F442855
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 433 | 256 | 433 | 253 |
Family's Representative Sequence
| Representative Sequence | 3300025315|Ga0207697_10008372|Ga0207697_100083725 |
| Length | 301 |
| Sequence | MFDKLFGWSKKKEEPEPRISFGRYSDNNKPNEKVTRWNDADALFKEKKYADSFSAFFEYLIRLGDDRLVLGHRLSEWCGHGPILEEDIALANISLDLIGEASLLLKLAASVEGQGRNEDTLAYFRDAIDFRNALMLELPKGDFGFTVVRQFLFSVYSLLQMDALQKSRNADLSGIAAKALKETRYHVRHSAQWVVTLGGGTDESNARAQQALNDLWRYTGELFVADDIDREVAASGDGVDPSTLEAVWREQVLPILQRAGLRVPDAGYMQGGGRGGRHTEHLGHMLSEMQILARSHPGASW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 63 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 145 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 147 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 148 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 149 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 150 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 151 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 152 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 153 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 155 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 156 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 157 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 158 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 159 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 162 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 163 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 164 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 166 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 168 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 169 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 172 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 173 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 174 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 175 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 176 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 177 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 178 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 179 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 180 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 219 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 220 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 221 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 222 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 223 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 226 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 227 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 228 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 229 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 230 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 231 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 242 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 243 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.77 |
| Metatranscriptomes | 0.23 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.46 |
| Rhizosphere | 95.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_11525244 | 2162886012 | Bacteria | 1536 |
| 2 | JGI24752J21851_1011473 | 3300001976 | Bacteria | 1159 |
| 3 | Ga0065715_10094976 | 3300005293 | Bacteria | 4197 |
| 4 | Ga0070658_10083078 | 3300005327 | Bacteria | 2632 |
| 5 | Ga0070658_10148970 | 3300005327 | Bacteria | 1958 |
| 6 | Ga0070676_10049070 | 3300005328 | Bacteria | 2470 |
| 7 | Ga0070683_100002016 | 3300005329 | Bacteria | 15955 |
| 8 | Ga0070683_100007884 | 3300005329 | Bacteria | 9024 |
| 9 | Ga0070683_100031558 | 3300005329 | Bacteria | 4819 |
| 10 | Ga0070683_100044917 | 3300005329 | Bacteria | 4077 |
| 11 | Ga0070683_100054480 | 3300005329 | Bacteria | 3708 |
| 12 | Ga0070683_100129629 | 3300005329 | Bacteria | 2386 |
| 13 | Ga0070683_100144030 | 3300005329 | Bacteria | 2258 |
| 14 | Ga0070683_100384821 | 3300005329 | Bacteria | 1337 |
| 15 | Ga0070683_100573064 | 3300005329 | Bacteria | 1080 |
| 16 | Ga0070683_100584708 | 3300005329 | Bacteria | 1068 |
| 17 | Ga0070690_100067031 | 3300005330 | Bacteria | 2325 |
| 18 | Ga0070690_100253484 | 3300005330 | Bacteria | 1246 |
| 19 | Ga0070690_100410377 | 3300005330 | Bacteria | 996 |
| 20 | Ga0070670_100014874 | 3300005331 | Bacteria | 6674 |
| 21 | Ga0068869_100008216 | 3300005334 | Bacteria | 6715 |
| 22 | Ga0068869_100086820 | 3300005334 | Bacteria | 2346 |
| 23 | Ga0068869_100095379 | 3300005334 | Bacteria | 2245 |
| 24 | Ga0070666_10038854 | 3300005335 | Bacteria | 3169 |
| 25 | Ga0070680_100022455 | 3300005336 | Bacteria | 5027 |
| 26 | Ga0070680_100049855 | 3300005336 | Bacteria | 3414 |
| 27 | Ga0070680_100059190 | 3300005336 | Bacteria | 3133 |
| 28 | Ga0070682_100012166 | 3300005337 | Bacteria | 4927 |
| 29 | Ga0068868_100036156 | 3300005338 | Bacteria | 3821 |
| 30 | Ga0070687_100026770 | 3300005343 | Bacteria | 2780 |
| 31 | Ga0070661_100004608 | 3300005344 | Bacteria | 9483 |
| 32 | Ga0070661_100122207 | 3300005344 | Bacteria | 1951 |
| 33 | Ga0070692_10061889 | 3300005345 | Bacteria | 1974 |
| 34 | Ga0070668_100069283 | 3300005347 | Bacteria | 2744 |
| 35 | Ga0070675_100014760 | 3300005354 | Bacteria | 6163 |
| 36 | Ga0070675_100133232 | 3300005354 | Bacteria | 2119 |
| 37 | Ga0070675_100260328 | 3300005354 | Bacteria | 1520 |
| 38 | Ga0070671_100188857 | 3300005355 | Bacteria | 1746 |
| 39 | Ga0070673_100049029 | 3300005364 | Bacteria | 3295 |
| 40 | Ga0070659_100011507 | 3300005366 | Bacteria | 6545 |
| 41 | Ga0070709_10023174 | 3300005434 | Bacteria | 3642 |
| 42 | Ga0070709_10073590 | 3300005434 | Bacteria | 2212 |
| 43 | Ga0070709_10282347 | 3300005434 | Bacteria | 1207 |
| 44 | Ga0070714_100108379 | 3300005435 | Bacteria | 2456 |
| 45 | Ga0070714_100136015 | 3300005435 | Bacteria | 2201 |
| 46 | Ga0070713_100000223 | 3300005436 | Bacteria | 37729 |
| 47 | Ga0070713_100010218 | 3300005436 | Bacteria | 6774 |
| 48 | Ga0070713_100034995 | 3300005436 | Bacteria | 4041 |
| 49 | Ga0070713_100038712 | 3300005436 | Bacteria | 3866 |
| 50 | Ga0070701_10094470 | 3300005438 | Bacteria | 1645 |
| 51 | Ga0070711_100238417 | 3300005439 | Bacteria | 1421 |
| 52 | Ga0070711_100331387 | 3300005439 | Bacteria | 1218 |
| 53 | Ga0070705_100002442 | 3300005440 | Bacteria | 9343 |
| 54 | Ga0070694_100060464 | 3300005444 | Bacteria | 2584 |
| 55 | Ga0070694_100425217 | 3300005444 | Bacteria | 1044 |
| 56 | Ga0070708_100000007 | 3300005445 | Bacteria | 146443 |
| 57 | Ga0070662_100009125 | 3300005457 | Bacteria | 6476 |
| 58 | Ga0070662_100072180 | 3300005457 | Bacteria | 2548 |
| 59 | Ga0070681_10000978 | 3300005458 | Bacteria | 24153 |
| 60 | Ga0070681_10027504 | 3300005458 | Bacteria | 5717 |
| 61 | Ga0070681_10027690 | 3300005458 | Bacteria | 5697 |
| 62 | Ga0070685_10189256 | 3300005466 | Bacteria | 1330 |
| 63 | Ga0070706_100089052 | 3300005467 | Bacteria | 2862 |
| 64 | Ga0070707_100084104 | 3300005468 | Bacteria | 3075 |
| 65 | Ga0070707_100207869 | 3300005468 | Bacteria | 1908 |
| 66 | Ga0070698_100034646 | 3300005471 | Bacteria | 5225 |
| 67 | Ga0070698_100058577 | 3300005471 | Bacteria | 3894 |
| 68 | Ga0070698_100164770 | 3300005471 | Bacteria | 2160 |
| 69 | Ga0070698_100189417 | 3300005471 | Bacteria | 1995 |
| 70 | Ga0070698_100567005 | 3300005471 | Bacteria | 1075 |
| 71 | Ga0070699_100000024 | 3300005518 | Bacteria | 161189 |
| 72 | Ga0070699_100077816 | 3300005518 | Bacteria | 2888 |
| 73 | Ga0070699_100137468 | 3300005518 | Bacteria | 2156 |
| 74 | Ga0070679_100005712 | 3300005530 | Bacteria | 11534 |
| 75 | Ga0070679_100007387 | 3300005530 | Bacteria | 10270 |
| 76 | Ga0070679_100025597 | 3300005530 | Bacteria | 5793 |
| 77 | Ga0070679_100133562 | 3300005530 | Bacteria | 2463 |
