907 Bacteria 3458
347 Ga0496104_0450750 3300048907 Bacteria 1198
348 Ga0496106_0042218 3300048909 Bacteria 3420
349 Ga0496106_0100776 3300048909 Bacteria 2240
350 Ga0496108_0030679 3300048911 Bacteria 4455
351 Ga0496108_0507224 3300048911 Bacteria 1053
352 Ga0496109_0023875 3300048912 Bacteria 5429
353 Ga0496111_0461950 3300048914 Bacteria 936
354 Ga0496112_0011793 3300048915 Bacteria 8001
355 Ga0496112_0050183 3300048915 Bacteria 4091
356 Ga0496113_0025736 3300048916 Bacteria 4199
357 Ga0496113_0071287 3300048916 Bacteria 2643
358 Ga0496114_0002607 3300048917 Bacteria 13767
359 Ga0496114_0529463 3300048917 Bacteria 1042
360 Ga0496115_0218461 3300048918 Bacteria 1573
361 Ga0496121_0034169 3300048924 Bacteria 4581
362 Ga0501299_023124 3300049522 Bacteria 1151
363 Ga0501031_0239226 3300049568 Bacteria 1180
364 Ga0501033_0472423 3300049570 Bacteria 869
365 Ga0501036_0110282 3300049572 Bacteria 2325
366 Ga0501038_0133286 3300049574 Bacteria 2037
367 Ga0501038_0406856 3300049574 Bacteria 1052
368 Ga0501039_0175213 3300049575 Bacteria 1687
369 Ga0501039_0195944 3300049575 Bacteria 1588
370 Ga0501039_0322169 3300049575 Bacteria 1215
371 Ga0501040_0000159 3300049576 Bacteria 37483
372 Ga0501040_0016892 3300049576 Bacteria 4837
373 Ga0501040_0134435 3300049576 Bacteria 1740
374 Ga0501042_0001075 3300049578 Bacteria 15655
375 Ga0501042_0043633 3300049578 Bacteria 3193
376 Ga0501043_0253548 3300049579 Bacteria 1355
377 Ga0501046_0040601 3300049580 Bacteria 3717
378 Ga0501046_0042392 3300049580 Bacteria 3629
379 Ga0501047_0782901 3300049581 Bacteria 769
380 Ga0501069_0038876 3300049585 Bacteria 2627
381 Ga0501070_0045177 3300049586 Bacteria 3664
382 Ga0501070_0129459 3300049586 Bacteria 2085
383 Ga0501071_0030469 3300049587 Bacteria 3816
384 Ga0501072_0080005 3300049588 Bacteria 2588
385 Ga0501074_0086884 3300049590 Bacteria 2240
386 Ga0501075_0076035 3300049591 Bacteria 2539
387 Ga0501076_0584031 3300049592 Bacteria 921
388 Ga0501077_0180406 3300049593 Bacteria 1342
389 Ga0501079_0091687 3300049741 Bacteria 2354
390 Ga0501079_0599672 3300049741 Bacteria 867
391 Ga0501081_0064167 3300049743 Bacteria 2550
392 Ga0501268_059262 3300049765 Bacteria 756
393 Ga0501035_0320465 3300049822 Bacteria 1302
394 Ga0501044_0541035 3300049823 Bacteria 1063
395 nmdc:mga03683_4813_c1 3300050489 Bacteria 4508
396 nmdc:mga00v17_127573_c1 3300050491 Bacteria 1624
397 nmdc:mga0k408_21896_c1 3300050493 Bacteria 3594
398 nmdc:mga0k408_26531_c1 3300050493 Bacteria 3285
399 nmdc:mga0k408_266265_c1 3300050493 Bacteria 1023
400 nmdc:mga06z11_110988_c1 3300050494 Bacteria 1518
401 nmdc:mga05p37_15516_c1 3300050507 Bacteria 9157
402 nmdc:mga05p37_60449_c1 3300050507 Bacteria 4666
403 nmdc:mga09592_102586_c1 3300050508 Bacteria 2451
404 nmdc:mga09592_147978_c1 3300050508 Bacteria 2025
405 nmdc:mga09592_57296_c1 3300050508 Bacteria 3293
406 nmdc:mga0qj67_189706_c1 3300050509 Bacteria 1670
407 nmdc:mga0qj67_19606_c1 3300050509 Bacteria 5169
408 nmdc:mga0qj67_36839_c1 3300050509 Bacteria 3829
409 nmdc:mga06r32_25654_c1 3300050510 Bacteria 5486
410 nmdc:mga06r32_389078_c1 3300050510 Bacteria 1377
411 nmdc:mga06r32_496540_c1 3300050510 Bacteria 1198
412 nmdc:mga06r32_565_c1 3300050510 Bacteria 32242
413 nmdc:mga08y16_163472_c1 3300050511 Bacteria 2313
414 nmdc:mga08y16_92730_c1 3300050511 Bacteria 3147
415 nmdc:mga0n895_1051604_c1 3300050512 Bacteria 793
416 nmdc:mga0n895_238911_c1 3300050512 Bacteria 1843
417 nmdc:mga0rr50_28846_c1 3300050513 Bacteria 3906
418 nmdc:mga08x19_18_c1 3300050514 Bacteria 321445
419 nmdc:mga0a205_642694_c1 3300050515 Bacteria 912
