F442907

General Info

Members Datasets Scaffolds Average Seq Length
433 210 866 183

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0039086|Ga0466960_0039086_234_842
Length 202
Sequence MTQDTIVALSVLGVIGQVLVGMGILVGLLALAGVRGPLDAIRNLLWGYELWGAFVVASIATGGSLFYSQIAPFIPCEFCWFQRVLMYPLSILTLFLAARGDNRAARYLLPLPVVGAGTSIYHMLIERGVIEEPKACLISAPGGCGTNWIANHSFGYLTIPTLALTAFLLLIGFLVLASSGESDSTATLPAHAERQEGKTAEA

Samples

Sample ID Description Type Environment
1 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
99 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
102 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
114 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
115 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
136 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
137 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
146 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
147 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
165 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
180 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
204 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
205 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
207 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 11.09
Rhizosphere 88.45
Stem 0
Stem Tuber 0
Unclassified 6.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466960_0039086 3300044901 Bacteria 2236
2 Ga0070658_10421738 3300005327 Bacteria 1147
3 Ga0070683_100138298 3300005329 Bacteria 2307
4 Ga0070680_100591192 3300005336 Bacteria 952
5 Ga0070660_100067214 3300005339 Bacteria 2792
6 Ga0070660_100418288 3300005339 Bacteria 1110
7 Ga0070691_10241765 3300005341 Bacteria 965
8 Ga0070661_100023023 3300005344 Bacteria 4463
9 Ga0070692_10383160 3300005345 Unclassified 883
10 Ga0070674_100347929 3300005356 Bacteria 1196
11 Ga0070674_100849249 3300005356 Bacteria 792
12 Ga0070659_100072519 3300005366 Bacteria 2740
13 Ga0070659_100107690 3300005366 Bacteria 2248
14 Ga0070714_100011755 3300005435 Bacteria 6956
15 Ga0070714_100197857 3300005435 Bacteria 1837
16 Ga0070714_100454162 3300005435 Bacteria 1217
17 Ga0070714_101080986 3300005435 Archaea 781
18 Ga0070713_100004631 3300005436 Bacteria 9274
19 Ga0070710_10002369 3300005437 Bacteria 8922
20 Ga0070711_100015282 3300005439 Bacteria 4858
21 Ga0070711_100635513 3300005439 Bacteria 893
22 Ga0070678_100074763 3300005456 Bacteria 2547
23 Ga0070681_10007929 3300005458 Bacteria 10389
24 Ga0070681_10203714 3300005458 Bacteria 1896
25 Ga0070681_10382024 3300005458 Bacteria 1319
26 Ga0070681_11083707 3300005458 Bacteria 722
27 Ga0070685_10164761 3300005466 Bacteria 1416
28 Ga0070706_100594157 3300005467 Bacteria 1029
29 Ga0070707_100008855 3300005468 Bacteria 9332
30 Ga0070679_100184416 3300005530 Unclassified 2058
31 Ga0070679_100609815 3300005530 Bacteria 1035
32 Ga0070684_100057918 3300005535 Bacteria 3384
33 Ga0070684_100343913 3300005535 Bacteria 1371
34 Ga0068853_100490826 3300005539 Bacteria 1159
35 Ga0068853_101171746 3300005539 Bacteria 742
36 Ga0070686_100201046 3300005544 Bacteria 1428
37 Ga0070695_100000066 3300005545 Bacteria 41937
38 Ga0070696_100466667 3300005546 Bacteria 999
39 Ga0070693_100003527 3300005547 Bacteria 7296
40 Ga0070693_100466931 3300005547 Bacteria 889
41 Ga0070704_100390902 3300005549 Bacteria 1184
42 Ga0068855_100022839 3300005563 Bacteria 7497
43 Ga0068855_100059586 3300005563 Bacteria 4466
44 Ga0070664_100014405 3300005564 Bacteria 6447
45 Ga0070664_100628791 3300005564 Bacteria 997
46 Ga0070664_100678444 3300005564 Bacteria 959
47 Ga0068857_100062959 3300005577 Bacteria 3298
48 Ga0068857_100192676 3300005577 Bacteria 1857
49 Ga0068854_100110291 3300005578 Bacteria 2074
50 Ga0068856_100146794 3300005614 Bacteria 2366
51 Ga0068856_100242820 3300005614 Unclassified 1816
52 Ga0068856_100248888 3300005614 Bacteria 1792
53 Ga0068856_100382349 3300005614 Bacteria 1427
54 Ga0070702_100172039 3300005615 Bacteria 1410
55 Ga0070702_100280489 3300005615 Bacteria 1144
56 Ga0068852_100119625 3300005616 Bacteria 2408
57 Ga0068852_100154954 3300005616 Bacteria 2133
58 Ga0068864_100569958 3300005618 Bacteria 1096
59 Ga0068861_100148130 3300005719 Bacteria 1923