| 78 | Ga0070679_100282586 | 3300005530 | Bacteria | 1612 |
| 79 | Ga0070679_100485221 | 3300005530 | Bacteria | 1180 |
| 80 | Ga0070684_100011325 | 3300005535 | Bacteria | 7101 |
| 81 | Ga0070684_100054145 | 3300005535 | Bacteria | 3495 |
| 82 | Ga0070684_100094069 | 3300005535 | Bacteria | 2669 |
| 83 | Ga0070684_100124591 | 3300005535 | Bacteria | 2320 |
| 84 | Ga0070684_100129922 | 3300005535 | Bacteria | 2272 |
| 85 | Ga0070684_100146634 | 3300005535 | Bacteria | 2136 |
| 86 | Ga0070684_100193773 | 3300005535 | Bacteria | 1850 |
| 87 | Ga0070684_100556110 | 3300005535 | Bacteria | 1065 |
| 88 | Ga0068853_100292729 | 3300005539 | Bacteria | 1503 |
| 89 | Ga0068853_100715568 | 3300005539 | Bacteria | 956 |
| 90 | Ga0070686_100143901 | 3300005544 | Bacteria | 1663 |
| 91 | Ga0070696_100000366 | 3300005546 | Bacteria | 27619 |
| 92 | Ga0070696_100010341 | 3300005546 | Bacteria | 6251 |
| 93 | Ga0070693_100006198 | 3300005547 | Bacteria | 5798 |
| 94 | Ga0070693_100008346 | 3300005547 | Bacteria | 5102 |
| 95 | Ga0070704_100000546 | 3300005549 | Bacteria | 18015 |
| 96 | Ga0070704_100011501 | 3300005549 | Bacteria | 5427 |
| 97 | Ga0068855_100072626 | 3300005563 | Bacteria | 3999 |
| 98 | Ga0068855_100107945 | 3300005563 | Bacteria | 3198 |
| 99 | Ga0068855_100137335 | 3300005563 | Bacteria | 2788 |
| 100 | Ga0070664_100016569 | 3300005564 | Bacteria | 6044 |
| 101 | Ga0068857_100022867 | 3300005577 | Bacteria | 5499 |
| 102 | Ga0068856_100054986 | 3300005614 | Bacteria | 3928 |
| 103 | Ga0068856_100067511 | 3300005614 | Bacteria | 3534 |
| 104 | Ga0068852_100033592 | 3300005616 | Bacteria | 4261 |
| 105 | Ga0068852_100512529 | 3300005616 | Bacteria | 1196 |
| 106 | Ga0068859_100011471 | 3300005617 | Bacteria | 8910 |
| 107 | Ga0068859_100012064 | 3300005617 | Bacteria | 8682 |
| 108 | Ga0068859_100035842 | 3300005617 | Bacteria | 4979 |
| 109 | Ga0068859_100215199 | 3300005617 | Bacteria | 2009 |
| 110 | Ga0068859_100251000 | 3300005617 | Bacteria | 1860 |
| 111 | Ga0068859_100597556 | 3300005617 | Bacteria | 1197 |
| 112 | Ga0068864_100020285 | 3300005618 | Bacteria | 5560 |
| 113 | Ga0068861_100376899 | 3300005719 | Bacteria | 1252 |
| 114 | Ga0068863_100016544 | 3300005841 | Bacteria | 7077 |
| 115 | Ga0068858_100589253 | 3300005842 | Bacteria | 1078 |
| 116 | Ga0068860_100024706 | 3300005843 | Bacteria | 5803 |
| 117 | Ga0081539_10000290 | 3300005985 | Bacteria | 113852 |
| 118 | Ga0070717_10017368 | 3300006028 | Bacteria | 5599 |
| 119 | Ga0070717_10092280 | 3300006028 | Bacteria | 2558 |
| 120 | Ga0070716_100130385 | 3300006173 | Bacteria | 1588 |
| 121 | Ga0070716_100429362 | 3300006173 | Bacteria | 958 |
| 122 | Ga0070712_100157089 | 3300006175 | Bacteria | 1752 |
| 123 | Ga0097621_100026170 | 3300006237 | Bacteria | 4574 |
| 124 | Ga0068871_100024103 | 3300006358 | Bacteria | 4716 |
| 125 | Ga0075428_100033832 | 3300006844 | Bacteria | 5639 |
| 126 | Ga0075428_100104380 | 3300006844 | Bacteria | 3091 |
| 127 | Ga0075431_100017051 | 3300006847 | Bacteria | 7377 |
| 128 | Ga0075431_100024684 | 3300006847 | Bacteria | 6164 |
| 129 | Ga0075433_10119938 | 3300006852 | Bacteria | 2335 |
| 130 | Ga0075433_10223162 | 3300006852 | Unclassified | 1674 |
| 131 | Ga0075434_100021100 | 3300006871 | Bacteria | 6330 |
| 132 | Ga0075429_100002822 | 3300006880 | Bacteria | 14690 |
| 133 | Ga0075429_100471453 | 3300006880 | Bacteria | 1100 |
| 134 | Ga0068865_100034114 | 3300006881 | Bacteria | 3413 |
| 135 | Ga0097620_100011471 | 3300006931 | Bacteria | 8910 |
| 136 | Ga0097620_100012064 | 3300006931 | Bacteria | 8682 |
| 137 | Ga0097620_100035840 | 3300006931 | Bacteria | 4979 |
| 138 | Ga0097620_100215196 | 3300006931 | Bacteria | 2009 |
| 139 | Ga0097620_100250984 | 3300006931 | Bacteria | 1860 |
| 140 | Ga0097620_100597518 | 3300006931 | Bacteria | 1197 |
| 141 | Ga0105240_10118852 | 3300009093 | Bacteria | 3185 |
| 142 | Ga0111539_10194907 | 3300009094 | Bacteria | 2363 |
| 143 | Ga0105245_10011794 | 3300009098 | Bacteria | 7603 |
| 144 | Ga0105245_10740663 | 3300009098 | Bacteria | 1018 |
| 145 | Ga0114129_10002529 | 3300009147 | Bacteria | 25398 |
| 146 | Ga0114129_10005319 | 3300009147 | Bacteria | 18170 |
| 147 | Ga0114129_10018253 | 3300009147 | Bacteria | 9990 |
| 148 | Ga0105241_10151771 | 3300009174 | Bacteria | 1896 |
| 149 | Ga0105241_10336244 | 3300009174 | Bacteria | 1307 |
| 150 | Ga0105242_10004361 | 3300009176 | Bacteria | 11010 |
| 151 | Ga0105242_10123309 | 3300009176 | Bacteria | 2227 |
| 152 | Ga0105248_10006255 | 3300009177 | Bacteria | 13055 |
| 153 | Ga0105248_10018959 | 3300009177 | Bacteria | 7607 |
| 154 | Ga0105248_10160471 | 3300009177 | Bacteria | 2536 |
| 155 | Ga0105237_10138392 | 3300009545 | Bacteria | 2429 |
| 156 | Ga0105238_10021569 | 3300009551 | Bacteria | 6560 |
| 157 | Ga0105249_10431489 | 3300009553 | Bacteria | 1353 |
| 158 | Ga0105249_10468096 | 3300009553 | Bacteria | 1301 |
| 159 | Ga0105239_10008939 | 3300010375 | Bacteria | 11334 |
| 160 | Ga0105246_10004459 | 3300011119 | Bacteria | 8522 |
| 161 | Ga0157373_10052000 | 3300013100 | Bacteria | 2916 |
| 162 | Ga0157371_10048328 | 3300013102 | Bacteria | 3024 |
| 163 | Ga0157370_10002257 | 3300013104 | Bacteria | 23417 |
| 164 | Ga0157370_10035353 | 3300013104 | Bacteria | 4857 |
| 165 | Ga0157370_10590245 | 3300013104 | Bacteria | 1017 |
| 166 | Ga0157369_10095473 | 3300013105 | Bacteria | 3172 |
| 167 | Ga0157369_10181359 | 3300013105 | Bacteria | 2215 |
| 168 | Ga0157369_10411850 | 3300013105 | Bacteria | 1402 |
| 169 | Ga0157369_10488490 | 3300013105 | Bacteria | 1274 |
| 170 | Ga0157374_10065113 | 3300013296 | Bacteria | 3422 |
| 171 | Ga0157378_10519897 | 3300013297 | Bacteria | 1191 |
| 172 | Ga0163162_10059814 | 3300013306 | Bacteria | 3843 |
| 173 | Ga0163162_10152003 | 3300013306 | Bacteria | 2433 |
| 174 | Ga0163162_10224517 | 3300013306 | Bacteria | 2008 |
| 175 | Ga0163162_10577020 | 3300013306 | Bacteria | 1252 |
| 176 | Ga0157372_10002903 | 3300013307 | Bacteria | 18534 |
| 177 | Ga0157372_10007361 | 3300013307 | Bacteria | 11712 |
| 178 | Ga0157372_10041041 | 3300013307 | Bacteria | 5115 |
| 179 | Ga0157372_10043513 | 3300013307 | Bacteria | 4972 |
| 180 | Ga0157372_10168705 | 3300013307 | Bacteria | 2532 |
| 181 | Ga0157372_10214074 | 3300013307 | Bacteria | 2233 |
| 182 | Ga0157375_10027197 | 3300013308 | Bacteria | 5344 |
| 183 | Ga0157375_10216992 | 3300013308 | Bacteria | 2071 |
| 184 | Ga0163163_10158670 | 3300014325 | Bacteria | 2307 |
| 185 | Ga0157380_10421715 | 3300014326 | Bacteria | 1273 |
| 186 | Ga0157377_10014284 | 3300014745 | Bacteria | 4038 |
| 187 | Ga0157376_10149935 | 3300014969 | Bacteria | 2102 |
| 188 | Ga0157376_10424653 | 3300014969 | Bacteria | 1291 |
| 189 | Ga0206352_11185906 | 3300020078 | Bacteria | 1316 |
| 190 | Ga0207697_10008372 | 3300025315 | Bacteria | 4528 |
| 191 | Ga0207682_10130836 | 3300025893 | Bacteria | 1120 |
| 192 | Ga0207699_10001315 | 3300025906 | Bacteria | 11811 |
| 193 | Ga0207699_10037803 | 3300025906 | Bacteria | 2762 |
| 194 | Ga0207699_10120239 | 3300025906 | Bacteria | 1697 |
| 195 | Ga0207705_10064956 | 3300025909 | Bacteria | 2638 |
| 196 | Ga0207654_10102761 | 3300025911 | Bacteria | 1763 |
| 197 | Ga0207707_10037085 | 3300025912 | Bacteria | 4259 |
| 198 | Ga0207707_10226105 | 3300025912 | Bacteria | 1628 |
| 199 | Ga0207695_10066375 | 3300025913 | Bacteria | 3706 |
| 200 | Ga0207693_10059649 | 3300025915 | Bacteria | 2989 |
| 201 | Ga0207663_10243841 | 3300025916 | Bacteria | 1319 |
| 202 | Ga0207660_10031074 | 3300025917 | Bacteria | 3674 |
| 203 | Ga0207660_10126431 | 3300025917 | Bacteria | 1941 |
| 204 | Ga0207662_10044367 | 3300025918 | Bacteria | 2625 |
| 205 | Ga0207649_10004047 | 3300025920 | Bacteria | 7979 |
| 206 | Ga0207652_10008351 | 3300025921 | Bacteria | 8328 |
| 207 | Ga0207652_10016297 | 3300025921 | Bacteria | 6065 |