420 Ga0495601_0017033 3300053077 Bacteria 4408
421 Ga0495601_0185891 3300053077 Bacteria 1358
422 Ga0500650_0000143 3300053098 Bacteria 18700
423 Ga0500556_0000208 3300053104 Bacteria 48224
424 Ga0500556_0036971 3300053104 Bacteria 1697
425 Ga0500556_0057351 3300053104 Bacteria 1425
426 Ga0500562_029027 3300053108 Bacteria 1455
427 Ga0500652_054538 3300053131 Bacteria 1637
428 Ga0500658_0087809 3300053134 Bacteria 1340
429 Ga0500627_0042216 3300053158 Bacteria 1963
430 Ga0501084_0121177 3300054114 Bacteria 2199
431 Ga0501084_0275080 3300054114 Bacteria 1422
432 Ga0501082_0350759 3300060353 Bacteria 1286
433 Ga0530510_0024017 3300061734 Bacteria 4348
434 Ga0495583_0084875
435 Ga0065704_10001574
436 Ga0065707_10083000
437 Ga0070676_10030313
438 Ga0070683_100121694
439 Ga0070683_100486656
440 Ga0070683_100669552
441 Ga0070670_100004055
442 Ga0070670_100057682
443 Ga0070670_100094403
444 Ga0068869_100028552
445 Ga0068869_100110918
446 Ga0070666_10009736
447 Ga0070680_100025672
448 Ga0070680_100032804
449 Ga0070680_100567084
450 Ga0070682_100078734
451 Ga0070682_100194597
452 Ga0068868_100001932
453 Ga0070689_100000509
454 Ga0070689_100029275
455 Ga0070691_10125688
456 Ga0070687_100021739
457 Ga0070661_100004656
458 Ga0070661_100383142
459 Ga0070692_10141793
460 Ga0070692_10301239
461 Ga0070668_100011369
462 Ga0070668_100011721
463 Ga0070669_100139871
464 Ga0070675_100000139
465 Ga0070675_100009664
466 Ga0070675_100257669
467 Ga0070671_100010215
468 Ga0070671_100013221
469 Ga0070671_100066649
470 Ga0070674_100113757
471 Ga0070674_100151234
472 Ga0070673_100008271
473 Ga0070673_100078996
474 Ga0070688_100097964
475 Ga0070659_100245908
476 Ga0070667_100017036
477 Ga0070711_100483460
478 Ga0070705_100050756
479 Ga0070705_100054359
480 Ga0070700_100010490
481 Ga0070700_100232557
482 Ga0070700_100305003
483 Ga0070663_100157545
484 Ga0070663_100344871
485 Ga0070663_100605440
486 Ga0070678_100060227
487 Ga0070662_100059963
488 Ga0070681_10247947
489 Ga0070681_10314744
490 Ga0068867_100077481
491 Ga0070706_100294401
492 Ga0070679_100273489
493 Ga0070684_100024241
494 Ga0070684_100124195
495 Ga0070697_100001631
496 Ga0068853_100366741
497 Ga0070672_100015640
498 Ga0070672_100200258
499 Ga0070672_100413433
500 Ga0070686_100070506
501 Ga0070695_100002214
502 Ga0070695_100034297
503 Ga0070696_100092534
504 Ga0070693_100268387
505 Ga0070665_100004473
506 Ga0070665_100118337
507 Ga0070665_100816098
508 Ga0070704_100103611
509 Ga0070704_100114505
510 Ga0070704_100254639
511 Ga0070664_100000585
512 Ga0070664_100004247
513 Ga0068854_100134879
514 Ga0070702_100010032
515 Ga0070702_100013200
516 Ga0068852_100355864
517 Ga0068859_100006281
518 Ga0068859_100040768
519 Ga0068864_100002385
520 Ga0068864_100016468
521 Ga0068864_100039469
522 Ga0068866_10120090
523 Ga0068861_100009443
524 Ga0068861_100060717
525 Ga0068861_100087267
526 Ga0068861_100125242
527 Ga0068870_10054981
528 Ga0068870_10341518
529 Ga0068863_100001178
530 Ga0068863_100013555
531 Ga0068863_100226181
532 Ga0068858_100004429
533 Ga0068858_100014809
534 Ga0068860_100020030
535 Ga0068860_100105925
536 Ga0068860_100175888
537 Ga0068862_100000707
538 Ga0070715_10066745
539 Ga0070716_100189002
540 Ga0075362_10002026
541 Ga0075367_10048989
542 Ga0068871_100073153
543 Ga0068871_100090581
544 Ga0075428_100168398
545 Ga0075428_100428290
546 Ga0075428_100921025
547 Ga0075430_100013189
548 Ga0075430_100099091
549 Ga0075431_100000938
550 Ga0075431_100003513
551 Ga0075431_100039026
552 Ga0075431_100148537
553 Ga0075434_100396708
554 Ga0075434_100939353
555 Ga0075429_100006127