60 Ga0068863_100446291 3300005841 Bacteria 1269
61 Ga0068863_100880041 3300005841 Unclassified 895
62 Ga0081455_10094331 3300005937 Unclassified 2417
63 Ga0070717_10153421 3300006028 Unclassified 1994
64 Ga0070717_10191232 3300006028 Bacteria 1788
65 Ga0070717_10558956 3300006028 Bacteria 1036
66 Ga0097621_100028076 3300006237 Bacteria 4433
67 Ga0097621_100473149 3300006237 Bacteria 1132
68 Ga0075433_10488737 3300006852 Bacteria 1084
69 Ga0075434_100014684 3300006871 Bacteria 7492
70 Ga0075434_100075811 3300006871 Bacteria 3357
71 Ga0075434_100139309 3300006871 Bacteria 2445
72 Ga0075434_100549123 3300006871 Bacteria 1175
73 Ga0075435_100067337 3300007076 Bacteria 2915
74 Ga0075435_100448744 3300007076 Bacteria 1112
75 Ga0105240_10003994 3300009093 Bacteria 22725
76 Ga0111539_10549785 3300009094 Bacteria 1345
77 Ga0105245_10175337 3300009098 Bacteria 2044
78 Ga0114129_10393407 3300009147 Bacteria 1828
79 Ga0105242_10043320 3300009176 Bacteria 3641
80 Ga0105242_11053699 3300009176 Bacteria 824
81 Ga0105248_11385403 3300009177 Unclassified 796
82 Ga0105237_10279045 3300009545 Bacteria 1673
83 Ga0105237_10943870 3300009545 Bacteria 870
84 Ga0105238_10066333 3300009551 Bacteria 3611
85 Ga0105238_10442515 3300009551 Unclassified 1296
86 Ga0105238_10871862 3300009551 Bacteria 918
87 Ga0105249_11045504 3300009553 Bacteria 886
88 Ga0105239_11100882 3300010375 Bacteria 914
89 Ga0105246_10274652 3300011119 Unclassified 1349
90 Ga0105246_10648828 3300011119 Bacteria 919
91 Ga0157370_10197119 3300013104 Bacteria 1869
92 Ga0157370_10300357 3300013104 Bacteria 1482
93 Ga0157370_10635246 3300013104 Bacteria 976
94 Ga0157374_10347549 3300013296 Bacteria 1473
95 Ga0163162_11756305 3300013306 Bacteria 709
96 Ga0157372_10023806 3300013307 Bacteria 6644
97 Ga0157372_10047267 3300013307 Bacteria 4781
98 Ga0157372_10109002 3300013307 Bacteria 3170
99 Ga0157372_10226919 3300013307 Bacteria 2165
100 Ga0157375_10190233 3300013308 Bacteria 2207
101 Ga0182008_10179801 3300014497 Bacteria 1070
102 Ga0157377_10118912 3300014745 Bacteria 1599
103 Ga0157376_10222108 3300014969 Bacteria 1750
104 Ga0182006_1137989 3300015261 Unclassified 835
105 Ga0182007_10107227 3300015262 Bacteria 928
106 Ga0197907_10165038 3300020069 Bacteria 972
107 Ga0207692_10240207 3300025898 Bacteria 1081
108 Ga0207692_10454066 3300025898 Bacteria 807
109 Ga0207642_10072982 3300025899 Bacteria 1640
110 Ga0207647_10350736 3300025904 Bacteria 836
111 Ga0207699_10012635 3300025906 Bacteria 4300
112 Ga0207699_10509749 3300025906 Bacteria 869
113 Ga0207705_10293346 3300025909 Bacteria 1246
114 Ga0207684_10521475 3300025910 Bacteria 1018
115 Ga0207707_10206458 3300025912 Bacteria 1712
116 Ga0207707_10225427 3300025912 Bacteria 1631
117 Ga0207695_10055525 3300025913 Bacteria 4127
118 Ga0207693_10008397 3300025915 Bacteria 8449
119 Ga0207693_10049107 3300025915 Bacteria 3313
120 Ga0207663_10012692 3300025916 Bacteria 4561
121 Ga0207660_10056725 3300025917 Bacteria 2803
122 Ga0207657_10178227 3300025919 Bacteria 1719
123 Ga0207649_10323099 3300025920 Archaea 1134
124 Ga0207652_10397651 3300025921 Archaea 1243
125 Ga0207652_10544088 3300025921 Bacteria 1044
126 Ga0207652_10763521 3300025921 Bacteria 860
127 Ga0207646_10036601 3300025922 Bacteria 4429
128 Ga0207694_10504954 3300025924 Bacteria 1013
129 Ga0207694_10830168 3300025924 Bacteria 781
130 Ga0207687_10138025 3300025927 Bacteria 1846
131 Ga0207664_10057721 3300025929 Bacteria 3086
132 Ga0207664_10171479 3300025929 Bacteria 1857
133 Ga0207664_10247841 3300025929 Unclassified 1553
134 Ga0207709_10413697 3300025935 Bacteria 1034
135 Ga0207669_10274107 3300025937 Bacteria 1269
136 Ga0207669_10574869 3300025937 Bacteria 913
137 Ga0207704_10869717 3300025938 Bacteria 756
138 Ga0207661_10060260 3300025944 Bacteria 3061
139 Ga0207661_10061081 3300025944 Bacteria 3043
140 Ga0207679_10277559 3300025945 Bacteria 1436
141 Ga0207640_10110006 3300025981 Bacteria 1951
142 Ga0207639_11264328 3300026041 Bacteria 693
143 Ga0207678_10303978 3300026067 Bacteria 1371
144 Ga0207702_10266027 3300026078 Bacteria 1616
145 Ga0207641_11008525 3300026088 Bacteria 829
146 Ga0207676_10551675 3300026095 Bacteria 1101
147 Ga0207674_10040296 3300026116 Bacteria 4840