| 208 | Ga0207652_10037839 | 3300025921 | Bacteria | 4085 |
| 209 | Ga0207652_10263572 | 3300025921 | Bacteria | 1554 |
| 210 | Ga0207652_10328923 | 3300025921 | Bacteria | 1380 |
| 211 | Ga0207694_10026192 | 3300025924 | Bacteria | 4434 |
| 212 | Ga0207650_10031285 | 3300025925 | Bacteria | 3842 |
| 213 | Ga0207650_10113460 | 3300025925 | Bacteria | 2101 |
| 214 | Ga0207650_10457596 | 3300025925 | Bacteria | 1063 |
| 215 | Ga0207659_10101099 | 3300025926 | Bacteria | 2173 |
| 216 | Ga0207659_10131929 | 3300025926 | Bacteria | 1929 |
| 217 | Ga0207659_10178656 | 3300025926 | Bacteria | 1680 |
| 218 | Ga0207687_10110193 | 3300025927 | Bacteria | 2041 |
| 219 | Ga0207700_10000633 | 3300025928 | Bacteria | 20583 |
| 220 | Ga0207700_10018297 | 3300025928 | Bacteria | 4704 |
| 221 | Ga0207700_10035334 | 3300025928 | Bacteria | 3599 |
| 222 | Ga0207700_10265529 | 3300025928 | Bacteria | 1471 |
| 223 | Ga0207664_10020800 | 3300025929 | Bacteria | 4869 |
| 224 | Ga0207664_10060722 | 3300025929 | Bacteria | 3014 |
| 225 | Ga0207664_10135735 | 3300025929 | Bacteria | 2076 |
| 226 | Ga0207644_10029711 | 3300025931 | Bacteria | 3795 |
| 227 | Ga0207690_10050733 | 3300025932 | Bacteria | 2771 |
| 228 | Ga0207706_10005722 | 3300025933 | Bacteria | 11578 |
| 229 | Ga0207706_10019828 | 3300025933 | Bacteria | 6044 |
| 230 | Ga0207686_10061905 | 3300025934 | Bacteria | 2374 |
| 231 | Ga0207670_10326941 | 3300025936 | Bacteria | 1208 |
| 232 | Ga0207704_10213004 | 3300025938 | Bacteria | 1423 |
| 233 | Ga0207665_10085041 | 3300025939 | Bacteria | 2183 |
| 234 | Ga0207665_10557119 | 3300025939 | Bacteria | 891 |
| 235 | Ga0207691_10084368 | 3300025940 | Bacteria | 2852 |
| 236 | Ga0207711_10220999 | 3300025941 | Bacteria | 1732 |
| 237 | Ga0207711_10307906 | 3300025941 | Bacteria | 1462 |
| 238 | Ga0207689_10002072 | 3300025942 | Bacteria | 18927 |
| 239 | Ga0207689_10008190 | 3300025942 | Bacteria | 9107 |
| 240 | Ga0207661_10004811 | 3300025944 | Bacteria | 9454 |
| 241 | Ga0207661_10005194 | 3300025944 | Bacteria | 9153 |
| 242 | Ga0207661_10074049 | 3300025944 | Bacteria | 2791 |
| 243 | Ga0207661_10111261 | 3300025944 | Bacteria | 2317 |
| 244 | Ga0207661_10128162 | 3300025944 | Bacteria | 2170 |
| 245 | Ga0207661_10217787 | 3300025944 | Bacteria | 1686 |
| 246 | Ga0207679_10003073 | 3300025945 | Bacteria | 10336 |
| 247 | Ga0207667_10098163 | 3300025949 | Bacteria | 3023 |
| 248 | Ga0207667_10178852 | 3300025949 | Bacteria | 2179 |
| 249 | Ga0207667_10308578 | 3300025949 | Bacteria | 1616 |
| 250 | Ga0207651_10021159 | 3300025960 | Bacteria | 3946 |
| 251 | Ga0207712_10087816 | 3300025961 | Bacteria | 2281 |
| 252 | Ga0207712_10315354 | 3300025961 | Bacteria | 1288 |
| 253 | Ga0207677_10088770 | 3300026023 | Bacteria | 2242 |
| 254 | Ga0207703_10646822 | 3300026035 | Bacteria | 1003 |
| 255 | Ga0207639_10252210 | 3300026041 | Bacteria | 1539 |
| 256 | Ga0207639_10354144 | 3300026041 | Bacteria | 1312 |
| 257 | Ga0207702_10044326 | 3300026078 | Bacteria | 3738 |
| 258 | Ga0207702_10174180 | 3300026078 | Bacteria | 1976 |
| 259 | Ga0207641_10017493 | 3300026088 | Bacteria | 5869 |
| 260 | Ga0207641_10101119 | 3300026088 | Bacteria | 2540 |
| 261 | Ga0207648_10098118 | 3300026089 | Bacteria | 2565 |
| 262 | Ga0207676_10015349 | 3300026095 | Bacteria | 5521 |
| 263 | Ga0207674_10001365 | 3300026116 | Bacteria | 31614 |
| 264 | Ga0207674_10102115 | 3300026116 | Bacteria | 2848 |
| 265 | Ga0207674_10686390 | 3300026116 | Bacteria | 989 |
| 266 | Ga0207675_100245823 | 3300026118 | Bacteria | 1730 |
| 267 | Ga0207683_10055172 | 3300026121 | Bacteria | 3485 |
| 268 | Ga0207698_10096031 | 3300026142 | Bacteria | 2442 |
| 269 | Ga0207698_10455521 | 3300026142 | Bacteria | 1236 |
| 270 | Ga0210000_1019352 | 3300027462 | Bacteria | 1037 |
| 271 | Ga0209995_1003730 | 3300027471 | Bacteria | 2430 |
| 272 | Ga0209995_1009997 | 3300027471 | Bacteria | 1536 |
| 273 | Ga0268266_10076947 | 3300028379 | Bacteria | 2901 |
| 274 | Ga0268265_10056253 | 3300028380 | Bacteria | 2992 |
| 275 | Ga0268265_10104789 | 3300028380 | Bacteria | 2293 |
| 276 | Ga0268264_10009948 | 3300028381 | Bacteria | 7874 |
| 277 | Ga0268264_10522391 | 3300028381 | Bacteria | 1161 |
| 278 | Ga0265338_10086652 | 3300028800 | Bacteria | 2605 |
| 279 | Ga0265332_10017263 | 3300031238 | Bacteria | 3184 |
| 280 | Ga0265327_10033939 | 3300031251 | Bacteria | 2837 |
| 281 | Ga0316576_10368767 | 3300031727 | Bacteria | 1067 |
| 282 | Ga0307405_10053691 | 3300031731 | Bacteria | 2511 |
| 283 | Ga0307413_10081931 | 3300031824 | Bacteria | 2071 |
| 284 | Ga0307413_10121918 | 3300031824 | Bacteria | 1768 |
| 285 | Ga0307413_10186023 | 3300031824 | Bacteria | 1486 |
| 286 | Ga0307413_10285561 | 3300031824 | Bacteria | 1243 |
| 287 | Ga0307410_10153310 | 3300031852 | Bacteria | 1718 |
| 288 | Ga0307406_10061282 | 3300031901 | Bacteria | 2429 |
| 289 | Ga0307407_10034797 | 3300031903 | Bacteria | 2762 |
| 290 | Ga0307407_10046212 | 3300031903 | Bacteria | 2464 |
| 291 | Ga0307407_10132414 | 3300031903 | Bacteria | 1597 |
| 292 | Ga0307412_10012283 | 3300031911 | Bacteria | 4987 |
| 293 | Ga0307412_10048180 | 3300031911 | Bacteria | 2801 |
| 294 | Ga0307409_100177420 | 3300031995 | Bacteria | 1882 |
| 295 | Ga0307416_100005833 | 3300032002 | Bacteria | 7636 |
| 296 | Ga0307414_10357480 | 3300032004 | Bacteria | 1255 |
| 297 | Ga0373926_0002415 | 3300035083 | Bacteria | 5921 |
| 298 | Ga0373934_0077927 | 3300035086 | Bacteria | 1329 |
| 299 | Ga0373944_0061311 | 3300035089 | Bacteria | 1207 |
| 300 | Ga0373923_0052388 | 3300035111 | Bacteria | 1714 |
| 301 | Ga0373945_0006262 | 3300035116 | Bacteria | 3833 |
| 302 | Ga0373945_0011217 | 3300035116 | Bacteria | 2961 |
| 303 | Ga0373953_0003399 | 3300035117 | Bacteria | 4951 |
| 304 | Ga0373954_0012335 | 3300035118 | Bacteria | 3798 |
| 305 | Ga0373954_0215618 | 3300035118 | Bacteria | 944 |
| 306 | Ga0373955_0001896 | 3300035172 | Bacteria | 9019 |
| 307 | Ga0373931_0003254 | 3300035691 | Bacteria | 7264 |
| 308 | Ga0373935_0007600 | 3300035692 | Bacteria | 6491 |
| 309 | Ga0373927_0076975 | 3300035695 | Bacteria | 2160 |
| 310 | Ga0373927_0133595 | 3300035695 | Bacteria | 1621 |
| 311 | Ga0373947_0000123 | 3300035725 | Bacteria | 39071 |
| 312 | Ga0373937_0028977 | 3300036401 | Bacteria | 5014 |
| 313 | Ga0373937_0363057 | 3300036401 | Bacteria | 1372 |
| 314 | Ga0373937_0817583 | 3300036401 | Bacteria | 880 |
| 315 | Ga0373925_0001983 | 3300037068 | Bacteria | 16951 |
| 316 | Ga0373925_0098036 | 3300037068 | Bacteria | 2249 |
| 317 | Ga0436365_1220956 | 3300039437 | Bacteria | 2468 |
| 318 | Ga0436365_1778386 | 3300039437 | Bacteria | 944 |
| 319 | Ga0451577_0036930 | 3300042876 | Bacteria | 4398 |
| 320 | Ga0453683_0122418 | 3300044673 | Bacteria | 1638 |
| 321 | Ga0466963_0099635 | 3300044694 | Bacteria | 1988 |
| 322 | Ga0453684_0000617 | 3300044712 | Bacteria | 130120 |
| 323 | Ga0453684_0065064 | 3300044712 | Bacteria | 4652 |
| 324 | Ga0466959_0050360 | 3300045049 | Bacteria | 3058 |
| 325 | Ga0451576_0027705 | 3300045051 | Bacteria | 6083 |
| 326 | Ga0451576_0056758 | 3300045051 | Bacteria | 4094 |
| 327 | Ga0466958_0080965 | 3300045836 | Bacteria | 1998 |
| 328 | Ga0466967_0349824 | 3300045976 | Bacteria | 1430 |
| 329 | Ga0495592_0005002 | 3300046454 | Bacteria | 9760 |
| 330 | Ga0495603_0021183 | 3300046455 | Bacteria | 3936 |
| 331 | Ga0495629_0007989 | 3300046459 | Bacteria | 7784 |
| 332 | Ga0495629_0018684 | 3300046459 | Bacteria | 4955 |
| 333 | Ga0495629_0104005 | 3300046459 | Bacteria | 1981 |
| 334 | Ga0495641_0033426 | 3300046461 | Bacteria | 2441 |
| 335 | Ga0495651_0003057 | 3300046462 | Bacteria | 12913 |
| 336 | Ga0495653_0008227 | 3300046463 | Bacteria | 8546 |
| 337 | Ga0495580_0000872 | 3300046472 | Bacteria | 26075 |