556 Ga0075429_100044479
557 Ga0075429_100081425
558 Ga0068865_100116553
559 Ga0068865_100472462
560 Ga0075436_100008836
561 Ga0097620_100006281
562 Ga0097620_100040769
563 Ga0075435_100043513
564 Ga0099794_10137021
565 Ga0105250_10143789
566 Ga0105240_11256613
567 Ga0111539_10049296
568 Ga0111539_10189180
569 Ga0111539_10241831
570 Ga0105245_10001944
571 Ga0105247_10045738
572 Ga0105247_10136560
573 Ga0105247_10182015
574 Ga0114129_10002722
575 Ga0114129_10004060
576 Ga0114129_10641288
577 Ga0105243_10530377
578 Ga0105242_10544537
579 Ga0105248_10009220
580 Ga0105248_10103746
581 Ga0105248_10291584
582 Ga0105237_10235926
583 Ga0105237_10246019
584 Ga0105238_10142132
585 Ga0105249_10147503
586 Ga0105249_10362487
587 Ga0105249_10621407
588 Ga0105249_11343858
589 Ga0105239_10033072
590 Ga0105239_10231070
591 Ga0105239_11319700
592 Ga0105246_10028423
593 Ga0157374_10005133
594 Ga0163162_10006973
595 Ga0163162_10421484
596 Ga0157372_10108359
597 Ga0157372_10113944
598 Ga0157375_10242164
599 Ga0157375_10751668
600 Ga0163163_10004084
601 Ga0163163_10015972
602 Ga0163163_10035246
603 Ga0157380_10062055
604 Ga0157380_10245260
605 Ga0157377_10109203
606 Ga0157377_10222330
607 Ga0157376_10014190
608 Ga0157376_10326676
609 Ga0163161_10032366
610 Ga0209258_101988
611 Ga0207682_10015630
612 Ga0207710_10034068
613 Ga0207710_10130512
614 Ga0207688_10076315
615 Ga0207680_10031275
616 Ga0207685_10012326
617 Ga0207645_10014836
618 Ga0207645_10226122
619 Ga0207643_10011710
620 Ga0207643_10055515
621 Ga0207643_10258493
622 Ga0207707_10189901
623 Ga0207707_10637209
624 Ga0207671_10145793
625 Ga0207671_10554063
626 Ga0207660_10076280
627 Ga0207662_10034123
628 Ga0207657_10463157
629 Ga0207649_10062609
630 Ga0207649_10117405
631 Ga0207652_10020985
632 Ga0207694_10189206
633 Ga0207650_10035885
634 Ga0207687_10021120
635 Ga0207644_10065241
636 Ga0207644_10147388
637 Ga0207706_10053706
638 Ga0207686_10503955
639 Ga0207709_10377483
640 Ga0207670_10001481
641 Ga0207670_10036841
642 Ga0207669_10022215
643 Ga0207669_10045563
644 Ga0207704_10045567
645 Ga0207665_10028412
646 Ga0207691_10019835
647 Ga0207691_10088886
648 Ga0207691_10290801
649 Ga0207711_10011326
650 Ga0207711_10030955
651 Ga0207689_10028547
652 Ga0207661_10286588
653 Ga0207679_10000656
654 Ga0207679_10068179
655 Ga0207679_10237830
656 Ga0207651_10009962
657 Ga0207651_10039827
658 Ga0207712_10170649
659 Ga0207712_10843136
660 Ga0207668_10001362
661 Ga0207658_10018034
662 Ga0207658_10096027
663 Ga0207677_10004570
664 Ga0207677_10014385
665 Ga0207703_10039466
666 Ga0207703_10073373
667 Ga0207639_10326414
668 Ga0207678_10060585
669 Ga0207678_10619135
670 Ga0207708_10044154
671 Ga0207708_10230432
672 Ga0207641_10033871
673 Ga0207641_10112585
674 Ga0207648_10014770
675 Ga0207676_10004599
676 Ga0207676_10009011
677 Ga0207676_10050360
678 Ga0207674_10105072
679 Ga0207675_100009531
680 Ga0207675_100018139
681 Ga0207675_100118569
682 Ga0207683_10005258
683 Ga0207683_10038849
684 Ga0207698_10193387
685 Ga0207698_10321348
686 Ga0209282_1130270
687 Ga0207428_10002056
688 Ga0265356_1000953
689 Ga0268266_10053092
690 Ga0268266_10071344
691 Ga0268266_10123975
692 Ga0268266_10243243
693 Ga0268266_10246003
694 Ga0268265_10001803
695 Ga0268265_10008677
696 Ga0268265_10035768
697 Ga0268264_10019528
698 Ga0268264_10031481
699 Ga0268264_10077459
700 Ga0265328_10074726
701 Ga0265320_10076680
702 Ga0265316_10212814
703 Ga0307509_10001782
704 Ga0307408_100186266
705 Ga0307408_100367694
706 Ga0307408_100902707
707 Ga0316575_10042443
708 Ga0316575_10048859
709 Ga0316575_10062520
710 Ga0316578_10149727