148 Ga0207674_10134972 3300026116 Bacteria 2430
149 Ga0207675_100143946 3300026118 Bacteria 2266
150 Ga0207675_100331454 3300026118 Bacteria 1488
151 Ga0207428_10186085 3300027907 Bacteria 1567
152 Ga0265318_10134435 3300028577 Bacteria 909
153 Ga0265336_10002072 3300028666 Bacteria 8529
154 Ga0265327_10026396 3300031251 Bacteria 3364
155 Ga0373926_0031042 3300035083 Bacteria 1883
156 Ga0373945_0001012 3300035116 Bacteria 8417
157 Ga0373943_0001687 3300035170 Bacteria 10024
158 Ga0373927_0038819 3300035695 Bacteria 3091
159 Ga0373947_0000128 3300035725 Bacteria 38766
160 Ga0373937_0103123 3300036401 Bacteria 2649
161 Ga0373925_0000616 3300037068 Bacteria 33997
162 Ga0395899_0103124 3300037312 Bacteria 2058
163 Ga0395900_0007802 3300037418 Bacteria 11034
164 Ga0395900_0184799 3300037418 Bacteria 2116
165 Ga0395898_0022353 3300037466 Bacteria 6405
166 Ga0395905_0832947 3300037471 Bacteria 825
167 Ga0395901_0054999 3300038443 Bacteria 4138
168 Ga0395901_0114844 3300038443 Bacteria 2828
169 Ga0395901_0255334 3300038443 Bacteria 1825
170 Ga0395901_0718219 3300038443 Bacteria 995
171 Ga0451853_3360861 3300041512 Bacteria 787
172 Ga0466969_0002202 3300044656 Bacteria 10416
173 Ga0466965_0063447 3300044683 Bacteria 1849
174 Ga0466965_0146388 3300044683 Bacteria 1233
175 Ga0466965_0665251 3300044683 Bacteria 595
176 Ga0466966_0006498 3300044684 Bacteria 7735
177 Ga0466966_0133487 3300044684 Bacteria 1519
178 Ga0466961_0002869 3300044693 Bacteria 10690
179 Ga0466961_0010878 3300044693 Bacteria 5812
180 Ga0466963_0000430 3300044694 Bacteria 19359
181 Ga0466963_0000791 3300044694 Bacteria 15750
182 Ga0466963_0001559 3300044694 Bacteria 12424
183 Ga0466963_0010163 3300044694 Bacteria 5690
184 Ga0466963_0013097 3300044694 Bacteria 5087
185 Ga0466963_0016378 3300044694 Bacteria 4609
186 Ga0466963_0051932 3300044694 Bacteria 2719
187 Ga0466963_0189773 3300044694 Bacteria 1435
188 Ga0466963_0195403 3300044694 Bacteria 1414
189 Ga0466963_0630741 3300044694 Bacteria 756
190 Ga0466964_0005168 3300044706 Bacteria 4837
191 Ga0466964_0020401 3300044706 Unclassified 2552
192 Ga0466964_0020956 3300044706 Bacteria 2523
193 Ga0466964_0220595 3300044706 Bacteria 920
194 Ga0466971_0000571 3300044719 Bacteria 14575
195 Ga0466971_0110664 3300044719 Bacteria 1267
196 Ga0466968_0001242 3300044735 Bacteria 9053
197 Ga0466968_0007072 3300044735 Bacteria 4255
198 Ga0466968_0009002 3300044735 Bacteria 3838
199 Ga0466968_0015282 3300044735 Bacteria 3040
200 Ga0466968_0026665 3300044735 Unclassified 2373
201 Ga0466968_0174899 3300044735 Bacteria 996
202 Ga0466968_0183692 3300044735 Bacteria 973
203 Ga0466968_0202858 3300044735 Bacteria 929
204 Ga0466970_0005446 3300044765 Bacteria 6315
205 Ga0466970_0040603 3300044765 Bacteria 2471
206 Ga0466970_0153979 3300044765 Bacteria 1270
207 Ga0466957_0017390 3300044842 Bacteria 4210
208 Ga0466957_0079442 3300044842 Bacteria 2041
209 Ga0466957_0092668 3300044842 Bacteria 1895
210 Ga0466957_0126009 3300044842 Bacteria 1636
211 Ga0466957_0237112 3300044842 Bacteria 1209
212 Ga0466957_0815112 3300044842 Bacteria 664
213 Ga0466960_0003818 3300044901 Bacteria 5839
214 Ga0466959_0000479 3300045049 Bacteria 23287
215 Ga0466958_0008309 3300045836 Bacteria 5748
216 Ga0466958_0012897 3300045836 Bacteria 4745
217 Ga0466958_0080714 3300045836 Unclassified 2001
218 Ga0466958_0081321 3300045836 Bacteria 1993
219 Ga0466958_0176430 3300045836 Bacteria 1355
220 Ga0466958_0210776 3300045836 Bacteria 1238
221 Ga0466958_0372064 3300045836 Unclassified 921
222 Ga0466967_0002703 3300045976 Bacteria 11204
223 Ga0466967_0006827 3300045976 Bacteria 8140
224 Ga0466967_0008012 3300045976 Bacteria 7697
225 Ga0466967_0014566 3300045976 Bacteria 6131
226 Ga0466967_0025335 3300045976 Bacteria 4889
227 Ga0466967_0031218 3300045976 Bacteria 4482
228 Ga0466967_0042665 3300045976 Bacteria 3921
229 Ga0466967_0086713 3300045976 Bacteria 2837
230 Ga0466967_0094441 3300045976 Bacteria 2723
231 Ga0466967_0097769 3300045976 Bacteria 2679
232 Ga0466967_0106933 3300045976 Bacteria 2565
233 Ga0466967_0110601 3300045976 Bacteria 2524
234 Ga0466967_0158365 3300045976 Bacteria 2123
235 Ga0466967_0326387 3300045976 Bacteria 1481