| 338 | Ga0495580_0055088 | 3300046472 | Bacteria | 2803 |
| 339 | Ga0495582_0004569 | 3300046473 | Bacteria | 7772 |
| 340 | Ga0495582_0083763 | 3300046473 | Bacteria | 1772 |
| 341 | Ga0495639_0000117 | 3300046475 | Bacteria | 40157 |
| 342 | Ga0495594_0004546 | 3300046499 | Bacteria | 7137 |
| 343 | Ga0495594_0012340 | 3300046499 | Bacteria | 4451 |
| 344 | Ga0495594_0141394 | 3300046499 | Bacteria | 1365 |
| 345 | Ga0495628_0005595 | 3300046516 | Bacteria | 11000 |
| 346 | Ga0495630_0001819 | 3300046517 | Bacteria | 14876 |
| 347 | Ga0495630_0041452 | 3300046517 | Bacteria | 3438 |
| 348 | Ga0495666_0026398 | 3300046526 | Bacteria | 2863 |
| 349 | Ga0495652_0134860 | 3300046529 | Bacteria | 1949 |
| 350 | Ga0495652_0194468 | 3300046529 | Bacteria | 1545 |
| 351 | Ga0495665_0000362 | 3300046531 | Bacteria | 22903 |
| 352 | Ga0495665_0137461 | 3300046531 | Bacteria | 1278 |
| 353 | Ga0495640_0085801 | 3300046533 | Bacteria | 2086 |
| 354 | Ga0495586_0036288 | 3300046535 | Bacteria | 2646 |
| 355 | Ga0495586_0186417 | 3300046535 | Bacteria | 1175 |
| 356 | Ga0495587_0003085 | 3300046536 | Bacteria | 11130 |
| 357 | Ga0495645_0002661 | 3300046543 | Bacteria | 12139 |
| 358 | Ga0495645_0004316 | 3300046543 | Bacteria | 9715 |
| 359 | Ga0495667_0007606 | 3300046559 | Bacteria | 7355 |
| 360 | Ga0495634_0100785 | 3300046642 | Bacteria | 1866 |
| 361 | Ga0495635_0016076 | 3300046663 | Bacteria | 5226 |
| 362 | Ga0495635_0211790 | 3300046663 | Bacteria | 1312 |
| 363 | Ga0495657_0161754 | 3300046675 | Bacteria | 1385 |
| 364 | Ga0495599_0003366 | 3300046678 | Bacteria | 9344 |
| 365 | Ga0495599_0020060 | 3300046678 | Bacteria | 4164 |
| 366 | Ga0495658_0000095 | 3300046683 | Bacteria | 46039 |
| 367 | Ga0495658_0083995 | 3300046683 | Unclassified | 1874 |
| 368 | Ga0495613_0022404 | 3300046689 | Bacteria | 4708 |
| 369 | Ga0495600_0016094 | 3300046809 | Bacteria | 4741 |
| 370 | Ga0495600_0042968 | 3300046809 | Bacteria | 2946 |
| 371 | Ga0495600_0096991 | 3300046809 | Bacteria | 1922 |
| 372 | Ga0495581_0000662 | 3300047315 | Bacteria | 18083 |
| 373 | Ga0495581_0042835 | 3300047315 | Bacteria | 2619 |
| 374 | Ga0495604_0004690 | 3300047317 | Bacteria | 10841 |
| 375 | Ga0495674_0090226 | 3300047319 | Bacteria | 2619 |
| 376 | Ga0495680_0025804 | 3300047322 | Bacteria | 4858 |
| 377 | Ga0495675_0005691 | 3300047444 | Bacteria | 7616 |
| 378 | Ga0495675_0044344 | 3300047444 | Bacteria | 2833 |
| 379 | Ga0495677_0054342 | 3300047445 | Unclassified | 1477 |
| 380 | Ga0495684_0007844 | 3300047471 | Bacteria | 8261 |
| 381 | Ga0495684_0341160 | 3300047471 | Bacteria | 1066 |
| 382 | Ga0495593_0000896 | 3300047673 | Bacteria | 17308 |
| 383 | Ga0495602_0072044 | 3300048088 | Bacteria | 2948 |
| 384 | Ga0495614_0000104 | 3300048089 | Bacteria | 28897 |
| 385 | Ga0496101_0072742 | 3300048904 | Bacteria | 2524 |
| 386 | Ga0496102_0002168 | 3300048905 | Bacteria | 16849 |
| 387 | Ga0496103_0010140 | 3300048906 | Bacteria | 5571 |
| 388 | Ga0496104_0018711 | 3300048907 | Bacteria | 6322 |
| 389 | Ga0496105_0106207 | 3300048908 | Bacteria | 2318 |
| 390 | Ga0496106_0030552 | 3300048909 | Bacteria | 4015 |
| 391 | Ga0496108_0140132 | 3300048911 | Bacteria | 2083 |
| 392 | Ga0496109_0005313 | 3300048912 | Bacteria | 10765 |
| 393 | Ga0496110_0029093 | 3300048913 | Bacteria | 4750 |
| 394 | Ga0496111_0004841 | 3300048914 | Bacteria | 8541 |
| 395 | Ga0496112_0005923 | 3300048915 | Bacteria | 10661 |
| 396 | Ga0496112_0035687 | 3300048915 | Bacteria | 4846 |
| 397 | Ga0496113_0001879 | 3300048916 | Bacteria | 11973 |
| 398 | Ga0496115_0010495 | 3300048918 | Bacteria | 6923 |
| 399 | Ga0496115_0131245 | 3300048918 | Bacteria | 2065 |
| 400 | Ga0496119_0246071 | 3300048922 | Unclassified | 903 |
| 401 | Ga0501031_0000459 | 3300049568 | Bacteria | 23626 |
| 402 | Ga0501033_0000005 | 3300049570 | Bacteria | 379089 |
| 403 | Ga0501034_0000259 | 3300049571 | Bacteria | 95584 |
| 404 | Ga0501034_0237906 | 3300049571 | Bacteria | 1768 |
| 405 | Ga0501036_0007883 | 3300049572 | Bacteria | 8711 |
| 406 | Ga0501037_0132183 | 3300049573 | Bacteria | 1789 |
| 407 | Ga0501038_0007600 | 3300049574 | Bacteria | 9995 |
| 408 | Ga0501039_0002829 | 3300049575 | Bacteria | 12972 |
| 409 | Ga0501043_0008234 | 3300049579 | Bacteria | 8216 |
| 410 | Ga0501047_0163276 | 3300049581 | Bacteria | 2099 |
| 411 | Ga0501047_0212237 | 3300049581 | Bacteria | 1794 |
| 412 | Ga0501070_0187825 | 3300049586 | Bacteria | 1699 |
| 413 | Ga0501235_002543 | 3300049669 | Bacteria | 3925 |
| 414 | Ga0501225_0000715 | 3300049705 | Bacteria | 10435 |
| 415 | Ga0501080_0779468 | 3300049742 | Bacteria | 840 |
| 416 | Ga0501035_0010943 | 3300049822 | Bacteria | 8402 |
| 417 | Ga0501044_0030786 | 3300049823 | Bacteria | 5652 |
| 418 | Ga0501044_0546151 | 3300049823 | Bacteria | 1056 |
| 419 | Ga0501045_0000307 | 3300049824 | Bacteria | 28643 |
| 420 | nmdc:mga05p37_113417_c1 | 3300050507 | Bacteria | 3333 |
| 421 | nmdc:mga05p37_32338_c1 | 3300050507 | Bacteria | 4450 |
| 422 | nmdc:mga05p37_641669_c1 | 3300050507 | Bacteria | 1191 |
| 423 | nmdc:mga09592_1400_c1 | 3300050508 | Bacteria | 19294 |
| 424 | nmdc:mga09592_325960_c1 | 3300050508 | Bacteria | 1330 |
| 425 | nmdc:mga08y16_158556_c1 | 3300050511 | Bacteria | 2351 |
| 426 | nmdc:mga0n895_215246_c1 | 3300050512 | Bacteria | 1951 |
| 427 | nmdc:mga0rr50_382474_c1 | 3300050513 | Bacteria | 1187 |
| 428 | nmdc:mga0a205_102838_c1 | 3300050515 | Bacteria | 2755 |
| 429 | nmdc:mga0a205_71927_c1 | 3300050515 | Bacteria | 3340 |
| 430 | Ga0495601_0281812 | 3300053077 | Bacteria | 1083 |
| 431 | Ga0495612_0000807 | 3300053078 | Bacteria | 12764 |
| 432 | Ga0495595_0170529 | 3300053084 | Bacteria | 1077 |
| 433 | Ga0495619_0003992 | 3300053085 | Bacteria | 9457 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048922 | Ga0496119_0246071 | Ga0496119_0246071_116_865 | 234 |
| 2 | 3300005546 | Ga0070696_100000366 | Ga0070696_10000036614 | 236 |
| 3 | 3300005471 | Ga0070698_100164770 | Ga0070698_1001647703 | 241 |
| 4 | 3300005518 | Ga0070699_100137468 | Ga0070699_1001374683 | 241 |
| 5 | 3300006844 | Ga0075428_100033832 | Ga0075428_1000338324 | 241 |
| 6 | 3300009147 | Ga0114129_10005319 | Ga0114129_1000531924 | 241 |
| 7 | 3300049742 | Ga0501080_0779468 | Ga0501080_0779468_43_768 | 241 |
| 8 | 3300050507 | nmdc:mga05p37_641669_c1 | nmdc:mga05p37_641669_c1_233_958 | 241 |
| 9 | 3300049705 | Ga0501225_0000715 | Ga0501225_0000715_164_895 | 242 |
| 10 | 3300025912 | Ga0207707_10226105 | Ga0207707_102261052 | 244 |
| 11 | 3300005530 | Ga0070679_100485221 | Ga0070679_1004852211 | 245 |
| 12 | 3300039437 | Ga0436365_1778386 | Ga0436365_1778386_88_831 | 245 |
| 13 | 3300005530 | Ga0070679_100133562 | Ga0070679_1001335624 | 246 |
| 14 | 3300005563 | Ga0068855_100107945 | Ga0068855_1001079452 | 246 |
| 15 | 3300006173 | Ga0070716_100429362 | Ga0070716_1004293621 | 246 |
| 16 | 3300025921 | Ga0207652_10008351 | Ga0207652_100083519 | 246 |
| 17 | 3300025926 | Ga0207659_10178656 | Ga0207659_101786562 | 246 |
| 18 | 3300025939 | Ga0207665_10557119 | Ga0207665_105571191 | 246 |
| 19 | 3300025949 | Ga0207667_10178852 | Ga0207667_101788522 | 246 |
| 20 | 3300028800 | Ga0265338_10086652 | Ga0265338_100866523 | 246 |
| 21 | 3300035083 | Ga0373926_0002415 | Ga0373926_0002415_4417_5166 | 246 |
| 22 | 3300035089 | Ga0373944_0061311 | Ga0373944_0061311_76_825 | 246 |
| 23 | 3300035116 | Ga0373945_0006262 | Ga0373945_0006262_1271_2020 | 246 |
| 24 | 3300035692 | Ga0373935_0007600 | Ga0373935_0007600_4895_5644 | 246 |
| 25 | 3300035725 | Ga0373947_0000123 | Ga0373947_0000123_37438_38187 | 246 |
| 26 | 3300037068 | Ga0373925_0001983 | Ga0373925_0001983_3545_4294 | 246 |
| 27 | 3300046455 | Ga0495603_0021183 | Ga0495603_0021183_1133_1882 | 246 |
| 28 | 3300046459 | Ga0495629_0007989 | Ga0495629_0007989_1329_2078 | 246 |