711 Ga0307516_10380067
712 Ga0307405_10804757
713 Ga0307413_10011950
714 Ga0307413_10097143
715 Ga0307413_10329918
716 Ga0307413_10685476
717 Ga0307410_10025962
718 Ga0307410_10191040
719 Ga0307407_10020798
720 Ga0307407_10141220
721 Ga0307407_10292324
722 Ga0307407_10320861
723 Ga0307409_100017692
724 Ga0307409_100045073
725 Ga0307409_100115151
726 Ga0307416_100004425
727 Ga0307414_10083418
728 Ga0307414_10200945
729 Ga0307414_10366597
730 Ga0307411_10226030
731 Ga0307415_100585611
732 Ga0373954_0079082
733 Ga0373956_0078974
734 Ga0373957_0224525
735 Ga0373955_0416480
736 Ga0373942_0034318
737 Ga0316574_0125606
738 Ga0373931_0063380
739 Ga0373931_0249846
740 Ga0373933_0143645
741 Ga0373937_0037248
742 Ga0373937_0303243
743 Ga0436365_0868875
744 Ga0451853_3406862
745 Ga0439442_008201
746 Ga0439448_0016040
747 Ga0439455_0054735
748 Ga0450914_001601
749 Ga0450888_005862
750 Ga0450897_018945
751 Ga0439435_0150920
752 Ga0439444_0045983
753 Ga0450918_008135
754 Ga0451577_0040235
755 Ga0451577_0241227
756 Ga0451576_0059650
757 Ga0495603_0080960
758 Ga0495638_0001328
759 Ga0495638_0038204
760 Ga0495641_0128544
761 Ga0495651_0240363
762 Ga0495650_0024862
763 Ga0495639_0081503
764 Ga0495608_0402861
765 Ga0495616_0167956
766 Ga0495630_0160652
767 Ga0495632_0205861
768 Ga0495652_0285641
769 Ga0495622_0113658
770 Ga0495667_0233704
771 Ga0495634_0097571
772 Ga0495611_0054301
773 Ga0495625_0016351
774 Ga0495623_0111232
775 Ga0495658_0180937
776 Ga0495672_0142224
777 Ga0495675_0279501
778 Ga0496102_0137493
779 Ga0496104_0065115
780 Ga0496104_0450750
781 Ga0496106_0042218
782 Ga0496106_0100776
783 Ga0496108_0030679
784 Ga0496108_0507224
785 Ga0496109_0023875
786 Ga0496111_0461950
787 Ga0496112_0011793
788 Ga0496112_0050183
789 Ga0496113_0025736
790 Ga0496113_0071287
791 Ga0496114_0002607
792 Ga0496114_0529463
793 Ga0496115_0218461
794 Ga0496121_0034169
795 Ga0501299_023124
796 Ga0501031_0239226
797 Ga0501033_0472423
798 Ga0501036_0110282
799 Ga0501038_0133286
800 Ga0501038_0406856
801 Ga0501039_0175213
802 Ga0501039_0195944
803 Ga0501039_0322169
804 Ga0501040_0000159
805 Ga0501040_0016892
806 Ga0501040_0134435
807 Ga0501042_0001075
808 Ga0501042_0043633
809 Ga0501043_0253548
810 Ga0501046_0040601
811 Ga0501046_0042392
812 Ga0501047_0782901
813 Ga0501069_0038876
814 Ga0501070_0045177
815 Ga0501070_0129459
816 Ga0501071_0030469
817 Ga0501072_0080005
818 Ga0501074_0086884
819 Ga0501075_0076035
820 Ga0501076_0584031
821 Ga0501077_0180406
822 Ga0501079_0091687
823 Ga0501079_0599672
824 Ga0501081_0064167
825 Ga0501268_059262
826 Ga0501035_0320465
827 Ga0501044_0541035
828 nmdc:mga03683_4813_c1
829 nmdc:mga00v17_127573_c1
830 nmdc:mga0k408_21896_c1
831 nmdc:mga0k408_26531_c1
832 nmdc:mga0k408_266265_c1
833 nmdc:mga06z11_110988_c1
834 nmdc:mga05p37_15516_c1
835 nmdc:mga05p37_60449_c1
836 nmdc:mga09592_102586_c1
837 nmdc:mga09592_147978_c1
838 nmdc:mga09592_57296_c1
839 nmdc:mga0qj67_189706_c1
840 nmdc:mga0qj67_19606_c1
841 nmdc:mga0qj67_36839_c1
842 nmdc:mga06r32_25654_c1
843 nmdc:mga06r32_389078_c1
844 nmdc:mga06r32_496540_c1
845 nmdc:mga06r32_565_c1
846 nmdc:mga08y16_163472_c1
847 nmdc:mga08y16_92730_c1
848 nmdc:mga0n895_1051604_c1
849 nmdc:mga0n895_238911_c1
850 nmdc:mga0rr50_28846_c1
851 nmdc:mga08x19_18_c1
852 nmdc:mga0a205_642694_c1
853 Ga0495601_0017033
854 Ga0495601_0185891
855 Ga0500650_0000143
856 Ga0500556_0000208
857 Ga0500556_0036971
858 Ga0500556_0057351
859 Ga0500562_029027
860 Ga0500652_054538
861 Ga0500658_0087809
862 Ga0500627_0042216
863 Ga0501084_0121177
864 Ga0501084_0275080
865 Ga0501082_0350759
866 Ga0530510_0024017