236 Ga0466967_0503718 3300045976 Bacteria 1188
237 Ga0466967_0693128 3300045976 Bacteria 1009
238 Ga0466967_1405666 3300045976 Bacteria 695
239 Ga0495592_0082633 3300046454 Bacteria 2321
240 Ga0495592_0222984 3300046454 Bacteria 1259
241 Ga0495603_0061749 3300046455 Bacteria 2213
242 Ga0495603_0122749 3300046455 Bacteria 1513
243 Ga0495603_0177785 3300046455 Unclassified 1232
244 Ga0495629_0001054 3300046459 Bacteria 22052
245 Ga0495629_0003488 3300046459 Bacteria 11896
246 Ga0495641_0002561 3300046461 Bacteria 14289
247 Ga0495641_0062588 3300046461 Bacteria 1678
248 Ga0495641_0094727 3300046461 Bacteria 1333
249 Ga0495651_0002454 3300046462 Bacteria 14323
250 Ga0495651_0209441 3300046462 Unclassified 1358
251 Ga0495653_0004604 3300046463 Bacteria 11155
252 Ga0495653_0047724 3300046463 Bacteria 3311
253 Ga0495653_0298546 3300046463 Archaea 1051
254 Ga0495653_0454191 3300046463 Bacteria 805
255 Ga0495653_0461474 3300046463 Unclassified 797
256 Ga0495580_0038328 3300046472 Bacteria 3433
257 Ga0495580_0531305 3300046472 Bacteria 783
258 Ga0495582_0016931 3300046473 Bacteria 3991
259 Ga0495582_0022244 3300046473 Bacteria 3469
260 Ga0495582_0037389 3300046473 Bacteria 2670
261 Ga0495582_0179061 3300046473 Bacteria 1208
262 Ga0495605_0246175 3300046474 Bacteria 766
263 Ga0495639_0000536 3300046475 Bacteria 17788
264 Ga0495662_0001493 3300046476 Bacteria 11587
265 Ga0495664_0017991 3300046477 Bacteria 4041
266 Ga0495664_0263632 3300046477 Bacteria 1041
267 Ga0495584_0036990 3300046491 Bacteria 2466
268 Ga0495584_0058621 3300046491 Bacteria 1937
269 Ga0495584_0309059 3300046491 Bacteria 803
270 Ga0495596_0091520 3300046500 Bacteria 1181
271 Ga0495608_0031082 3300046511 Bacteria 3612
272 Ga0495608_0088699 3300046511 Bacteria 2002
273 Ga0495618_0027294 3300046514 Bacteria 3554
274 Ga0495618_0043316 3300046514 Bacteria 2840
275 Ga0495618_0118649 3300046514 Bacteria 1694
276 Ga0495618_0392461 3300046514 Bacteria 850
277 Ga0495628_0095724 3300046516 Bacteria 2294
278 Ga0495628_0102315 3300046516 Bacteria 2210
279 Ga0495630_0001803 3300046517 Bacteria 14938
280 Ga0495630_0061066 3300046517 Bacteria 2830
281 Ga0495644_0070034 3300046523 Bacteria 1318
282 Ga0495666_0001969 3300046526 Bacteria 10130
283 Ga0495666_0397226 3300046526 Bacteria 620
284 Ga0495642_0085348 3300046528 Bacteria 1333
285 Ga0495652_0050253 3300046529 Bacteria 3565
286 Ga0495652_0152022 3300046529 Bacteria 1807
287 Ga0495652_0187033 3300046529 Bacteria 1584
288 Ga0495652_0345201 3300046529 Bacteria 1068
289 Ga0495665_0001782 3300046531 Bacteria 11587
290 Ga0495640_0004397 3300046533 Bacteria 11240
291 Ga0495640_0295577 3300046533 Bacteria 1007
292 Ga0495640_0311333 3300046533 Bacteria 976
293 Ga0495586_0010698 3300046535 Bacteria 4881
294 Ga0495586_0047612 3300046535 Bacteria 2315
295 Ga0495586_0124976 3300046535 Bacteria 1438
296 Ga0495587_0057533 3300046536 Bacteria 2285
297 Ga0495609_0217608 3300046538 Bacteria 794
298 Ga0495645_0099401 3300046543 Bacteria 2070
299 Ga0495645_0206022 3300046543 Bacteria 1331
300 Ga0495622_0278500 3300046557 Bacteria 732
301 Ga0495667_0088024 3300046559 Bacteria 2013
302 Ga0495667_0198217 3300046559 Bacteria 1285
303 Ga0495656_0009632 3300046615 Unclassified 3481
304 Ga0495668_0425161 3300046616 Bacteria 731
305 Ga0495634_0029169 3300046642 Bacteria 3821
306 Ga0495634_0069094 3300046642 Bacteria 2331
307 Ga0495634_0204272 3300046642 Bacteria 1226
308 Ga0495634_0268641 3300046642 Bacteria 1038
309 Ga0495635_0020360 3300046663 Bacteria 4622
310 Ga0495635_0062635 3300046663 Bacteria 2554
311 Ga0495635_0198662 3300046663 Bacteria 1360
312 Ga0495635_0473484 3300046663 Unclassified 826
313 Ga0495659_0100715 3300046664 Bacteria 1119
314 Ga0495657_0099319 3300046675 Unclassified 1856
315 Ga0495657_0250099 3300046675 Unclassified 1067
316 Ga0495657_0439755 3300046675 Bacteria 764
317 Ga0495599_0010890 3300046678 Bacteria 5574
318 Ga0495599_0087876 3300046678 Bacteria 1940
319 Ga0495599_0155455 3300046678 Bacteria 1415
320 Ga0495646_0012347 3300046680 Bacteria 5432
321 Ga0495646_0048046 3300046680 Bacteria 2595
322 Ga0495647_0000460 3300046681 Bacteria 11740
323 Ga0495647_0056211 3300046681 Bacteria 1542