| 29 | 3300046461 | Ga0495641_0033426 | Ga0495641_0033426_936_1685 | 246 |
| 30 | 3300046472 | Ga0495580_0000872 | Ga0495580_0000872_13356_14105 | 246 |
| 31 | 3300046475 | Ga0495639_0000117 | Ga0495639_0000117_1178_1927 | 246 |
| 32 | 3300046517 | Ga0495630_0001819 | Ga0495630_0001819_3293_4042 | 246 |
| 33 | 3300046531 | Ga0495665_0000362 | Ga0495665_0000362_15436_16185 | 246 |
| 34 | 3300046663 | Ga0495635_0211790 | Ga0495635_0211790_270_1019 | 246 |
| 35 | 3300046683 | Ga0495658_0000095 | Ga0495658_0000095_10490_11239 | 246 |
| 36 | 3300046689 | Ga0495613_0022404 | Ga0495613_0022404_1442_2191 | 246 |
| 37 | 3300047315 | Ga0495581_0000662 | Ga0495581_0000662_2190_2939 | 246 |
| 38 | 3300047673 | Ga0495593_0000896 | Ga0495593_0000896_1959_2708 | 246 |
| 39 | 3300048089 | Ga0495614_0000104 | Ga0495614_0000104_10467_11216 | 246 |
| 40 | 3300005336 | Ga0070680_100049855 | Ga0070680_1000498553 | 247 |
| 41 | 3300005458 | Ga0070681_10027504 | Ga0070681_100275046 | 247 |
| 42 | 3300005530 | Ga0070679_100007387 | Ga0070679_1000073872 | 247 |
| 43 | 3300025917 | Ga0207660_10031074 | Ga0207660_100310743 | 247 |
| 44 | 3300025921 | Ga0207652_10037839 | Ga0207652_100378396 | 247 |
| 45 | 3300036401 | Ga0373937_0817583 | Ga0373937_0817583_49_798 | 247 |
| 46 | 3300046459 | Ga0495629_0104005 | Ga0495629_0104005_570_1319 | 247 |
| 47 | 3300005330 | Ga0070690_100067031 | Ga0070690_1000670313 | 248 |
| 48 | 3300005334 | Ga0068869_100095379 | Ga0068869_1000953793 | 248 |
| 49 | 3300005343 | Ga0070687_100026770 | Ga0070687_1000267703 | 248 |
| 50 | 3300005354 | Ga0070675_100133232 | Ga0070675_1001332322 | 248 |
| 51 | 3300005354 | Ga0070675_100260328 | Ga0070675_1002603282 | 248 |
| 52 | 3300005436 | Ga0070713_100010218 | Ga0070713_1000102186 | 248 |
| 53 | 3300005438 | Ga0070701_10094470 | Ga0070701_100944702 | 248 |
| 54 | 3300005466 | Ga0070685_10189256 | Ga0070685_101892562 | 248 |
| 55 | 3300005544 | Ga0070686_100143901 | Ga0070686_1001439012 | 248 |
| 56 | 3300006844 | Ga0075428_100104380 | Ga0075428_1001043802 | 248 |
| 57 | 3300006847 | Ga0075431_100024684 | Ga0075431_1000246843 | 248 |
| 58 | 3300006852 | Ga0075433_10119938 | Ga0075433_101199383 | 248 |
| 59 | 3300006871 | Ga0075434_100021100 | Ga0075434_1000211006 | 248 |
| 60 | 3300009147 | Ga0114129_10002529 | Ga0114129_1000252923 | 248 |
| 61 | 3300009176 | Ga0105242_10123309 | Ga0105242_101233093 | 248 |
| 62 | 3300009177 | Ga0105248_10160471 | Ga0105248_101604713 | 248 |
| 63 | 3300013306 | Ga0163162_10224517 | Ga0163162_102245172 | 248 |
| 64 | 3300014969 | Ga0157376_10424653 | Ga0157376_104246531 | 248 |
| 65 | 3300025893 | Ga0207682_10130836 | Ga0207682_101308362 | 248 |
| 66 | 3300025918 | Ga0207662_10044367 | Ga0207662_100443673 | 248 |
| 67 | 3300025925 | Ga0207650_10457596 | Ga0207650_104575962 | 248 |
| 68 | 3300025928 | Ga0207700_10018297 | Ga0207700_100182973 | 248 |
| 69 | 3300025940 | Ga0207691_10084368 | Ga0207691_100843683 | 248 |
| 70 | 3300025941 | Ga0207711_10220999 | Ga0207711_102209993 | 248 |
| 71 | 3300025942 | Ga0207689_10008190 | Ga0207689_100081905 | 248 |
| 72 | 3300026121 | Ga0207683_10055172 | Ga0207683_100551724 | 248 |
| 73 | 3300027471 | Ga0209995_1009997 | Ga0209995_10099973 | 248 |
| 74 | 3300035086 | Ga0373934_0077927 | Ga0373934_0077927_63_815 | 248 |
| 75 | 3300035118 | Ga0373954_0215618 | Ga0373954_0215618_31_783 | 248 |
| 76 | 3300036401 | Ga0373937_0028977 | Ga0373937_0028977_3264_4016 | 248 |
| 77 | 3300046529 | Ga0495652_0194468 | Ga0495652_0194468_509_1261 | 248 |
| 78 | 3300046535 | Ga0495586_0186417 | Ga0495586_0186417_49_801 | 248 |
| 79 | 3300046536 | Ga0495587_0003085 | Ga0495587_0003085_8485_9237 | 248 |
| 80 | 3300046543 | Ga0495645_0002661 | Ga0495645_0002661_5412_6164 | 248 |
| 81 | 3300046559 | Ga0495667_0007606 | Ga0495667_0007606_3506_4258 | 248 |
| 82 | 3300046675 | Ga0495657_0161754 | Ga0495657_0161754_472_1224 | 248 |
| 83 | 3300046678 | Ga0495599_0020060 | Ga0495599_0020060_1625_2377 | 248 |
| 84 | 3300046809 | Ga0495600_0016094 | Ga0495600_0016094_1412_2164 | 248 |
| 85 | 3300047444 | Ga0495675_0044344 | Ga0495675_0044344_1624_2376 | 248 |
| 86 | 3300047471 | Ga0495684_0341160 | Ga0495684_0341160_48_800 | 248 |
| 87 | 3300050507 | nmdc:mga05p37_113417_c1 | nmdc:mga05p37_113417_c1_2355_3101 | 248 |
| 88 | 3300050508 | nmdc:mga09592_325960_c1 | nmdc:mga09592_325960_c1_528_1274 | 248 |
| 89 | 3300050515 | nmdc:mga0a205_102838_c1 | nmdc:mga0a205_102838_c1_1459_2205 | 248 |
| 90 | 3300053084 | Ga0495595_0170529 | Ga0495595_0170529_19_771 | 248 |
| 91 | 2162886012 | MBSR1b_contig_11525244 | MBSR1b_0874.00003870 | 249 |
| 92 | 3300001976 | JGI24752J21851_1011473 | JGI24752J21851_10114732 | 249 |
| 93 | 3300005293 | Ga0065715_10094976 | Ga0065715_100949763 | 249 |
| 94 | 3300005327 | Ga0070658_10083078 | Ga0070658_100830783 | 249 |
| 95 | 3300005327 | Ga0070658_10148970 | Ga0070658_101489702 | 249 |
| 96 | 3300005328 | Ga0070676_10049070 | Ga0070676_100490703 | 249 |
| 97 | 3300005329 | Ga0070683_100002016 | Ga0070683_10000201611 | 249 |
| 98 | 3300005329 | Ga0070683_100007884 | Ga0070683_1000078845 | 249 |
| 99 | 3300005329 | Ga0070683_100031558 | Ga0070683_1000315585 | 249 |
| 100 | 3300005329 | Ga0070683_100044917 | Ga0070683_1000449173 | 249 |
| 101 | 3300005329 | Ga0070683_100054480 | Ga0070683_1000544804 | 249 |
| 102 | 3300005329 | Ga0070683_100129629 | Ga0070683_1001296293 | 249 |
| 103 | 3300005329 | Ga0070683_100144030 | Ga0070683_1001440303 | 249 |
| 104 | 3300005329 | Ga0070683_100384821 | Ga0070683_1003848212 | 249 |
| 105 | 3300005329 | Ga0070683_100573064 | Ga0070683_1005730642 | 249 |
| 106 | 3300005329 | Ga0070683_100584708 | Ga0070683_1005847082 | 249 |
| 107 | 3300005330 | Ga0070690_100253484 | Ga0070690_1002534842 | 249 |
| 108 | 3300005330 | Ga0070690_100410377 | Ga0070690_1004103771 | 249 |
| 109 | 3300005331 | Ga0070670_100014874 | Ga0070670_1000148745 | 249 |
| 110 | 3300005334 | Ga0068869_100008216 | Ga0068869_1000082163 | 249 |
| 111 | 3300005334 | Ga0068869_100086820 | Ga0068869_1000868203 | 249 |
| 112 | 3300005335 | Ga0070666_10038854 | Ga0070666_100388543 | 249 |
| 113 | 3300005336 | Ga0070680_100022455 | Ga0070680_1000224553 | 249 |
| 114 | 3300005336 | Ga0070680_100059190 | Ga0070680_1000591903 | 249 |
| 115 | 3300005337 | Ga0070682_100012166 | Ga0070682_1000121663 | 249 |
| 116 | 3300005338 | Ga0068868_100036156 | Ga0068868_1000361565 | 249 |
| 117 | 3300005344 | Ga0070661_100004608 | Ga0070661_1000046085 | 249 |
| 118 | 3300005344 | Ga0070661_100122207 | Ga0070661_1001222073 | 249 |
| 119 | 3300005345 | Ga0070692_10061889 | Ga0070692_100618893 | 249 |
| 120 | 3300005347 | Ga0070668_100069283 | Ga0070668_1000692834 | 249 |
| 121 | 3300005354 | Ga0070675_100014760 | Ga0070675_1000147605 | 249 |
| 122 | 3300005355 | Ga0070671_100188857 | Ga0070671_1001888572 | 249 |
| 123 | 3300005364 | Ga0070673_100049029 | Ga0070673_1000490293 | 249 |
| 124 | 3300005366 | Ga0070659_100011507 | Ga0070659_1000115076 | 249 |
| 125 | 3300005434 | Ga0070709_10023174 | Ga0070709_100231745 | 249 |
| 126 | 3300005434 | Ga0070709_10073590 | Ga0070709_100735903 | 249 |
| 127 | 3300005434 | Ga0070709_10282347 | Ga0070709_102823472 | 249 |
| 128 | 3300005435 | Ga0070714_100108379 | Ga0070714_1001083793 | 249 |
| 129 | 3300005435 | Ga0070714_100136015 | Ga0070714_1001360152 | 249 |
| 130 | 3300005436 | Ga0070713_100000223 | Ga0070713_10000022319 | 249 |
| 131 | 3300005436 | Ga0070713_100034995 | Ga0070713_1000349955 | 249 |
| 132 | 3300005436 | Ga0070713_100038712 | Ga0070713_1000387124 | 249 |
| 133 | 3300005439 | Ga0070711_100238417 | Ga0070711_1002384171 | 249 |
| 134 | 3300005439 | Ga0070711_100331387 | Ga0070711_1003313872 | 249 |
| 135 | 3300005440 | Ga0070705_100002442 | Ga0070705_10000244210 | 249 |
| 136 | 3300005444 | Ga0070694_100060464 | Ga0070694_1000604643 | 249 |