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02224

Cytidylate_kin

Cytidylate kinase

19

234

0.99

PF13189

Cytidylate_kin2

Cytidylate kinase-like family

18

203

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e22-assembly1.cif.gz_A structure of cytidine monophosphate kinase from yersinia pseudotuberculosis 0.9538 2 222
2fem-assembly1.cif.gz_A mutant r188m of the cytidine monophosphate kinase from e. coli 0.9358 1 222
1cke-assembly1.cif.gz_A cmp kinase from escherichia coli free enzyme structure 0.9334 1 222
4e22-assembly1.cif.gz_A structure of cytidine monophosphate kinase from yersinia pseudotuberculosis 0.9279 2 222
1kdt-assembly1.cif.gz_A cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate 0.9156 1 222
ID Description Score Start End Superfamily
2femA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9358 1 222 3.40.50.300
2femA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9148 1 222 3.40.50.300
2h92C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8663 1 220 3.40.50.300
4dieB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8654 3 221 3.40.50.300
af_Q2FYF5_1_183_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8619 37 221 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A419GEG6-F1-model_v4 (d)CMP kinase (EC 2.7.4.25) 0.9875 128 220 GO:0004127
GO:0005524
AF-A0A7C4IRL3-F1-model_v4 (d)CMP kinase (EC 2.7.4.25) 0.9836 128 221 GO:0004127
GO:0005524
AF-G2J7B7-F1-model_v4 (d)CMP kinase (EC 2.7.4.25) 0.9821 95 221 GO:0005524
GO:0036430
GO:0036431
AF-A0A3C0M2F0-F1-model_v4 deleted 0.9806 114 221
AF-A0A7V4KEW4-F1-model_v4 (d)CMP kinase (EC 2.7.4.25) 0.9801 139 221 GO:0004127
GO:0005524

Map