324 Ga0495647_0101195 3300046681 Bacteria 1194
325 Ga0495658_0002928 3300046683 Bacteria 8562
326 Ga0495613_0025173 3300046689 Bacteria 4435
327 Ga0495613_0033272 3300046689 Bacteria 3831
328 Ga0495624_0004984 3300046690 Bacteria 9619
329 Ga0495624_0070405 3300046690 Bacteria 2178
330 Ga0495600_0050826 3300046809 Bacteria 2705
331 Ga0495600_0197880 3300046809 Bacteria 1291
332 Ga0495660_0128816 3300046810 Bacteria 1272
333 Ga0495581_0001193 3300047315 Bacteria 14265
334 Ga0495604_0579636 3300047317 Bacteria 721
335 Ga0495674_0008925 3300047319 Bacteria 9535
336 Ga0495674_0062575 3300047319 Bacteria 3239
337 Ga0495674_0065176 3300047319 Bacteria 3165
338 Ga0495674_0295573 3300047319 Bacteria 1324
339 Ga0495674_0334816 3300047319 Unclassified 1231
340 Ga0495676_0008488 3300047321 Bacteria 9412
341 Ga0495676_0413283 3300047321 Bacteria 894
342 Ga0495680_0038600 3300047322 Bacteria 3815
343 Ga0495680_0107794 3300047322 Bacteria 2068
344 Ga0495680_0265433 3300047322 Unclassified 1213
345 Ga0495684_0003498 3300047471 Bacteria 12285
346 Ga0495684_0018025 3300047471 Bacteria 5440
347 Ga0495684_0129311 3300047471 Bacteria 1898
348 Ga0495684_0216673 3300047471 Bacteria 1405
349 Ga0495684_0419129 3300047471 Unclassified 936
350 Ga0495593_0001377 3300047673 Bacteria 14221
351 Ga0495602_0025218 3300048088 Bacteria 5755
352 Ga0495602_0171002 3300048088 Bacteria 1687
353 Ga0495602_0260703 3300048088 Bacteria 1286
354 Ga0495614_0000398 3300048089 Bacteria 17643
355 Ga0495626_0116449 3300048091 Bacteria 1153
356 Ga0496100_0386916 3300048903 Bacteria 1063
357 Ga0496100_0606341 3300048903 Bacteria 850
358 Ga0496101_0057012 3300048904 Bacteria 2824
359 Ga0496101_0430292 3300048904 Bacteria 1040
360 Ga0496101_0576605 3300048904 Unclassified 890
361 Ga0496102_0068169 3300048905 Bacteria 3264
362 Ga0496102_0145427 3300048905 Bacteria 2225
363 Ga0496102_0439763 3300048905 Bacteria 1224
364 Ga0496104_0012649 3300048907 Bacteria 7598
365 Ga0496104_0137240 3300048907 Unclassified 2349
366 Ga0496104_0499147 3300048907 Bacteria 1128
367 Ga0496105_0004966 3300048908 Bacteria 10056
368 Ga0496105_0006879 3300048908 Bacteria 8754
369 Ga0496105_0083612 3300048908 Bacteria 2636
370 Ga0496106_0517493 3300048909 Bacteria 958
371 Ga0496107_0021548 3300048910 Bacteria 4555
372 Ga0496107_0084540 3300048910 Bacteria 2315
373 Ga0496107_0466940 3300048910 Bacteria 937
374 Ga0496108_0005783 3300048911 Bacteria 10018
375 Ga0496108_0041400 3300048911 Bacteria 3846
376 Ga0496108_0249211 3300048911 Bacteria 1545
377 Ga0496108_1537309 3300048911 Bacteria 553
378 Ga0496109_0049809 3300048912 Bacteria 3814
379 Ga0496109_0053424 3300048912 Bacteria 3684
380 Ga0496109_0060485 3300048912 Bacteria 3461
381 Ga0496109_0113156 3300048912 Bacteria 2524
382 Ga0496109_0308636 3300048912 Unclassified 1492
383 Ga0496110_0187650 3300048913 Bacteria 1877
384 Ga0496110_0733936 3300048913 Bacteria 890
385 Ga0496111_0095433 3300048914 Bacteria 2182
386 Ga0496111_0376936 3300048914 Bacteria 1049
387 Ga0496111_0439097 3300048914 Bacteria 963
388 Ga0496111_0569502 3300048914 Bacteria 831
389 Ga0496112_0005078 3300048915 Bacteria 11311
390 Ga0496112_0883295 3300048915 Bacteria 816
391 Ga0496112_0955096 3300048915 Bacteria 778
392 Ga0496112_0966978 3300048915 Bacteria 772
393 Ga0496113_0020429 3300048916 Bacteria 4655
394 Ga0496113_0074820 3300048916 Bacteria 2583
395 Ga0496114_0005225 3300048917 Bacteria 10144
396 Ga0496114_0094332 3300048917 Bacteria 2545
397 Ga0496114_0172043 3300048917 Unclassified 1888
398 Ga0496114_0395257 3300048917 Unclassified 1224
399 Ga0496114_0413186 3300048917 Bacteria 1195
400 Ga0496114_0428644 3300048917 Bacteria 1171
401 Ga0496115_0005964 3300048918 Bacteria 8893
402 Ga0496115_0030295 3300048918 Bacteria 4256
403 Ga0496115_0059116 3300048918 Bacteria 3086
404 Ga0501067_0000081 3300049583 Bacteria 54875
405 Ga0501068_0000501 3300049584 Bacteria 19932
406 Ga0501068_0737694 3300049584 Bacteria 645
407 Ga0501069_0047030 3300049585 Bacteria 2394
408 nmdc:mga05p37_1002090_c1 3300050507 Bacteria 887
409 nmdc:mga08y16_432039_c1 3300050511 Bacteria 1345
410 nmdc:mga0n895_119233_c1 3300050512 Bacteria 2659
411 nmdc:mga0n895_17585_c1 3300050512 Bacteria 6594
412 nmdc:mga0n895_47305_c1 3300050512 Bacteria 4206
413 nmdc:mga0rr50_120593_c1 3300050513 Bacteria 2087
414 nmdc:mga0rr50_540658_c1 3300050513 Bacteria 992
415 Ga0495601_0026179 3300053077 Bacteria 3599
416 Ga0495601_0033392 3300053077 Bacteria 3206
417 Ga0495601_0128515 3300053077 Bacteria 1649
418 Ga0495601_0386066 3300053077 Bacteria 908
419 Ga0495612_0009152 3300053078 Bacteria 4018
420 Ga0495612_0019002 3300053078 Bacteria 2750
421 Ga0495612_0152184 3300053078 Bacteria 1007
422 Ga0495595_0015900 3300053084 Bacteria 3212
423 Ga0495595_0021724 3300053084 Bacteria 2807
424 Ga0495595_0034412 3300053084 Bacteria 2291
425 Ga0495619_0008649 3300053085 Bacteria 6442
426 Ga0495619_0021372 3300053085 Bacteria 4130
427 Ga0495619_0050350 3300053085 Bacteria 2749
428 Ga0500566_0122501 3300053094 Bacteria 1400
429 Ga0501082_0592497 3300060353 Bacteria 970
430 Ga0466962_0004184 3300061719 Bacteria 6916
431 Ga0466962_0069632 3300061719 Bacteria 1680
432 Ga0466962_0080210 3300061719 Bacteria 1560
433 Ga0530510_0141572 3300061734 Bacteria 1772
434 Ga0466960_0039086
435 Ga0070658_10421738
436 Ga0070683_100138298
437 Ga0070680_100591192
438 Ga0070660_100067214
439 Ga0070660_100418288
440 Ga0070691_10241765
441 Ga0070661_100023023
442 Ga0070692_10383160
443 Ga0070674_100347929
444 Ga0070674_100849249
445 Ga0070659_100072519
446 Ga0070659_100107690
447 Ga0070714_100011755
448 Ga0070714_100197857
449 Ga0070714_100454162
450 Ga0070714_101080986
451 Ga0070713_100004631
452 Ga0070710_10002369
453 Ga0070711_100015282
454 Ga0070711_100635513
455 Ga0070678_100074763
456 Ga0070681_10007929
457 Ga0070681_10203714
458 Ga0070681_10382024
459 Ga0070681_11083707
460 Ga0070685_10164761
461 Ga0070706_100594157
462 Ga0070707_100008855
463 Ga0070679_100184416
464 Ga0070679_100609815
465 Ga0070684_100057918
466 Ga0070684_100343913
467 Ga0068853_100490826
468 Ga0068853_101171746
469 Ga0070686_100201046
470 Ga0070695_100000066
471 Ga0070696_100466667
472 Ga0070693_100003527
473 Ga0070693_100466931
474 Ga0070704_100390902
475 Ga0068855_100022839
476 Ga0068855_100059586
477 Ga0070664_100014405
478 Ga0070664_100628791
479 Ga0070664_100678444
480 Ga0068857_100062959
481 Ga0068857_100192676
482 Ga0068854_100110291
483 Ga0068856_100146794
484 Ga0068856_100242820
485 Ga0068856_100248888
486 Ga0068856_100382349
487 Ga0070702_100172039
488 Ga0070702_100280489
489 Ga0068852_100119625
490 Ga0068852_100154954
491 Ga0068864_100569958
492 Ga0068861_100148130
493 Ga0068863_100446291
494 Ga0068863_100880041
495 Ga0081455_10094331
496 Ga0070717_10153421
497 Ga0070717_10191232
498 Ga0070717_10558956
499 Ga0097621_100028076
500 Ga0097621_100473149
501 Ga0075433_10488737
502 Ga0075434_100014684
503 Ga0075434_100075811
504 Ga0075434_100139309
505 Ga0075434_100549123
506 Ga0075435_100067337
507 Ga0075435_100448744
508 Ga0105240_10003994
509 Ga0111539_10549785
510 Ga0105245_10175337
511 Ga0114129_10393407
512 Ga0105242_10043320
513 Ga0105242_11053699
514 Ga0105248_11385403
515 Ga0105237_10279045
516 Ga0105237_10943870
517 Ga0105238_10066333
518 Ga0105238_10442515
519 Ga0105238_10871862
520 Ga0105249_11045504
521 Ga0105239_11100882
522 Ga0105246_10274652
523 Ga0105246_10648828
524 Ga0157370_10197119
525 Ga0157370_10300357
526 Ga0157370_10635246
527 Ga0157374_10347549
528 Ga0163162_11756305
529 Ga0157372_10023806
530 Ga0157372_10047267
531 Ga0157372_10109002
532 Ga0157372_10226919
533 Ga0157375_10190233
534 Ga0182008_10179801
535 Ga0157377_10118912
536 Ga0157376_10222108
537 Ga0182006_1137989
538 Ga0182007_10107227
539 Ga0197907_10165038
540 Ga0207692_10240207
541 Ga0207692_10454066
542 Ga0207642_10072982
543 Ga0207647_10350736
544 Ga0207699_10012635
545 Ga0207699_10509749
546 Ga0207705_10293346
547 Ga0207684_10521475
548 Ga0207707_10206458
549 Ga0207707_10225427
550 Ga0207695_10055525
551 Ga0207693_10008397
552 Ga0207693_10049107
553 Ga0207663_10012692
554 Ga0207660_10056725
555 Ga0207657_10178227
556 Ga0207649_10323099
557 Ga0207652_10397651
558 Ga0207652_10544088
559 Ga0207652_10763521
560 Ga0207646_10036601
561 Ga0207694_10504954
562 Ga0207694_10830168
563 Ga0207687_10138025
564 Ga0207664_10057721
565 Ga0207664_10171479
566 Ga0207664_10247841
567 Ga0207709_10413697
568 Ga0207669_10274107
569 Ga0207669_10574869
570 Ga0207704_10869717
571 Ga0207661_10060260
572 Ga0207661_10061081
573 Ga0207679_10277559
574 Ga0207640_10110006
575 Ga0207639_11264328
576 Ga0207678_10303978
577 Ga0207702_10266027
578 Ga0207641_11008525
579 Ga0207676_10551675
580 Ga0207674_10040296
581 Ga0207674_10134972
582 Ga0207675_100143946
583 Ga0207675_100331454
584 Ga0207428_10186085
585 Ga0265318_10134435
586 Ga0265336_10002072
587 Ga0265327_10026396
588 Ga0373926_0031042
589 Ga0373945_0001012
590 Ga0373943_0001687
591 Ga0373927_0038819
592 Ga0373947_0000128
593 Ga0373937_0103123
594 Ga0373925_0000616
595 Ga0395899_0103124
596 Ga0395900_0007802
597 Ga0395900_0184799
598 Ga0395898_0022353
599 Ga0395905_0832947
600 Ga0395901_0054999
601 Ga0395901_0114844
602 Ga0395901_0255334
603 Ga0395901_0718219
604 Ga0451853_3360861
605 Ga0466969_0002202
606 Ga0466965_0063447
607 Ga0466965_0146388
608 Ga0466965_0665251
609 Ga0466966_0006498
610 Ga0466966_0133487
611 Ga0466961_0002869
612 Ga0466961_0010878
613 Ga0466963_0000430
614 Ga0466963_0000791
615 Ga0466963_0001559
616 Ga0466963_0010163
617 Ga0466963_0013097
618 Ga0466963_0016378
619 Ga0466963_0051932
620 Ga0466963_0189773
621 Ga0466963_0195403
622 Ga0466963_0630741
623 Ga0466964_0005168
624 Ga0466964_0020401
625 Ga0466964_0020956
626 Ga0466964_0220595
627 Ga0466971_0000571
628 Ga0466971_0110664
629 Ga0466968_0001242
630 Ga0466968_0007072
631 Ga0466968_0009002
632 Ga0466968_0015282
633 Ga0466968_0026665
634 Ga0466968_0174899
635 Ga0466968_0183692
636 Ga0466968_0202858
637 Ga0466970_0005446
638 Ga0466970_0040603
639 Ga0466970_0153979
640 Ga0466957_0017390
641 Ga0466957_0079442
642 Ga0466957_0092668
643 Ga0466957_0126009
644 Ga0466957_0237112
645 Ga0466957_0815112
646 Ga0466960_0003818
647 Ga0466959_0000479
648 Ga0466958_0008309
649 Ga0466958_0012897
650 Ga0466958_0080714
651 Ga0466958_0081321
652 Ga0466958_0176430
653 Ga0466958_0210776
654 Ga0466958_0372064
655 Ga0466967_0002703
656 Ga0466967_0006827
657 Ga0466967_0008012
658 Ga0466967_0014566
659 Ga0466967_0025335
660 Ga0466967_0031218
661 Ga0466967_0042665
662 Ga0466967_0086713
663 Ga0466967_0094441
664 Ga0466967_0097769
665 Ga0466967_0106933
666 Ga0466967_0110601
667 Ga0466967_0158365
668 Ga0466967_0326387
669 Ga0466967_0503718
670 Ga0466967_0693128
671 Ga0466967_1405666
672 Ga0495592_0082633
673 Ga0495592_0222984
674 Ga0495603_0061749
675 Ga0495603_0122749
676 Ga0495603_0177785
677 Ga0495629_0001054
678 Ga0495629_0003488
679 Ga0495641_0002561
680 Ga0495641_0062588
681 Ga0495641_0094727
682 Ga0495651_0002454
683 Ga0495651_0209441
684 Ga0495653_0004604
685 Ga0495653_0047724
686 Ga0495653_0298546
687 Ga0495653_0454191
688 Ga0495653_0461474
689 Ga0495580_0038328
690 Ga0495580_0531305
691 Ga0495582_0016931
692 Ga0495582_0022244
693 Ga0495582_0037389
694 Ga0495582_0179061
695 Ga0495605_0246175
696 Ga0495639_0000536
697 Ga0495662_0001493
698 Ga0495664_0017991
699 Ga0495664_0263632
700 Ga0495584_0036990
701 Ga0495584_0058621
702 Ga0495584_0309059
703 Ga0495596_0091520
704 Ga0495608_0031082
705 Ga0495608_0088699
706 Ga0495618_0027294
707 Ga0495618_0043316
708 Ga0495618_0118649
709 Ga0495618_0392461
710 Ga0495628_0095724
711 Ga0495628_0102315
712 Ga0495630_0001803
713 Ga0495630_0061066
714 Ga0495644_0070034
715 Ga0495666_0001969
716 Ga0495666_0397226
717 Ga0495642_0085348
718 Ga0495652_0050253
719 Ga0495652_0152022
720 Ga0495652_0187033
721 Ga0495652_0345201
722 Ga0495665_0001782
723 Ga0495640_0004397
724 Ga0495640_0295577
725 Ga0495640_0311333
726 Ga0495586_0010698
727 Ga0495586_0047612
728 Ga0495586_0124976
729 Ga0495587_0057533
730 Ga0495609_0217608
731 Ga0495645_0099401
732 Ga0495645_0206022
733 Ga0495622_0278500
734 Ga0495667_0088024
735 Ga0495667_0198217
736 Ga0495656_0009632
737 Ga0495668_0425161
738 Ga0495634_0029169
739 Ga0495634_0069094
740 Ga0495634_0204272
741 Ga0495634_0268641
742 Ga0495635_0020360
743 Ga0495635_0062635
744 Ga0495635_0198662
745 Ga0495635_0473484
746 Ga0495659_0100715
747 Ga0495657_0099319
748 Ga0495657_0250099
749 Ga0495657_0439755
750 Ga0495599_0010890
751 Ga0495599_0087876
752 Ga0495599_0155455
753 Ga0495646_0012347
754 Ga0495646_0048046
755 Ga0495647_0000460
756 Ga0495647_0056211
757 Ga0495647_0101195
758 Ga0495658_0002928
759 Ga0495613_0025173
760 Ga0495613_0033272
761 Ga0495624_0004984
762 Ga0495624_0070405
763 Ga0495600_0050826
764 Ga0495600_0197880
765 Ga0495660_0128816
766 Ga0495581_0001193
767 Ga0495604_0579636
768 Ga0495674_0008925
769 Ga0495674_0062575
770 Ga0495674_0065176
771 Ga0495674_0295573
772 Ga0495674_0334816
773 Ga0495676_0008488
774 Ga0495676_0413283
775 Ga0495680_0038600
776 Ga0495680_0107794
777 Ga0495680_0265433
778 Ga0495684_0003498
779 Ga0495684_0018025
780 Ga0495684_0129311
781 Ga0495684_0216673
782 Ga0495684_0419129
783 Ga0495593_0001377
784 Ga0495602_0025218
785 Ga0495602_0171002
786 Ga0495602_0260703
787 Ga0495614_0000398
788 Ga0495626_0116449
789 Ga0496100_0386916
790 Ga0496100_0606341
791 Ga0496101_0057012
792 Ga0496101_0430292
793 Ga0496101_0576605
794 Ga0496102_0068169
795 Ga0496102_0145427
796 Ga0496102_0439763
797 Ga0496104_0012649
798 Ga0496104_0137240
799 Ga0496104_0499147
800 Ga0496105_0004966
801 Ga0496105_0006879
802 Ga0496105_0083612
803 Ga0496106_0517493
804 Ga0496107_0021548
805 Ga0496107_0084540
806 Ga0496107_0466940
807 Ga0496108_0005783
808 Ga0496108_0041400
809 Ga0496108_0249211
810 Ga0496108_1537309
811 Ga0496109_0049809
812 Ga0496109_0053424
813 Ga0496109_0060485
814 Ga0496109_0113156
815 Ga0496109_0308636
816 Ga0496110_0187650
817 Ga0496110_0733936
818 Ga0496111_0095433
819 Ga0496111_0376936
820 Ga0496111_0439097
821 Ga0496111_0569502
822 Ga0496112_0005078
823 Ga0496112_0883295
824 Ga0496112_0955096
825 Ga0496112_0966978
826 Ga0496113_0020429
827 Ga0496113_0074820
828 Ga0496114_0005225
829 Ga0496114_0094332
830 Ga0496114_0172043
831 Ga0496114_0395257
832 Ga0496114_0413186
833 Ga0496114_0428644
834 Ga0496115_0005964
835 Ga0496115_0030295
836 Ga0496115_0059116
837 Ga0501067_0000081
838 Ga0501068_0000501
839 Ga0501068_0737694
840 Ga0501069_0047030
841 nmdc:mga05p37_1002090_c1
842 nmdc:mga08y16_432039_c1
843 nmdc:mga0n895_119233_c1
844 nmdc:mga0n895_17585_c1
845 nmdc:mga0n895_47305_c1
846 nmdc:mga0rr50_120593_c1
847 nmdc:mga0rr50_540658_c1
848 Ga0495601_0026179
849 Ga0495601_0033392
850 Ga0495601_0128515
851 Ga0495601_0386066
852 Ga0495612_0009152
853 Ga0495612_0019002
854 Ga0495612_0152184
855 Ga0495595_0015900
856 Ga0495595_0021724
857 Ga0495595_0034412
858 Ga0495619_0008649
859 Ga0495619_0021372
860 Ga0495619_0050350
861 Ga0500566_0122501
862 Ga0501082_0592497
863 Ga0466962_0004184
864 Ga0466962_0069632
865 Ga0466962_0080210
866 Ga0530510_0141572

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02600

DsbB

Disulfide bond formation protein DsbB

48

177

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wvf-assembly1.cif.gz_A e.coli dsbb c104s with ubiquinone 0.6537 31 160
4zsz-assembly1.cif.gz_A structure of a fusion protein with a helix linker, 2arh-3-3kaw-3.0 0.5612 27 160
6q58-assembly1.cif.gz_A copper loading to a cytosolic copper storage protein from streptomyces lividans (five coppers) 0.5518 20 162
6c14-assembly1.cif.gz_D cryoem structure of mouse pcdh15-1ec-lhfpl5 complex 0.5439 62 161
6q58-assembly1.cif.gz_A copper loading to a cytosolic copper storage protein from streptomyces lividans (five coppers) 0.5338 20 162
ID Description Score Start End Superfamily
2zuqD00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.7077 31 160 1.20.1550.10
2zuqA00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.6508 31 161 1.20.1550.10
af_Q55C26_1_134_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6484 33 176 1.20.140.150
af_Q84NQ7_50_187_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.64 22 162 1.20.140.150
2zuqD00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.6304 31 160 1.20.1550.10
ID Description Score Start End GO Terms
AF-A0A538MAS8-F1-model_v4 Disulfide bond formation protein B 0.9526 18 173 GO:0006457
GO:0015035
GO:0016020
AF-A0A2J0MQ87-F1-model_v4 Disulfide bond formation protein B 0.9442 27 161 GO:0006457
GO:0015035
GO:0016020
AF-A0A1G2K616-F1-model_v4 2-oxoglutarate dehydrogenase 0.9408 31 159 GO:0006457
GO:0015035
GO:0016020
AF-A0A7K1IBN7-F1-model_v4 deleted 0.9393 37 163
AF-A0A6N9EPS8-F1-model_v4 Disulfide bond formation protein B 0.937 31 161 GO:0006457
GO:0015035
GO:0016020

Map