| 137 | 3300005444 | Ga0070694_100425217 | Ga0070694_1004252171 | 249 |
| 138 | 3300005445 | Ga0070708_100000007 | Ga0070708_10000000785 | 249 |
| 139 | 3300005457 | Ga0070662_100009125 | Ga0070662_1000091255 | 249 |
| 140 | 3300005457 | Ga0070662_100072180 | Ga0070662_1000721803 | 249 |
| 141 | 3300005458 | Ga0070681_10000978 | Ga0070681_1000097820 | 249 |
| 142 | 3300005458 | Ga0070681_10027690 | Ga0070681_100276903 | 249 |
| 143 | 3300005467 | Ga0070706_100089052 | Ga0070706_1000890523 | 249 |
| 144 | 3300005468 | Ga0070707_100084104 | Ga0070707_1000841043 | 249 |
| 145 | 3300005468 | Ga0070707_100207869 | Ga0070707_1002078693 | 249 |
| 146 | 3300005471 | Ga0070698_100034646 | Ga0070698_1000346466 | 249 |
| 147 | 3300005471 | Ga0070698_100058577 | Ga0070698_1000585775 | 249 |
| 148 | 3300005471 | Ga0070698_100189417 | Ga0070698_1001894173 | 249 |
| 149 | 3300005471 | Ga0070698_100567005 | Ga0070698_1005670052 | 249 |
| 150 | 3300005518 | Ga0070699_100000024 | Ga0070699_10000002429 | 249 |
| 151 | 3300005518 | Ga0070699_100077816 | Ga0070699_1000778164 | 249 |
| 152 | 3300005530 | Ga0070679_100005712 | Ga0070679_1000057128 | 249 |
| 153 | 3300005530 | Ga0070679_100025597 | Ga0070679_1000255975 | 249 |
| 154 | 3300005530 | Ga0070679_100282586 | Ga0070679_1002825863 | 249 |
| 155 | 3300005535 | Ga0070684_100011325 | Ga0070684_1000113253 | 249 |
| 156 | 3300005535 | Ga0070684_100054145 | Ga0070684_1000541452 | 249 |
| 157 | 3300005535 | Ga0070684_100094069 | Ga0070684_1000940693 | 249 |
| 158 | 3300005535 | Ga0070684_100124591 | Ga0070684_1001245913 | 249 |
| 159 | 3300005535 | Ga0070684_100129922 | Ga0070684_1001299223 | 249 |
| 160 | 3300005535 | Ga0070684_100146634 | Ga0070684_1001466341 | 249 |
| 161 | 3300005535 | Ga0070684_100193773 | Ga0070684_1001937732 | 249 |
| 162 | 3300005535 | Ga0070684_100556110 | Ga0070684_1005561102 | 249 |
| 163 | 3300005539 | Ga0068853_100292729 | Ga0068853_1002927292 | 249 |
| 164 | 3300005539 | Ga0068853_100715568 | Ga0068853_1007155682 | 249 |
| 165 | 3300005546 | Ga0070696_100010341 | Ga0070696_1000103411 | 249 |
| 166 | 3300005547 | Ga0070693_100006198 | Ga0070693_1000061983 | 249 |
| 167 | 3300005547 | Ga0070693_100008346 | Ga0070693_1000083463 | 249 |
| 168 | 3300005549 | Ga0070704_100000546 | Ga0070704_1000005462 | 249 |
| 169 | 3300005549 | Ga0070704_100011501 | Ga0070704_1000115017 | 249 |
| 170 | 3300005563 | Ga0068855_100072626 | Ga0068855_1000726265 | 249 |
| 171 | 3300005563 | Ga0068855_100137335 | Ga0068855_1001373353 | 249 |
| 172 | 3300005564 | Ga0070664_100016569 | Ga0070664_1000165695 | 249 |
| 173 | 3300005577 | Ga0068857_100022867 | Ga0068857_1000228673 | 249 |
| 174 | 3300005614 | Ga0068856_100054986 | Ga0068856_1000549866 | 249 |
| 175 | 3300005614 | Ga0068856_100067511 | Ga0068856_1000675114 | 249 |
| 176 | 3300005616 | Ga0068852_100033592 | Ga0068852_1000335923 | 249 |
| 177 | 3300005616 | Ga0068852_100512529 | Ga0068852_1005125292 | 249 |
| 178 | 3300005617 | Ga0068859_100011471 | Ga0068859_1000114714 | 249 |
| 179 | 3300005617 | Ga0068859_100012064 | Ga0068859_1000120643 | 249 |
| 180 | 3300005617 | Ga0068859_100035842 | Ga0068859_1000358423 | 249 |
| 181 | 3300005617 | Ga0068859_100215199 | Ga0068859_1002151992 | 249 |
| 182 | 3300005617 | Ga0068859_100251000 | Ga0068859_1002510003 | 249 |
| 183 | 3300005617 | Ga0068859_100597556 | Ga0068859_1005975561 | 249 |
| 184 | 3300005618 | Ga0068864_100020285 | Ga0068864_1000202853 | 249 |
| 185 | 3300005719 | Ga0068861_100376899 | Ga0068861_1003768992 | 249 |
| 186 | 3300005841 | Ga0068863_100016544 | Ga0068863_1000165444 | 249 |
| 187 | 3300005842 | Ga0068858_100589253 | Ga0068858_1005892532 | 249 |
| 188 | 3300005843 | Ga0068860_100024706 | Ga0068860_1000247064 | 249 |
| 189 | 3300005985 | Ga0081539_10000290 | Ga0081539_1000029012 | 249 |
| 190 | 3300006028 | Ga0070717_10017368 | Ga0070717_100173683 | 249 |
| 191 | 3300006028 | Ga0070717_10092280 | Ga0070717_100922803 | 249 |
| 192 | 3300006173 | Ga0070716_100130385 | Ga0070716_1001303852 | 249 |
| 193 | 3300006175 | Ga0070712_100157089 | Ga0070712_1001570893 | 249 |
| 194 | 3300006237 | Ga0097621_100026170 | Ga0097621_1000261705 | 249 |
| 195 | 3300006358 | Ga0068871_100024103 | Ga0068871_1000241033 | 249 |
| 196 | 3300006847 | Ga0075431_100017051 | Ga0075431_1000170512 | 249 |
| 197 | 3300006852 | Ga0075433_10223162 | Ga0075433_102231623 | 249 |
| 198 | 3300006880 | Ga0075429_100002822 | Ga0075429_10000282211 | 249 |
| 199 | 3300006880 | Ga0075429_100471453 | Ga0075429_1004714532 | 249 |
| 200 | 3300006881 | Ga0068865_100034114 | Ga0068865_1000341144 | 249 |
| 201 | 3300006931 | Ga0097620_100011471 | Ga0097620_10001147112 | 249 |
| 202 | 3300006931 | Ga0097620_100012064 | Ga0097620_1000120643 | 249 |
| 203 | 3300006931 | Ga0097620_100035840 | Ga0097620_1000358405 | 249 |
| 204 | 3300006931 | Ga0097620_100215196 | Ga0097620_1002151962 | 249 |
| 205 | 3300006931 | Ga0097620_100250984 | Ga0097620_1002509843 | 249 |
| 206 | 3300006931 | Ga0097620_100597518 | Ga0097620_1005975181 | 249 |
| 207 | 3300009093 | Ga0105240_10118852 | Ga0105240_101188523 | 249 |
| 208 | 3300009094 | Ga0111539_10194907 | Ga0111539_101949072 | 249 |
| 209 | 3300009098 | Ga0105245_10011794 | Ga0105245_100117944 | 249 |
| 210 | 3300009098 | Ga0105245_10740663 | Ga0105245_107406632 | 249 |
| 211 | 3300009147 | Ga0114129_10018253 | Ga0114129_100182533 | 249 |
| 212 | 3300009174 | Ga0105241_10151771 | Ga0105241_101517712 | 249 |
| 213 | 3300009174 | Ga0105241_10336244 | Ga0105241_103362441 | 249 |
| 214 | 3300009176 | Ga0105242_10004361 | Ga0105242_100043619 | 249 |
| 215 | 3300009177 | Ga0105248_10006255 | Ga0105248_1000625510 | 249 |
| 216 | 3300009177 | Ga0105248_10018959 | Ga0105248_100189595 | 249 |
| 217 | 3300009545 | Ga0105237_10138392 | Ga0105237_101383922 | 249 |
| 218 | 3300009551 | Ga0105238_10021569 | Ga0105238_100215696 | 249 |
| 219 | 3300009553 | Ga0105249_10431489 | Ga0105249_104314891 | 249 |
| 220 | 3300009553 | Ga0105249_10468096 | Ga0105249_104680962 | 249 |
| 221 | 3300010375 | Ga0105239_10008939 | Ga0105239_1000893911 | 249 |
| 222 | 3300011119 | Ga0105246_10004459 | Ga0105246_100044597 | 249 |
| 223 | 3300013100 | Ga0157373_10052000 | Ga0157373_100520003 | 249 |
| 224 | 3300013102 | Ga0157371_10048328 | Ga0157371_100483283 | 249 |
| 225 | 3300013104 | Ga0157370_10002257 | Ga0157370_1000225717 | 249 |
| 226 | 3300013104 | Ga0157370_10035353 | Ga0157370_100353536 | 249 |
| 227 | 3300013104 | Ga0157370_10590245 | Ga0157370_105902452 | 249 |
| 228 | 3300013105 | Ga0157369_10095473 | Ga0157369_100954733 | 249 |
| 229 | 3300013105 | Ga0157369_10181359 | Ga0157369_101813592 | 249 |
| 230 | 3300013105 | Ga0157369_10411850 | Ga0157369_104118501 | 249 |
| 231 | 3300013105 | Ga0157369_10488490 | Ga0157369_104884903 | 249 |
| 232 | 3300013296 | Ga0157374_10065113 | Ga0157374_100651134 | 249 |
| 233 | 3300013297 | Ga0157378_10519897 | Ga0157378_105198971 | 249 |
| 234 | 3300013306 | Ga0163162_10059814 | Ga0163162_100598145 | 249 |
| 235 | 3300013306 | Ga0163162_10152003 | Ga0163162_101520033 | 249 |
| 236 | 3300013306 | Ga0163162_10577020 | Ga0163162_105770202 | 249 |
| 237 | 3300013307 | Ga0157372_10002903 | Ga0157372_100029032 | 249 |
| 238 | 3300013307 | Ga0157372_10007361 | Ga0157372_100073617 | 249 |
| 239 | 3300013307 | Ga0157372_10041041 | Ga0157372_100410412 | 249 |
| 240 | 3300013307 | Ga0157372_10043513 | Ga0157372_100435133 | 249 |
| 241 | 3300013307 | Ga0157372_10168705 | Ga0157372_101687052 | 249 |
| 242 | 3300013307 | Ga0157372_10214074 | Ga0157372_102140743 | 249 |
| 243 | 3300013308 | Ga0157375_10027197 | Ga0157375_100271973 | 249 |
| 244 | 3300013308 | Ga0157375_10216992 | Ga0157375_102169923 | 249 |
| 245 | 3300014325 | Ga0163163_10158670 | Ga0163163_101586702 | 249 |
| 246 | 3300014326 | Ga0157380_10421715 | Ga0157380_104217152 | 249 |
| 247 | 3300014745 | Ga0157377_10014284 | Ga0157377_100142845 | 249 |
| 248 | 3300014969 | Ga0157376_10149935 | Ga0157376_101499353 | 249 |
| 249 | 3300020078 | Ga0206352_11185906 | Ga0206352_111859062 | 249 |
| 250 | 3300025315 | Ga0207697_10008372 | Ga0207697_100083725 | 249 |
| 251 | 3300025906 | Ga0207699_10001315 | Ga0207699_1000131510 | 249 |
| 252 | 3300025906 | Ga0207699_10037803 | Ga0207699_100378034 | 249 |
| 253 | 3300025906 | Ga0207699_10120239 | Ga0207699_101202393 | 249 |
| 254 | 3300025909 | Ga0207705_10064956 | Ga0207705_100649563 | 249 |
| 255 | 3300025911 | Ga0207654_10102761 | Ga0207654_101027613 | 249 |
| 256 | 3300025912 | Ga0207707_10037085 | Ga0207707_100370853 | 249 |
| 257 | 3300025913 | Ga0207695_10066375 | Ga0207695_100663753 | 249 |
| 258 | 3300025915 | Ga0207693_10059649 | Ga0207693_100596493 | 249 |
| 259 | 3300025916 | Ga0207663_10243841 | Ga0207663_102438412 | 249 |
| 260 | 3300025917 | Ga0207660_10126431 | Ga0207660_101264313 | 249 |
| 261 | 3300025920 | Ga0207649_10004047 | Ga0207649_100040476 | 249 |
| 262 | 3300025921 | Ga0207652_10016297 | Ga0207652_100162975 | 249 |
| 263 | 3300025921 | Ga0207652_10263572 | Ga0207652_102635722 | 249 |
| 264 | 3300025921 | Ga0207652_10328923 | Ga0207652_103289232 | 249 |
| 265 | 3300025924 | Ga0207694_10026192 | Ga0207694_100261924 | 249 |
| 266 | 3300025925 | Ga0207650_10031285 | Ga0207650_100312852 | 249 |
| 267 | 3300025925 | Ga0207650_10113460 | Ga0207650_101134602 | 249 |
| 268 | 3300025926 | Ga0207659_10101099 | Ga0207659_101010992 | 249 |
| 269 | 3300025926 | Ga0207659_10131929 | Ga0207659_101319293 | 249 |
| 270 | 3300025927 | Ga0207687_10110193 | Ga0207687_101101932 | 249 |
| 271 | 3300025928 | Ga0207700_10000633 | Ga0207700_100006336 | 249 |
| 272 | 3300025928 | Ga0207700_10035334 | Ga0207700_100353344 | 249 |
| 273 | 3300025928 | Ga0207700_10265529 | Ga0207700_102655292 | 249 |
| 274 | 3300025929 | Ga0207664_10020800 | Ga0207664_100208005 | 249 |
| 275 | 3300025929 | Ga0207664_10060722 | Ga0207664_100607224 | 249 |
| 276 | 3300025929 | Ga0207664_10135735 | Ga0207664_101357352 | 249 |
| 277 | 3300025931 | Ga0207644_10029711 | Ga0207644_100297113 | 249 |
| 278 | 3300025932 | Ga0207690_10050733 | Ga0207690_100507333 | 249 |
| 279 | 3300025933 | Ga0207706_10005722 | Ga0207706_100057223 | 249 |
| 280 | 3300025933 | Ga0207706_10019828 | Ga0207706_100198285 | 249 |
| 281 | 3300025934 | Ga0207686_10061905 | Ga0207686_100619053 | 249 |
| 282 | 3300025936 | Ga0207670_10326941 | Ga0207670_103269413 | 249 |
| 283 | 3300025938 | Ga0207704_10213004 | Ga0207704_102130042 | 249 |
| 284 | 3300025939 | Ga0207665_10085041 | Ga0207665_100850413 | 249 |
| 285 | 3300025941 | Ga0207711_10307906 | Ga0207711_103079063 | 249 |
| 286 | 3300025942 | Ga0207689_10002072 | Ga0207689_1000207214 | 249 |
| 287 | 3300025944 | Ga0207661_10004811 | Ga0207661_100048115 | 249 |
| 288 | 3300025944 | Ga0207661_10005194 | Ga0207661_100051945 | 249 |
| 289 | 3300025944 | Ga0207661_10074049 | Ga0207661_100740493 | 249 |
| 290 | 3300025944 | Ga0207661_10111261 | Ga0207661_101112613 | 249 |
| 291 | 3300025944 | Ga0207661_10128162 | Ga0207661_101281623 | 249 |
| 292 | 3300025944 | Ga0207661_10217787 | Ga0207661_102177872 | 249 |
| 293 | 3300025945 | Ga0207679_10003073 | Ga0207679_100030735 | 249 |
| 294 | 3300025949 | Ga0207667_10098163 | Ga0207667_100981633 | 249 |
| 295 | 3300025949 | Ga0207667_10308578 | Ga0207667_103085781 | 249 |
| 296 | 3300025960 | Ga0207651_10021159 | Ga0207651_100211593 | 249 |
| 297 | 3300025961 | Ga0207712_10087816 | Ga0207712_100878163 | 249 |
| 298 | 3300025961 | Ga0207712_10315354 | Ga0207712_103153542 | 249 |
| 299 | 3300026023 | Ga0207677_10088770 | Ga0207677_100887703 | 249 |
| 300 | 3300026035 | Ga0207703_10646822 | Ga0207703_106468222 | 249 |
| 301 | 3300026041 | Ga0207639_10252210 | Ga0207639_102522102 | 249 |
| 302 | 3300026041 | Ga0207639_10354144 | Ga0207639_103541442 | 249 |
| 303 | 3300026078 | Ga0207702_10044326 | Ga0207702_100443264 | 249 |
| 304 | 3300026078 | Ga0207702_10174180 | Ga0207702_101741803 | 249 |
| 305 | 3300026088 | Ga0207641_10017493 | Ga0207641_100174933 | 249 |
| 306 | 3300026088 | Ga0207641_10101119 | Ga0207641_101011193 | 249 |
| 307 | 3300026089 | Ga0207648_10098118 | Ga0207648_100981182 | 249 |
| 308 | 3300026095 | Ga0207676_10015349 | Ga0207676_100153493 | 249 |
| 309 | 3300026116 | Ga0207674_10001365 | Ga0207674_100013656 | 249 |
| 310 | 3300026116 | Ga0207674_10102115 | Ga0207674_101021153 | 249 |
| 311 | 3300026116 | Ga0207674_10686390 | Ga0207674_106863902 | 249 |
| 312 | 3300026118 | Ga0207675_100245823 | Ga0207675_1002458232 | 249 |
| 313 | 3300026142 | Ga0207698_10096031 | Ga0207698_100960312 | 249 |
| 314 | 3300026142 | Ga0207698_10455521 | Ga0207698_104555211 | 249 |
| 315 | 3300027462 | Ga0210000_1019352 | Ga0210000_10193522 | 249 |
| 316 | 3300027471 | Ga0209995_1003730 | Ga0209995_10037304 | 249 |
| 317 | 3300028379 | Ga0268266_10076947 | Ga0268266_100769473 | 249 |
| 318 | 3300028380 | Ga0268265_10056253 | Ga0268265_100562534 | 249 |
| 319 | 3300028380 | Ga0268265_10104789 | Ga0268265_101047893 | 249 |
| 320 | 3300028381 | Ga0268264_10009948 | Ga0268264_100099485 | 249 |
| 321 | 3300028381 | Ga0268264_10522391 | Ga0268264_105223912 | 249 |
| 322 | 3300031238 | Ga0265332_10017263 | Ga0265332_100172633 | 249 |
| 323 | 3300031251 | Ga0265327_10033939 | Ga0265327_100339393 | 249 |
| 324 | 3300031727 | Ga0316576_10368767 | Ga0316576_103687672 | 249 |
| 325 | 3300031731 | Ga0307405_10053691 | Ga0307405_100536914 | 249 |
| 326 | 3300031824 | Ga0307413_10081931 | Ga0307413_100819313 | 249 |
| 327 | 3300031824 | Ga0307413_10121918 | Ga0307413_101219182 | 249 |
| 328 | 3300031824 | Ga0307413_10186023 | Ga0307413_101860233 | 249 |
| 329 | 3300031824 | Ga0307413_10285561 | Ga0307413_102855612 | 249 |
| 330 | 3300031852 | Ga0307410_10153310 | Ga0307410_101533102 | 249 |
| 331 | 3300031901 | Ga0307406_10061282 | Ga0307406_100612823 | 249 |
| 332 | 3300031903 | Ga0307407_10034797 | Ga0307407_100347973 | 249 |
| 333 | 3300031903 | Ga0307407_10046212 | Ga0307407_100462122 | 249 |
| 334 | 3300031903 | Ga0307407_10132414 | Ga0307407_101324142 | 249 |
| 335 | 3300031911 | Ga0307412_10012283 | Ga0307412_100122835 | 249 |
| 336 | 3300031911 | Ga0307412_10048180 | Ga0307412_100481803 | 249 |
| 337 | 3300031995 | Ga0307409_100177420 | Ga0307409_1001774203 | 249 |
| 338 | 3300032002 | Ga0307416_100005833 | Ga0307416_1000058336 | 249 |
| 339 | 3300032004 | Ga0307414_10357480 | Ga0307414_103574802 | 249 |
| 340 | 3300035111 | Ga0373923_0052388 | Ga0373923_0052388_622_1374 | 249 |
| 341 | 3300035116 | Ga0373945_0011217 | Ga0373945_0011217_1485_2249 | 249 |
| 342 | 3300035117 | Ga0373953_0003399 | Ga0373953_0003399_1240_1992 | 249 |
| 343 | 3300035118 | Ga0373954_0012335 | Ga0373954_0012335_554_1306 | 249 |
| 344 | 3300035172 | Ga0373955_0001896 | Ga0373955_0001896_7630_8382 | 249 |
| 345 | 3300035691 | Ga0373931_0003254 | Ga0373931_0003254_3242_3997 | 249 |
| 346 | 3300035695 | Ga0373927_0076975 | Ga0373927_0076975_1323_2087 | 249 |
| 347 | 3300035695 | Ga0373927_0133595 | Ga0373927_0133595_43_798 | 249 |
| 348 | 3300036401 | Ga0373937_0363057 | Ga0373937_0363057_93_845 | 249 |
| 349 | 3300037068 | Ga0373925_0098036 | Ga0373925_0098036_160_924 | 249 |
| 350 | 3300039437 | Ga0436365_1220956 | Ga0436365_1220956_751_1506 | 249 |
| 351 | 3300042876 | Ga0451577_0036930 | Ga0451577_0036930_149_904 | 249 |
| 352 | 3300044673 | Ga0453683_0122418 | Ga0453683_0122418_484_1248 | 249 |
| 353 | 3300044694 | Ga0466963_0099635 | Ga0466963_0099635_1171_1926 | 249 |
| 354 | 3300044712 | Ga0453684_0000617 | Ga0453684_0000617_109443_110204 | 249 |
| 355 | 3300044712 | Ga0453684_0065064 | Ga0453684_0065064_3124_3879 | 249 |
| 356 | 3300045049 | Ga0466959_0050360 | Ga0466959_0050360_2083_2835 | 249 |
| 357 | 3300045051 | Ga0451576_0027705 | Ga0451576_0027705_4346_5101 | 249 |
| 358 | 3300045051 | Ga0451576_0056758 | Ga0451576_0056758_2244_3008 | 249 |
| 359 | 3300045836 | Ga0466958_0080965 | Ga0466958_0080965_836_1588 | 249 |
| 360 | 3300045976 | Ga0466967_0349824 | Ga0466967_0349824_419_1174 | 249 |
| 361 | 3300046454 | Ga0495592_0005002 | Ga0495592_0005002_7918_8670 | 249 |
| 362 | 3300046459 | Ga0495629_0018684 | Ga0495629_0018684_1991_2758 | 249 |
| 363 | 3300046462 | Ga0495651_0003057 | Ga0495651_0003057_8314_9066 | 249 |
| 364 | 3300046463 | Ga0495653_0008227 | Ga0495653_0008227_294_1046 | 249 |
| 365 | 3300046472 | Ga0495580_0055088 | Ga0495580_0055088_1783_2547 | 249 |
| 366 | 3300046473 | Ga0495582_0004569 | Ga0495582_0004569_2715_3482 | 249 |
| 367 | 3300046473 | Ga0495582_0083763 | Ga0495582_0083763_248_1012 | 249 |
| 368 | 3300046499 | Ga0495594_0004546 | Ga0495594_0004546_3114_3869 | 249 |
| 369 | 3300046499 | Ga0495594_0012340 | Ga0495594_0012340_1302_2063 | 249 |
| 370 | 3300046499 | Ga0495594_0141394 | Ga0495594_0141394_132_887 | 249 |
| 371 | 3300046516 | Ga0495628_0005595 | Ga0495628_0005595_8313_9065 | 249 |
| 372 | 3300046517 | Ga0495630_0041452 | Ga0495630_0041452_1164_1916 | 249 |
| 373 | 3300046526 | Ga0495666_0026398 | Ga0495666_0026398_769_1533 | 249 |
| 374 | 3300046529 | Ga0495652_0134860 | Ga0495652_0134860_550_1302 | 249 |
| 375 | 3300046531 | Ga0495665_0137461 | Ga0495665_0137461_160_915 | 249 |
| 376 | 3300046533 | Ga0495640_0085801 | Ga0495640_0085801_380_1132 | 249 |
| 377 | 3300046535 | Ga0495586_0036288 | Ga0495586_0036288_1780_2535 | 249 |
| 378 | 3300046543 | Ga0495645_0004316 | Ga0495645_0004316_7501_8253 | 249 |
| 379 | 3300046642 | Ga0495634_0100785 | Ga0495634_0100785_378_1130 | 249 |
| 380 | 3300046663 | Ga0495635_0016076 | Ga0495635_0016076_3821_4573 | 249 |
| 381 | 3300046678 | Ga0495599_0003366 | Ga0495599_0003366_7927_8679 | 249 |
| 382 | 3300046683 | Ga0495658_0083995 | Ga0495658_0083995_919_1686 | 249 |
| 383 | 3300046809 | Ga0495600_0042968 | Ga0495600_0042968_1542_2294 | 249 |
| 384 | 3300046809 | Ga0495600_0096991 | Ga0495600_0096991_932_1699 | 249 |
| 385 | 3300047315 | Ga0495581_0042835 | Ga0495581_0042835_522_1286 | 249 |
| 386 | 3300047317 | Ga0495604_0004690 | Ga0495604_0004690_8467_9219 | 249 |
| 387 | 3300047319 | Ga0495674_0090226 | Ga0495674_0090226_537_1289 | 249 |
| 388 | 3300047322 | Ga0495680_0025804 | Ga0495680_0025804_1447_2199 | 249 |
| 389 | 3300047444 | Ga0495675_0005691 | Ga0495675_0005691_652_1404 | 249 |
| 390 | 3300047445 | Ga0495677_0054342 | Ga0495677_0054342_422_1177 | 249 |
| 391 | 3300047471 | Ga0495684_0007844 | Ga0495684_0007844_7348_8100 | 249 |
| 392 | 3300048088 | Ga0495602_0072044 | Ga0495602_0072044_926_1678 | 249 |
| 393 | 3300048904 | Ga0496101_0072742 | Ga0496101_0072742_400_1149 | 249 |
| 394 | 3300048905 | Ga0496102_0002168 | Ga0496102_0002168_10430_11179 | 249 |
| 395 | 3300048906 | Ga0496103_0010140 | Ga0496103_0010140_4513_5262 | 249 |
| 396 | 3300048907 | Ga0496104_0018711 | Ga0496104_0018711_1406_2155 | 249 |
| 397 | 3300048908 | Ga0496105_0106207 | Ga0496105_0106207_1250_1999 | 249 |
| 398 | 3300048909 | Ga0496106_0030552 | Ga0496106_0030552_2969_3718 | 249 |
| 399 | 3300048911 | Ga0496108_0140132 | Ga0496108_0140132_1185_1934 | 249 |
| 400 | 3300048912 | Ga0496109_0005313 | Ga0496109_0005313_5289_6038 | 249 |
| 401 | 3300048913 | Ga0496110_0029093 | Ga0496110_0029093_3427_4176 | 249 |
| 402 | 3300048914 | Ga0496111_0004841 | Ga0496111_0004841_3523_4272 | 249 |
| 403 | 3300048915 | Ga0496112_0005923 | Ga0496112_0005923_633_1388 | 249 |
| 404 | 3300048915 | Ga0496112_0035687 | Ga0496112_0035687_4081_4830 | 249 |
| 405 | 3300048916 | Ga0496113_0001879 | Ga0496113_0001879_3835_4584 | 249 |
| 406 | 3300048918 | Ga0496115_0010495 | Ga0496115_0010495_5009_5758 | 249 |
| 407 | 3300048918 | Ga0496115_0131245 | Ga0496115_0131245_1103_1885 | 249 |
| 408 | 3300049568 | Ga0501031_0000459 | Ga0501031_0000459_7914_8672 | 249 |
| 409 | 3300049570 | Ga0501033_0000005 | Ga0501033_0000005_172461_173219 | 249 |
| 410 | 3300049571 | Ga0501034_0000259 | Ga0501034_0000259_11791_12549 | 249 |
| 411 | 3300049571 | Ga0501034_0237906 | Ga0501034_0237906_235_990 | 249 |
| 412 | 3300049572 | Ga0501036_0007883 | Ga0501036_0007883_5617_6375 | 249 |
| 413 | 3300049573 | Ga0501037_0132183 | Ga0501037_0132183_858_1616 | 249 |
| 414 | 3300049574 | Ga0501038_0007600 | Ga0501038_0007600_2947_3705 | 249 |
| 415 | 3300049575 | Ga0501039_0002829 | Ga0501039_0002829_2878_3636 | 249 |
| 416 | 3300049579 | Ga0501043_0008234 | Ga0501043_0008234_4690_5448 | 249 |
| 417 | 3300049581 | Ga0501047_0163276 | Ga0501047_0163276_1214_1972 | 249 |
| 418 | 3300049581 | Ga0501047_0212237 | Ga0501047_0212237_458_1213 | 249 |
| 419 | 3300049586 | Ga0501070_0187825 | Ga0501070_0187825_117_872 | 249 |
| 420 | 3300049669 | Ga0501235_002543 | Ga0501235_002543_843_1595 | 249 |
| 421 | 3300049822 | Ga0501035_0010943 | Ga0501035_0010943_7510_8268 | 249 |
| 422 | 3300049823 | Ga0501044_0030786 | Ga0501044_0030786_1710_2468 | 249 |
| 423 | 3300049823 | Ga0501044_0546151 | Ga0501044_0546151_144_899 | 249 |
| 424 | 3300049824 | Ga0501045_0000307 | Ga0501045_0000307_22105_22863 | 249 |
| 425 | 3300050507 | nmdc:mga05p37_32338_c1 | nmdc:mga05p37_32338_c1_1909_2688 | 249 |
| 426 | 3300050508 | nmdc:mga09592_1400_c1 | nmdc:mga09592_1400_c1_10243_11022 | 249 |
| 427 | 3300050511 | nmdc:mga08y16_158556_c1 | nmdc:mga08y16_158556_c1_1510_2265 | 249 |
| 428 | 3300050512 | nmdc:mga0n895_215246_c1 | nmdc:mga0n895_215246_c1_12_764 | 249 |
| 429 | 3300050513 | nmdc:mga0rr50_382474_c1 | nmdc:mga0rr50_382474_c1_32_805 | 249 |
| 430 | 3300050515 | nmdc:mga0a205_71927_c1 | nmdc:mga0a205_71927_c1_586_1335 | 249 |
| 431 | 3300053077 | Ga0495601_0281812 | Ga0495601_0281812_230_982 | 249 |
| 432 | 3300053078 | Ga0495612_0000807 | Ga0495612_0000807_3547_4299 | 249 |
| 433 | 3300053085 | Ga0495619_0003992 | Ga0495619_0003992_7392_8144 | 249 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3pwq-assembly5.cif.gz_K | the phenylacetyl-coa monooxygenase paaac subcomplex | 0.9864 | 6 | 238 |
| 3pwq-assembly5.cif.gz_K | the phenylacetyl-coa monooxygenase paaac subcomplex | 0.974 | 6 | 238 |
| 4iit-assembly1.cif.gz_C-2 | the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa | 0.9733 | 3 | 249 |
| 4ii4-assembly1.cif.gz_C | the phenylacetyl-coa monooxygenase - mutant paaa e49q k68q - paac wild type subcomplex with benzoyl-coa | 0.9713 | 1 | 249 |
| 4ii4-assembly1.cif.gz_C | the phenylacetyl-coa monooxygenase - mutant paaa e49q k68q - paac wild type subcomplex with benzoyl-coa | 0.9675 | 1 | 249 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3pwqA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9708 | 1 | 249 | 1.20.1260.10 |
| 3pwqA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.967 | 1 | 249 | 1.20.1260.10 |
| 3pwqH00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8358 | 4 | 243 | 1.20.1260.10 |
| 3pwqH00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.805 | 4 | 243 | 1.20.1260.10 |
| 4mudC00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.778 | 4 | 209 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A699WU94-F1-model_v4 | Phenylacetate-CoA oxygenase subunit PaaI | 0.9974 | 39 | 159 |
GO:0005829
GO:0010124 |
| AF-A0A3D0ZKV3-F1-model_v4 | Phenylacetate-CoA oxygenase subunit PaaI | 0.993 | 102 | 199 |
GO:0005829
GO:0010124 |
| AF-A0A6N8PLU7-F1-model_v4 | deleted | 0.9917 | 90 | 215 |
|
| AF-A0A4Q2LMM2-F1-model_v4 | deleted | 0.9909 | 50 | 138 |
|
| AF-A0A377CVP2-F1-model_v4 | Multicomponent oxygenase/reductase subunit for phenylacetic acid degradation | 0.9892 | 61 | 174 |
GO:0005829
GO:0010124 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar