F442855

General Info

Members Datasets Scaffolds Average Seq Length
433 256 433 253

Family's Representative Sequence

Representative Sequence 3300025315|Ga0207697_10008372|Ga0207697_100083725
Length 301
Sequence MFDKLFGWSKKKEEPEPRISFGRYSDNNKPNEKVTRWNDADALFKEKKYADSFSAFFEYLIRLGDDRLVLGHRLSEWCGHGPILEEDIALANISLDLIGEASLLLKLAASVEGQGRNEDTLAYFRDAIDFRNALMLELPKGDFGFTVVRQFLFSVYSLLQMDALQKSRNADLSGIAAKALKETRYHVRHSAQWVVTLGGGTDESNARAQQALNDLWRYTGELFVADDIDREVAASGDGVDPSTLEAVWREQVLPILQRAGLRVPDAGYMQGGGRGGRHTEHLGHMLSEMQILARSHPGASW

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
158 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
159 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
163 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
231 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
242 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
255 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.46
Rhizosphere 95.84
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_11525244 2162886012 Bacteria 1536
2 JGI24752J21851_1011473 3300001976 Bacteria 1159
3 Ga0065715_10094976 3300005293 Bacteria 4197
4 Ga0070658_10083078 3300005327 Bacteria 2632
5 Ga0070658_10148970 3300005327 Bacteria 1958
6 Ga0070676_10049070 3300005328 Bacteria 2470
7 Ga0070683_100002016 3300005329 Bacteria 15955
8 Ga0070683_100007884 3300005329 Bacteria 9024
9 Ga0070683_100031558 3300005329 Bacteria 4819
10 Ga0070683_100044917 3300005329 Bacteria 4077
11 Ga0070683_100054480 3300005329 Bacteria 3708
12 Ga0070683_100129629 3300005329 Bacteria 2386
13 Ga0070683_100144030 3300005329 Bacteria 2258
14 Ga0070683_100384821 3300005329 Bacteria 1337
15 Ga0070683_100573064 3300005329 Bacteria 1080
16 Ga0070683_100584708 3300005329 Bacteria 1068
17 Ga0070690_100067031 3300005330 Bacteria 2325
18 Ga0070690_100253484 3300005330 Bacteria 1246
19 Ga0070690_100410377 3300005330 Bacteria 996
20 Ga0070670_100014874 3300005331 Bacteria 6674
21 Ga0068869_100008216 3300005334 Bacteria 6715
22 Ga0068869_100086820 3300005334 Bacteria 2346
23 Ga0068869_100095379 3300005334 Bacteria 2245
24 Ga0070666_10038854 3300005335 Bacteria 3169
25 Ga0070680_100022455 3300005336 Bacteria 5027
26 Ga0070680_100049855 3300005336 Bacteria 3414
27 Ga0070680_100059190 3300005336 Bacteria 3133
28 Ga0070682_100012166 3300005337 Bacteria 4927
29 Ga0068868_100036156 3300005338 Bacteria 3821
30 Ga0070687_100026770 3300005343 Bacteria 2780
31 Ga0070661_100004608 3300005344 Bacteria 9483
32 Ga0070661_100122207 3300005344 Bacteria 1951
33 Ga0070692_10061889 3300005345 Bacteria 1974
34 Ga0070668_100069283 3300005347 Bacteria 2744
35 Ga0070675_100014760 3300005354 Bacteria 6163
36 Ga0070675_100133232 3300005354 Bacteria 2119
37 Ga0070675_100260328 3300005354 Bacteria 1520
38 Ga0070671_100188857 3300005355 Bacteria 1746
39 Ga0070673_100049029 3300005364 Bacteria 3295
40 Ga0070659_100011507 3300005366 Bacteria 6545
41 Ga0070709_10023174 3300005434 Bacteria 3642
42 Ga0070709_10073590 3300005434 Bacteria 2212
43 Ga0070709_10282347 3300005434 Bacteria 1207
44 Ga0070714_100108379 3300005435 Bacteria 2456
45 Ga0070714_100136015 3300005435 Bacteria 2201
46 Ga0070713_100000223 3300005436 Bacteria 37729
47 Ga0070713_100010218 3300005436 Bacteria 6774
48 Ga0070713_100034995 3300005436 Bacteria 4041
49 Ga0070713_100038712 3300005436 Bacteria 3866
50 Ga0070701_10094470 3300005438 Bacteria 1645
51 Ga0070711_100238417 3300005439 Bacteria 1421
52 Ga0070711_100331387 3300005439 Bacteria 1218
53 Ga0070705_100002442 3300005440 Bacteria 9343
54 Ga0070694_100060464 3300005444 Bacteria 2584
55 Ga0070694_100425217 3300005444 Bacteria 1044
56 Ga0070708_100000007 3300005445 Bacteria 146443
57 Ga0070662_100009125 3300005457 Bacteria 6476
58 Ga0070662_100072180 3300005457 Bacteria 2548
59 Ga0070681_10000978 3300005458 Bacteria 24153
60 Ga0070681_10027504 3300005458 Bacteria 5717
61 Ga0070681_10027690 3300005458 Bacteria 5697
62 Ga0070685_10189256 3300005466 Bacteria 1330
63 Ga0070706_100089052 3300005467 Bacteria 2862
64 Ga0070707_100084104 3300005468 Bacteria 3075
65 Ga0070707_100207869 3300005468 Bacteria 1908
66 Ga0070698_100034646 3300005471 Bacteria 5225
67 Ga0070698_100058577 3300005471 Bacteria 3894
68 Ga0070698_100164770 3300005471 Bacteria 2160
69 Ga0070698_100189417 3300005471 Bacteria 1995
70 Ga0070698_100567005 3300005471 Bacteria 1075
71 Ga0070699_100000024 3300005518 Bacteria 161189
72 Ga0070699_100077816 3300005518 Bacteria 2888
73 Ga0070699_100137468 3300005518 Bacteria 2156
74 Ga0070679_100005712 3300005530 Bacteria 11534
75 Ga0070679_100007387 3300005530 Bacteria 10270
76 Ga0070679_100025597 3300005530 Bacteria 5793
77 Ga0070679_100133562 3300005530 Bacteria 2463
78 Ga0070679_100282586 3300005530 Bacteria 1612
79 Ga0070679_100485221 3300005530 Bacteria 1180
80 Ga0070684_100011325 3300005535 Bacteria 7101
81 Ga0070684_100054145 3300005535 Bacteria 3495
82 Ga0070684_100094069 3300005535 Bacteria 2669
83 Ga0070684_100124591 3300005535 Bacteria 2320
84 Ga0070684_100129922 3300005535 Bacteria 2272
85 Ga0070684_100146634 3300005535 Bacteria 2136
86 Ga0070684_100193773 3300005535 Bacteria 1850
87 Ga0070684_100556110 3300005535 Bacteria 1065
88 Ga0068853_100292729 3300005539 Bacteria 1503
89 Ga0068853_100715568 3300005539 Bacteria 956
90 Ga0070686_100143901 3300005544 Bacteria 1663
91 Ga0070696_100000366 3300005546 Bacteria 27619
92 Ga0070696_100010341 3300005546 Bacteria 6251
93 Ga0070693_100006198 3300005547 Bacteria 5798
94 Ga0070693_100008346 3300005547 Bacteria 5102
95 Ga0070704_100000546 3300005549 Bacteria 18015
96 Ga0070704_100011501 3300005549 Bacteria 5427
97 Ga0068855_100072626 3300005563 Bacteria 3999
98 Ga0068855_100107945 3300005563 Bacteria 3198
99 Ga0068855_100137335 3300005563 Bacteria 2788
100 Ga0070664_100016569 3300005564 Bacteria 6044
101 Ga0068857_100022867 3300005577 Bacteria 5499
102 Ga0068856_100054986 3300005614 Bacteria 3928
103 Ga0068856_100067511 3300005614 Bacteria 3534
104 Ga0068852_100033592 3300005616 Bacteria 4261
105 Ga0068852_100512529 3300005616 Bacteria 1196
106 Ga0068859_100011471 3300005617 Bacteria 8910
107 Ga0068859_100012064 3300005617 Bacteria 8682
108 Ga0068859_100035842 3300005617 Bacteria 4979
109 Ga0068859_100215199 3300005617 Bacteria 2009
110 Ga0068859_100251000 3300005617 Bacteria 1860
111 Ga0068859_100597556 3300005617 Bacteria 1197
112 Ga0068864_100020285 3300005618 Bacteria 5560
113 Ga0068861_100376899 3300005719 Bacteria 1252
114 Ga0068863_100016544 3300005841 Bacteria 7077
115 Ga0068858_100589253 3300005842 Bacteria 1078
116 Ga0068860_100024706 3300005843 Bacteria 5803
117 Ga0081539_10000290 3300005985 Bacteria 113852
118 Ga0070717_10017368 3300006028 Bacteria 5599
119 Ga0070717_10092280 3300006028 Bacteria 2558
120 Ga0070716_100130385 3300006173 Bacteria 1588
121 Ga0070716_100429362 3300006173 Bacteria 958
122 Ga0070712_100157089 3300006175 Bacteria 1752
123 Ga0097621_100026170 3300006237 Bacteria 4574
124 Ga0068871_100024103 3300006358 Bacteria 4716
125 Ga0075428_100033832 3300006844 Bacteria 5639
126 Ga0075428_100104380 3300006844 Bacteria 3091
127 Ga0075431_100017051 3300006847 Bacteria 7377
128 Ga0075431_100024684 3300006847 Bacteria 6164
129 Ga0075433_10119938 3300006852 Bacteria 2335
130 Ga0075433_10223162 3300006852 Unclassified 1674
131 Ga0075434_100021100 3300006871 Bacteria 6330
132 Ga0075429_100002822 3300006880 Bacteria 14690
133 Ga0075429_100471453 3300006880 Bacteria 1100
134 Ga0068865_100034114 3300006881 Bacteria 3413
135 Ga0097620_100011471 3300006931 Bacteria 8910
136 Ga0097620_100012064 3300006931 Bacteria 8682
137 Ga0097620_100035840 3300006931 Bacteria 4979
138 Ga0097620_100215196 3300006931 Bacteria 2009
139 Ga0097620_100250984 3300006931 Bacteria 1860
140 Ga0097620_100597518 3300006931 Bacteria 1197
141 Ga0105240_10118852 3300009093 Bacteria 3185
142 Ga0111539_10194907 3300009094 Bacteria 2363
143 Ga0105245_10011794 3300009098 Bacteria 7603
144 Ga0105245_10740663 3300009098 Bacteria 1018
145 Ga0114129_10002529 3300009147 Bacteria 25398
146 Ga0114129_10005319 3300009147 Bacteria 18170
147 Ga0114129_10018253 3300009147 Bacteria 9990
148 Ga0105241_10151771 3300009174 Bacteria 1896
149 Ga0105241_10336244 3300009174 Bacteria 1307
150 Ga0105242_10004361 3300009176 Bacteria 11010
151 Ga0105242_10123309 3300009176 Bacteria 2227
152 Ga0105248_10006255 3300009177 Bacteria 13055
153 Ga0105248_10018959 3300009177 Bacteria 7607
154 Ga0105248_10160471 3300009177 Bacteria 2536
155 Ga0105237_10138392 3300009545 Bacteria 2429
156 Ga0105238_10021569 3300009551 Bacteria 6560
157 Ga0105249_10431489 3300009553 Bacteria 1353
158 Ga0105249_10468096 3300009553 Bacteria 1301
159 Ga0105239_10008939 3300010375 Bacteria 11334
160 Ga0105246_10004459 3300011119 Bacteria 8522
161 Ga0157373_10052000 3300013100 Bacteria 2916
162 Ga0157371_10048328 3300013102 Bacteria 3024
163 Ga0157370_10002257 3300013104 Bacteria 23417
164 Ga0157370_10035353 3300013104 Bacteria 4857
165 Ga0157370_10590245 3300013104 Bacteria 1017
166 Ga0157369_10095473 3300013105 Bacteria 3172
167 Ga0157369_10181359 3300013105 Bacteria 2215
168 Ga0157369_10411850 3300013105 Bacteria 1402
169 Ga0157369_10488490 3300013105 Bacteria 1274
170 Ga0157374_10065113 3300013296 Bacteria 3422
171 Ga0157378_10519897 3300013297 Bacteria 1191
172 Ga0163162_10059814 3300013306 Bacteria 3843
173 Ga0163162_10152003 3300013306 Bacteria 2433
174 Ga0163162_10224517 3300013306 Bacteria 2008
175 Ga0163162_10577020 3300013306 Bacteria 1252
176 Ga0157372_10002903 3300013307 Bacteria 18534
177 Ga0157372_10007361 3300013307 Bacteria 11712
178 Ga0157372_10041041 3300013307 Bacteria 5115
179 Ga0157372_10043513 3300013307 Bacteria 4972
180 Ga0157372_10168705 3300013307 Bacteria 2532
181 Ga0157372_10214074 3300013307 Bacteria 2233
182 Ga0157375_10027197 3300013308 Bacteria 5344
183 Ga0157375_10216992 3300013308 Bacteria 2071
184 Ga0163163_10158670 3300014325 Bacteria 2307
185 Ga0157380_10421715 3300014326 Bacteria 1273
186 Ga0157377_10014284 3300014745 Bacteria 4038
187 Ga0157376_10149935 3300014969 Bacteria 2102
188 Ga0157376_10424653 3300014969 Bacteria 1291
189 Ga0206352_11185906 3300020078 Bacteria 1316
190 Ga0207697_10008372 3300025315 Bacteria 4528
191 Ga0207682_10130836 3300025893 Bacteria 1120
192 Ga0207699_10001315 3300025906 Bacteria 11811
193 Ga0207699_10037803 3300025906 Bacteria 2762
194 Ga0207699_10120239 3300025906 Bacteria 1697
195 Ga0207705_10064956 3300025909 Bacteria 2638
196 Ga0207654_10102761 3300025911 Bacteria 1763
197 Ga0207707_10037085 3300025912 Bacteria 4259
198 Ga0207707_10226105 3300025912 Bacteria 1628
199 Ga0207695_10066375 3300025913 Bacteria 3706
200 Ga0207693_10059649 3300025915 Bacteria 2989
201 Ga0207663_10243841 3300025916 Bacteria 1319
202 Ga0207660_10031074 3300025917 Bacteria 3674
203 Ga0207660_10126431 3300025917 Bacteria 1941
204 Ga0207662_10044367 3300025918 Bacteria 2625
205 Ga0207649_10004047 3300025920 Bacteria 7979
206 Ga0207652_10008351 3300025921 Bacteria 8328
207 Ga0207652_10016297 3300025921 Bacteria 6065
208 Ga0207652_10037839 3300025921 Bacteria 4085
209 Ga0207652_10263572 3300025921 Bacteria 1554
210 Ga0207652_10328923 3300025921 Bacteria 1380
211 Ga0207694_10026192 3300025924 Bacteria 4434
212 Ga0207650_10031285 3300025925 Bacteria 3842
213 Ga0207650_10113460 3300025925 Bacteria 2101
214 Ga0207650_10457596 3300025925 Bacteria 1063
215 Ga0207659_10101099 3300025926 Bacteria 2173
216 Ga0207659_10131929 3300025926 Bacteria 1929
217 Ga0207659_10178656 3300025926 Bacteria 1680
218 Ga0207687_10110193 3300025927 Bacteria 2041
219 Ga0207700_10000633 3300025928 Bacteria 20583
220 Ga0207700_10018297 3300025928 Bacteria 4704
221 Ga0207700_10035334 3300025928 Bacteria 3599
222 Ga0207700_10265529 3300025928 Bacteria 1471
223 Ga0207664_10020800 3300025929 Bacteria 4869
224 Ga0207664_10060722 3300025929 Bacteria 3014
225 Ga0207664_10135735 3300025929 Bacteria 2076
226 Ga0207644_10029711 3300025931 Bacteria 3795
227 Ga0207690_10050733 3300025932 Bacteria 2771
228 Ga0207706_10005722 3300025933 Bacteria 11578
229 Ga0207706_10019828 3300025933 Bacteria 6044
230 Ga0207686_10061905 3300025934 Bacteria 2374
231 Ga0207670_10326941 3300025936 Bacteria 1208
232 Ga0207704_10213004 3300025938 Bacteria 1423
233 Ga0207665_10085041 3300025939 Bacteria 2183
234 Ga0207665_10557119 3300025939 Bacteria 891
235 Ga0207691_10084368 3300025940 Bacteria 2852
236 Ga0207711_10220999 3300025941 Bacteria 1732
237 Ga0207711_10307906 3300025941 Bacteria 1462
238 Ga0207689_10002072 3300025942 Bacteria 18927
239 Ga0207689_10008190 3300025942 Bacteria 9107
240 Ga0207661_10004811 3300025944 Bacteria 9454
241 Ga0207661_10005194 3300025944 Bacteria 9153
242 Ga0207661_10074049 3300025944 Bacteria 2791
243 Ga0207661_10111261 3300025944 Bacteria 2317
244 Ga0207661_10128162 3300025944 Bacteria 2170
245 Ga0207661_10217787 3300025944 Bacteria 1686
246 Ga0207679_10003073 3300025945 Bacteria 10336
247 Ga0207667_10098163 3300025949 Bacteria 3023
248 Ga0207667_10178852 3300025949 Bacteria 2179
249 Ga0207667_10308578 3300025949 Bacteria 1616
250 Ga0207651_10021159 3300025960 Bacteria 3946
251 Ga0207712_10087816 3300025961 Bacteria 2281
252 Ga0207712_10315354 3300025961 Bacteria 1288
253 Ga0207677_10088770 3300026023 Bacteria 2242
254 Ga0207703_10646822 3300026035 Bacteria 1003
255 Ga0207639_10252210 3300026041 Bacteria 1539
256 Ga0207639_10354144 3300026041 Bacteria 1312
257 Ga0207702_10044326 3300026078 Bacteria 3738
258 Ga0207702_10174180 3300026078 Bacteria 1976
259 Ga0207641_10017493 3300026088 Bacteria 5869
260 Ga0207641_10101119 3300026088 Bacteria 2540
261 Ga0207648_10098118 3300026089 Bacteria 2565
262 Ga0207676_10015349 3300026095 Bacteria 5521
263 Ga0207674_10001365 3300026116 Bacteria 31614
264 Ga0207674_10102115 3300026116 Bacteria 2848
265 Ga0207674_10686390 3300026116 Bacteria 989
266 Ga0207675_100245823 3300026118 Bacteria 1730
267 Ga0207683_10055172 3300026121 Bacteria 3485
268 Ga0207698_10096031 3300026142 Bacteria 2442
269 Ga0207698_10455521 3300026142 Bacteria 1236
270 Ga0210000_1019352 3300027462 Bacteria 1037
271 Ga0209995_1003730 3300027471 Bacteria 2430
272 Ga0209995_1009997 3300027471 Bacteria 1536
273 Ga0268266_10076947 3300028379 Bacteria 2901
274 Ga0268265_10056253 3300028380 Bacteria 2992
275 Ga0268265_10104789 3300028380 Bacteria 2293
276 Ga0268264_10009948 3300028381 Bacteria 7874
277 Ga0268264_10522391 3300028381 Bacteria 1161
278 Ga0265338_10086652 3300028800 Bacteria 2605
279 Ga0265332_10017263 3300031238 Bacteria 3184
280 Ga0265327_10033939 3300031251 Bacteria 2837
281 Ga0316576_10368767 3300031727 Bacteria 1067
282 Ga0307405_10053691 3300031731 Bacteria 2511
283 Ga0307413_10081931 3300031824 Bacteria 2071
284 Ga0307413_10121918 3300031824 Bacteria 1768
285 Ga0307413_10186023 3300031824 Bacteria 1486
286 Ga0307413_10285561 3300031824 Bacteria 1243
287 Ga0307410_10153310 3300031852 Bacteria 1718
288 Ga0307406_10061282 3300031901 Bacteria 2429
289 Ga0307407_10034797 3300031903 Bacteria 2762
290 Ga0307407_10046212 3300031903 Bacteria 2464
291 Ga0307407_10132414 3300031903 Bacteria 1597
292 Ga0307412_10012283 3300031911 Bacteria 4987
293 Ga0307412_10048180 3300031911 Bacteria 2801
294 Ga0307409_100177420 3300031995 Bacteria 1882
295 Ga0307416_100005833 3300032002 Bacteria 7636
296 Ga0307414_10357480 3300032004 Bacteria 1255
297 Ga0373926_0002415 3300035083 Bacteria 5921
298 Ga0373934_0077927 3300035086 Bacteria 1329
299 Ga0373944_0061311 3300035089 Bacteria 1207
300 Ga0373923_0052388 3300035111 Bacteria 1714
301 Ga0373945_0006262 3300035116 Bacteria 3833
302 Ga0373945_0011217 3300035116 Bacteria 2961
303 Ga0373953_0003399 3300035117 Bacteria 4951
304 Ga0373954_0012335 3300035118 Bacteria 3798
305 Ga0373954_0215618 3300035118 Bacteria 944
306 Ga0373955_0001896 3300035172 Bacteria 9019
307 Ga0373931_0003254 3300035691 Bacteria 7264
308 Ga0373935_0007600 3300035692 Bacteria 6491
309 Ga0373927_0076975 3300035695 Bacteria 2160
310 Ga0373927_0133595 3300035695 Bacteria 1621
311 Ga0373947_0000123 3300035725 Bacteria 39071
312 Ga0373937_0028977 3300036401 Bacteria 5014
313 Ga0373937_0363057 3300036401 Bacteria 1372
314 Ga0373937_0817583 3300036401 Bacteria 880
315 Ga0373925_0001983 3300037068 Bacteria 16951
316 Ga0373925_0098036 3300037068 Bacteria 2249
317 Ga0436365_1220956 3300039437 Bacteria 2468
318 Ga0436365_1778386 3300039437 Bacteria 944
319 Ga0451577_0036930 3300042876 Bacteria 4398
320 Ga0453683_0122418 3300044673 Bacteria 1638
321 Ga0466963_0099635 3300044694 Bacteria 1988
322 Ga0453684_0000617 3300044712 Bacteria 130120
323 Ga0453684_0065064 3300044712 Bacteria 4652
324 Ga0466959_0050360 3300045049 Bacteria 3058
325 Ga0451576_0027705 3300045051 Bacteria 6083
326 Ga0451576_0056758 3300045051 Bacteria 4094
327 Ga0466958_0080965 3300045836 Bacteria 1998
328 Ga0466967_0349824 3300045976 Bacteria 1430
329 Ga0495592_0005002 3300046454 Bacteria 9760
330 Ga0495603_0021183 3300046455 Bacteria 3936
331 Ga0495629_0007989 3300046459 Bacteria 7784
332 Ga0495629_0018684 3300046459 Bacteria 4955
333 Ga0495629_0104005 3300046459 Bacteria 1981
334 Ga0495641_0033426 3300046461 Bacteria 2441
335 Ga0495651_0003057 3300046462 Bacteria 12913
336 Ga0495653_0008227 3300046463 Bacteria 8546
337 Ga0495580_0000872 3300046472 Bacteria 26075
338 Ga0495580_0055088 3300046472 Bacteria 2803
339 Ga0495582_0004569 3300046473 Bacteria 7772
340 Ga0495582_0083763 3300046473 Bacteria 1772
341 Ga0495639_0000117 3300046475 Bacteria 40157
342 Ga0495594_0004546 3300046499 Bacteria 7137
343 Ga0495594_0012340 3300046499 Bacteria 4451
344 Ga0495594_0141394 3300046499 Bacteria 1365
345 Ga0495628_0005595 3300046516 Bacteria 11000
346 Ga0495630_0001819 3300046517 Bacteria 14876
347 Ga0495630_0041452 3300046517 Bacteria 3438
348 Ga0495666_0026398 3300046526 Bacteria 2863
349 Ga0495652_0134860 3300046529 Bacteria 1949
350 Ga0495652_0194468 3300046529 Bacteria 1545
351 Ga0495665_0000362 3300046531 Bacteria 22903
352 Ga0495665_0137461 3300046531 Bacteria 1278
353 Ga0495640_0085801 3300046533 Bacteria 2086
354 Ga0495586_0036288 3300046535 Bacteria 2646
355 Ga0495586_0186417 3300046535 Bacteria 1175
356 Ga0495587_0003085 3300046536 Bacteria 11130
357 Ga0495645_0002661 3300046543 Bacteria 12139
358 Ga0495645_0004316 3300046543 Bacteria 9715
359 Ga0495667_0007606 3300046559 Bacteria 7355
360 Ga0495634_0100785 3300046642 Bacteria 1866
361 Ga0495635_0016076 3300046663 Bacteria 5226
362 Ga0495635_0211790 3300046663 Bacteria 1312
363 Ga0495657_0161754 3300046675 Bacteria 1385
364 Ga0495599_0003366 3300046678 Bacteria 9344
365 Ga0495599_0020060 3300046678 Bacteria 4164
366 Ga0495658_0000095 3300046683 Bacteria 46039
367 Ga0495658_0083995 3300046683 Unclassified 1874
368 Ga0495613_0022404 3300046689 Bacteria 4708
369 Ga0495600_0016094 3300046809 Bacteria 4741
370 Ga0495600_0042968 3300046809 Bacteria 2946
371 Ga0495600_0096991 3300046809 Bacteria 1922
372 Ga0495581_0000662 3300047315 Bacteria 18083
373 Ga0495581_0042835 3300047315 Bacteria 2619
374 Ga0495604_0004690 3300047317 Bacteria 10841
375 Ga0495674_0090226 3300047319 Bacteria 2619
376 Ga0495680_0025804 3300047322 Bacteria 4858
377 Ga0495675_0005691 3300047444 Bacteria 7616
378 Ga0495675_0044344 3300047444 Bacteria 2833
379 Ga0495677_0054342 3300047445 Unclassified 1477
380 Ga0495684_0007844 3300047471 Bacteria 8261
381 Ga0495684_0341160 3300047471 Bacteria 1066
382 Ga0495593_0000896 3300047673 Bacteria 17308
383 Ga0495602_0072044 3300048088 Bacteria 2948
384 Ga0495614_0000104 3300048089 Bacteria 28897
385 Ga0496101_0072742 3300048904 Bacteria 2524
386 Ga0496102_0002168 3300048905 Bacteria 16849
387 Ga0496103_0010140 3300048906 Bacteria 5571
388 Ga0496104_0018711 3300048907 Bacteria 6322
389 Ga0496105_0106207 3300048908 Bacteria 2318
390 Ga0496106_0030552 3300048909 Bacteria 4015
391 Ga0496108_0140132 3300048911 Bacteria 2083
392 Ga0496109_0005313 3300048912 Bacteria 10765
393 Ga0496110_0029093 3300048913 Bacteria 4750
394 Ga0496111_0004841 3300048914 Bacteria 8541
395 Ga0496112_0005923 3300048915 Bacteria 10661
396 Ga0496112_0035687 3300048915 Bacteria 4846
397 Ga0496113_0001879 3300048916 Bacteria 11973
398 Ga0496115_0010495 3300048918 Bacteria 6923
399 Ga0496115_0131245 3300048918 Bacteria 2065
400 Ga0496119_0246071 3300048922 Unclassified 903
401 Ga0501031_0000459 3300049568 Bacteria 23626
402 Ga0501033_0000005 3300049570 Bacteria 379089
403 Ga0501034_0000259 3300049571 Bacteria 95584
404 Ga0501034_0237906 3300049571 Bacteria 1768
405 Ga0501036_0007883 3300049572 Bacteria 8711
406 Ga0501037_0132183 3300049573 Bacteria 1789
407 Ga0501038_0007600 3300049574 Bacteria 9995
408 Ga0501039_0002829 3300049575 Bacteria 12972
409 Ga0501043_0008234 3300049579 Bacteria 8216
410 Ga0501047_0163276 3300049581 Bacteria 2099
411 Ga0501047_0212237 3300049581 Bacteria 1794
412 Ga0501070_0187825 3300049586 Bacteria 1699
413 Ga0501235_002543 3300049669 Bacteria 3925
414 Ga0501225_0000715 3300049705 Bacteria 10435
415 Ga0501080_0779468 3300049742 Bacteria 840
416 Ga0501035_0010943 3300049822 Bacteria 8402
417 Ga0501044_0030786 3300049823 Bacteria 5652
418 Ga0501044_0546151 3300049823 Bacteria 1056
419 Ga0501045_0000307 3300049824 Bacteria 28643
420 nmdc:mga05p37_113417_c1 3300050507 Bacteria 3333
421 nmdc:mga05p37_32338_c1 3300050507 Bacteria 4450
422 nmdc:mga05p37_641669_c1 3300050507 Bacteria 1191
423 nmdc:mga09592_1400_c1 3300050508 Bacteria 19294
424 nmdc:mga09592_325960_c1 3300050508 Bacteria 1330
425 nmdc:mga08y16_158556_c1 3300050511 Bacteria 2351
426 nmdc:mga0n895_215246_c1 3300050512 Bacteria 1951
427 nmdc:mga0rr50_382474_c1 3300050513 Bacteria 1187
428 nmdc:mga0a205_102838_c1 3300050515 Bacteria 2755
429 nmdc:mga0a205_71927_c1 3300050515 Bacteria 3340
430 Ga0495601_0281812 3300053077 Bacteria 1083
431 Ga0495612_0000807 3300053078 Bacteria 12764
432 Ga0495595_0170529 3300053084 Bacteria 1077
433 Ga0495619_0003992 3300053085 Bacteria 9457

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048922 Ga0496119_0246071 Ga0496119_0246071_116_865 234
2 3300005546 Ga0070696_100000366 Ga0070696_10000036614 236
3 3300005471 Ga0070698_100164770 Ga0070698_1001647703 241
4 3300005518 Ga0070699_100137468 Ga0070699_1001374683 241
5 3300006844 Ga0075428_100033832 Ga0075428_1000338324 241
6 3300009147 Ga0114129_10005319 Ga0114129_1000531924 241
7 3300049742 Ga0501080_0779468 Ga0501080_0779468_43_768 241
8 3300050507 nmdc:mga05p37_641669_c1 nmdc:mga05p37_641669_c1_233_958 241
9 3300049705 Ga0501225_0000715 Ga0501225_0000715_164_895 242
10 3300025912 Ga0207707_10226105 Ga0207707_102261052 244
11 3300005530 Ga0070679_100485221 Ga0070679_1004852211 245
12 3300039437 Ga0436365_1778386 Ga0436365_1778386_88_831 245
13 3300005530 Ga0070679_100133562 Ga0070679_1001335624 246
14 3300005563 Ga0068855_100107945 Ga0068855_1001079452 246
15 3300006173 Ga0070716_100429362 Ga0070716_1004293621 246
16 3300025921 Ga0207652_10008351 Ga0207652_100083519 246
17 3300025926 Ga0207659_10178656 Ga0207659_101786562 246
18 3300025939 Ga0207665_10557119 Ga0207665_105571191 246
19 3300025949 Ga0207667_10178852 Ga0207667_101788522 246
20 3300028800 Ga0265338_10086652 Ga0265338_100866523 246
21 3300035083 Ga0373926_0002415 Ga0373926_0002415_4417_5166 246
22 3300035089 Ga0373944_0061311 Ga0373944_0061311_76_825 246
23 3300035116 Ga0373945_0006262 Ga0373945_0006262_1271_2020 246
24 3300035692 Ga0373935_0007600 Ga0373935_0007600_4895_5644 246
25 3300035725 Ga0373947_0000123 Ga0373947_0000123_37438_38187 246
26 3300037068 Ga0373925_0001983 Ga0373925_0001983_3545_4294 246
27 3300046455 Ga0495603_0021183 Ga0495603_0021183_1133_1882 246
28 3300046459 Ga0495629_0007989 Ga0495629_0007989_1329_2078 246
29 3300046461 Ga0495641_0033426 Ga0495641_0033426_936_1685 246
30 3300046472 Ga0495580_0000872 Ga0495580_0000872_13356_14105 246
31 3300046475 Ga0495639_0000117 Ga0495639_0000117_1178_1927 246
32 3300046517 Ga0495630_0001819 Ga0495630_0001819_3293_4042 246
33 3300046531 Ga0495665_0000362 Ga0495665_0000362_15436_16185 246
34 3300046663 Ga0495635_0211790 Ga0495635_0211790_270_1019 246
35 3300046683 Ga0495658_0000095 Ga0495658_0000095_10490_11239 246
36 3300046689 Ga0495613_0022404 Ga0495613_0022404_1442_2191 246
37 3300047315 Ga0495581_0000662 Ga0495581_0000662_2190_2939 246
38 3300047673 Ga0495593_0000896 Ga0495593_0000896_1959_2708 246
39 3300048089 Ga0495614_0000104 Ga0495614_0000104_10467_11216 246
40 3300005336 Ga0070680_100049855 Ga0070680_1000498553 247
41 3300005458 Ga0070681_10027504 Ga0070681_100275046 247
42 3300005530 Ga0070679_100007387 Ga0070679_1000073872 247
43 3300025917 Ga0207660_10031074 Ga0207660_100310743 247
44 3300025921 Ga0207652_10037839 Ga0207652_100378396 247
45 3300036401 Ga0373937_0817583 Ga0373937_0817583_49_798 247
46 3300046459 Ga0495629_0104005 Ga0495629_0104005_570_1319 247
47 3300005330 Ga0070690_100067031 Ga0070690_1000670313 248
48 3300005334 Ga0068869_100095379 Ga0068869_1000953793 248
49 3300005343 Ga0070687_100026770 Ga0070687_1000267703 248
50 3300005354 Ga0070675_100133232 Ga0070675_1001332322 248
51 3300005354 Ga0070675_100260328 Ga0070675_1002603282 248
52 3300005436 Ga0070713_100010218 Ga0070713_1000102186 248
53 3300005438 Ga0070701_10094470 Ga0070701_100944702 248
54 3300005466 Ga0070685_10189256 Ga0070685_101892562 248
55 3300005544 Ga0070686_100143901 Ga0070686_1001439012 248
56 3300006844 Ga0075428_100104380 Ga0075428_1001043802 248
57 3300006847 Ga0075431_100024684 Ga0075431_1000246843 248
58 3300006852 Ga0075433_10119938 Ga0075433_101199383 248
59 3300006871 Ga0075434_100021100 Ga0075434_1000211006 248
60 3300009147 Ga0114129_10002529 Ga0114129_1000252923 248
61 3300009176 Ga0105242_10123309 Ga0105242_101233093 248
62 3300009177 Ga0105248_10160471 Ga0105248_101604713 248
63 3300013306 Ga0163162_10224517 Ga0163162_102245172 248
64 3300014969 Ga0157376_10424653 Ga0157376_104246531 248
65 3300025893 Ga0207682_10130836 Ga0207682_101308362 248
66 3300025918 Ga0207662_10044367 Ga0207662_100443673 248
67 3300025925 Ga0207650_10457596 Ga0207650_104575962 248
68 3300025928 Ga0207700_10018297 Ga0207700_100182973 248
69 3300025940 Ga0207691_10084368 Ga0207691_100843683 248
70 3300025941 Ga0207711_10220999 Ga0207711_102209993 248
71 3300025942 Ga0207689_10008190 Ga0207689_100081905 248
72 3300026121 Ga0207683_10055172 Ga0207683_100551724 248
73 3300027471 Ga0209995_1009997 Ga0209995_10099973 248
74 3300035086 Ga0373934_0077927 Ga0373934_0077927_63_815 248
75 3300035118 Ga0373954_0215618 Ga0373954_0215618_31_783 248
76 3300036401 Ga0373937_0028977 Ga0373937_0028977_3264_4016 248
77 3300046529 Ga0495652_0194468 Ga0495652_0194468_509_1261 248
78 3300046535 Ga0495586_0186417 Ga0495586_0186417_49_801 248
79 3300046536 Ga0495587_0003085 Ga0495587_0003085_8485_9237 248
80 3300046543 Ga0495645_0002661 Ga0495645_0002661_5412_6164 248
81 3300046559 Ga0495667_0007606 Ga0495667_0007606_3506_4258 248
82 3300046675 Ga0495657_0161754 Ga0495657_0161754_472_1224 248
83 3300046678 Ga0495599_0020060 Ga0495599_0020060_1625_2377 248
84 3300046809 Ga0495600_0016094 Ga0495600_0016094_1412_2164 248
85 3300047444 Ga0495675_0044344 Ga0495675_0044344_1624_2376 248
86 3300047471 Ga0495684_0341160 Ga0495684_0341160_48_800 248
87 3300050507 nmdc:mga05p37_113417_c1 nmdc:mga05p37_113417_c1_2355_3101 248
88 3300050508 nmdc:mga09592_325960_c1 nmdc:mga09592_325960_c1_528_1274 248
89 3300050515 nmdc:mga0a205_102838_c1 nmdc:mga0a205_102838_c1_1459_2205 248
90 3300053084 Ga0495595_0170529 Ga0495595_0170529_19_771 248
91 2162886012 MBSR1b_contig_11525244 MBSR1b_0874.00003870 249
92 3300001976 JGI24752J21851_1011473 JGI24752J21851_10114732 249
93 3300005293 Ga0065715_10094976 Ga0065715_100949763 249
94 3300005327 Ga0070658_10083078 Ga0070658_100830783 249
95 3300005327 Ga0070658_10148970 Ga0070658_101489702 249
96 3300005328 Ga0070676_10049070 Ga0070676_100490703 249
97 3300005329 Ga0070683_100002016 Ga0070683_10000201611 249
98 3300005329 Ga0070683_100007884 Ga0070683_1000078845 249
99 3300005329 Ga0070683_100031558 Ga0070683_1000315585 249
100 3300005329 Ga0070683_100044917 Ga0070683_1000449173 249
101 3300005329 Ga0070683_100054480 Ga0070683_1000544804 249
102 3300005329 Ga0070683_100129629 Ga0070683_1001296293 249
103 3300005329 Ga0070683_100144030 Ga0070683_1001440303 249
104 3300005329 Ga0070683_100384821 Ga0070683_1003848212 249
105 3300005329 Ga0070683_100573064 Ga0070683_1005730642 249
106 3300005329 Ga0070683_100584708 Ga0070683_1005847082 249
107 3300005330 Ga0070690_100253484 Ga0070690_1002534842 249
108 3300005330 Ga0070690_100410377 Ga0070690_1004103771 249
109 3300005331 Ga0070670_100014874 Ga0070670_1000148745 249
110 3300005334 Ga0068869_100008216 Ga0068869_1000082163 249
111 3300005334 Ga0068869_100086820 Ga0068869_1000868203 249
112 3300005335 Ga0070666_10038854 Ga0070666_100388543 249
113 3300005336 Ga0070680_100022455 Ga0070680_1000224553 249
114 3300005336 Ga0070680_100059190 Ga0070680_1000591903 249
115 3300005337 Ga0070682_100012166 Ga0070682_1000121663 249
116 3300005338 Ga0068868_100036156 Ga0068868_1000361565 249
117 3300005344 Ga0070661_100004608 Ga0070661_1000046085 249
118 3300005344 Ga0070661_100122207 Ga0070661_1001222073 249
119 3300005345 Ga0070692_10061889 Ga0070692_100618893 249
120 3300005347 Ga0070668_100069283 Ga0070668_1000692834 249
121 3300005354 Ga0070675_100014760 Ga0070675_1000147605 249
122 3300005355 Ga0070671_100188857 Ga0070671_1001888572 249
123 3300005364 Ga0070673_100049029 Ga0070673_1000490293 249
124 3300005366 Ga0070659_100011507 Ga0070659_1000115076 249
125 3300005434 Ga0070709_10023174 Ga0070709_100231745 249
126 3300005434 Ga0070709_10073590 Ga0070709_100735903 249
127 3300005434 Ga0070709_10282347 Ga0070709_102823472 249
128 3300005435 Ga0070714_100108379 Ga0070714_1001083793 249
129 3300005435 Ga0070714_100136015 Ga0070714_1001360152 249
130 3300005436 Ga0070713_100000223 Ga0070713_10000022319 249
131 3300005436 Ga0070713_100034995 Ga0070713_1000349955 249
132 3300005436 Ga0070713_100038712 Ga0070713_1000387124 249
133 3300005439 Ga0070711_100238417 Ga0070711_1002384171 249
134 3300005439 Ga0070711_100331387 Ga0070711_1003313872 249
135 3300005440 Ga0070705_100002442 Ga0070705_10000244210 249
136 3300005444 Ga0070694_100060464 Ga0070694_1000604643 249
137 3300005444 Ga0070694_100425217 Ga0070694_1004252171 249
138 3300005445 Ga0070708_100000007 Ga0070708_10000000785 249
139 3300005457 Ga0070662_100009125 Ga0070662_1000091255 249
140 3300005457 Ga0070662_100072180 Ga0070662_1000721803 249
141 3300005458 Ga0070681_10000978 Ga0070681_1000097820 249
142 3300005458 Ga0070681_10027690 Ga0070681_100276903 249
143 3300005467 Ga0070706_100089052 Ga0070706_1000890523 249
144 3300005468 Ga0070707_100084104 Ga0070707_1000841043 249
145 3300005468 Ga0070707_100207869 Ga0070707_1002078693 249
146 3300005471 Ga0070698_100034646 Ga0070698_1000346466 249
147 3300005471 Ga0070698_100058577 Ga0070698_1000585775 249
148 3300005471 Ga0070698_100189417 Ga0070698_1001894173 249
149 3300005471 Ga0070698_100567005 Ga0070698_1005670052 249
150 3300005518 Ga0070699_100000024 Ga0070699_10000002429 249
151 3300005518 Ga0070699_100077816 Ga0070699_1000778164 249
152 3300005530 Ga0070679_100005712 Ga0070679_1000057128 249
153 3300005530 Ga0070679_100025597 Ga0070679_1000255975 249
154 3300005530 Ga0070679_100282586 Ga0070679_1002825863 249
155 3300005535 Ga0070684_100011325 Ga0070684_1000113253 249
156 3300005535 Ga0070684_100054145 Ga0070684_1000541452 249
157 3300005535 Ga0070684_100094069 Ga0070684_1000940693 249
158 3300005535 Ga0070684_100124591 Ga0070684_1001245913 249
159 3300005535 Ga0070684_100129922 Ga0070684_1001299223 249
160 3300005535 Ga0070684_100146634 Ga0070684_1001466341 249
161 3300005535 Ga0070684_100193773 Ga0070684_1001937732 249
162 3300005535 Ga0070684_100556110 Ga0070684_1005561102 249
163 3300005539 Ga0068853_100292729 Ga0068853_1002927292 249
164 3300005539 Ga0068853_100715568 Ga0068853_1007155682 249
165 3300005546 Ga0070696_100010341 Ga0070696_1000103411 249
166 3300005547 Ga0070693_100006198 Ga0070693_1000061983 249
167 3300005547 Ga0070693_100008346 Ga0070693_1000083463 249
168 3300005549 Ga0070704_100000546 Ga0070704_1000005462 249
169 3300005549 Ga0070704_100011501 Ga0070704_1000115017 249
170 3300005563 Ga0068855_100072626 Ga0068855_1000726265 249
171 3300005563 Ga0068855_100137335 Ga0068855_1001373353 249
172 3300005564 Ga0070664_100016569 Ga0070664_1000165695 249
173 3300005577 Ga0068857_100022867 Ga0068857_1000228673 249
174 3300005614 Ga0068856_100054986 Ga0068856_1000549866 249
175 3300005614 Ga0068856_100067511 Ga0068856_1000675114 249
176 3300005616 Ga0068852_100033592 Ga0068852_1000335923 249
177 3300005616 Ga0068852_100512529 Ga0068852_1005125292 249
178 3300005617 Ga0068859_100011471 Ga0068859_1000114714 249
179 3300005617 Ga0068859_100012064 Ga0068859_1000120643 249
180 3300005617 Ga0068859_100035842 Ga0068859_1000358423 249
181 3300005617 Ga0068859_100215199 Ga0068859_1002151992 249
182 3300005617 Ga0068859_100251000 Ga0068859_1002510003 249
183 3300005617 Ga0068859_100597556 Ga0068859_1005975561 249
184 3300005618 Ga0068864_100020285 Ga0068864_1000202853 249
185 3300005719 Ga0068861_100376899 Ga0068861_1003768992 249
186 3300005841 Ga0068863_100016544 Ga0068863_1000165444 249
187 3300005842 Ga0068858_100589253 Ga0068858_1005892532 249
188 3300005843 Ga0068860_100024706 Ga0068860_1000247064 249
189 3300005985 Ga0081539_10000290 Ga0081539_1000029012 249
190 3300006028 Ga0070717_10017368 Ga0070717_100173683 249
191 3300006028 Ga0070717_10092280 Ga0070717_100922803 249
192 3300006173 Ga0070716_100130385 Ga0070716_1001303852 249
193 3300006175 Ga0070712_100157089 Ga0070712_1001570893 249
194 3300006237 Ga0097621_100026170 Ga0097621_1000261705 249
195 3300006358 Ga0068871_100024103 Ga0068871_1000241033 249
196 3300006847 Ga0075431_100017051 Ga0075431_1000170512 249
197 3300006852 Ga0075433_10223162 Ga0075433_102231623 249
198 3300006880 Ga0075429_100002822 Ga0075429_10000282211 249
199 3300006880 Ga0075429_100471453 Ga0075429_1004714532 249
200 3300006881 Ga0068865_100034114 Ga0068865_1000341144 249
201 3300006931 Ga0097620_100011471 Ga0097620_10001147112 249
202 3300006931 Ga0097620_100012064 Ga0097620_1000120643 249
203 3300006931 Ga0097620_100035840 Ga0097620_1000358405 249
204 3300006931 Ga0097620_100215196 Ga0097620_1002151962 249
205 3300006931 Ga0097620_100250984 Ga0097620_1002509843 249
206 3300006931 Ga0097620_100597518 Ga0097620_1005975181 249
207 3300009093 Ga0105240_10118852 Ga0105240_101188523 249
208 3300009094 Ga0111539_10194907 Ga0111539_101949072 249
209 3300009098 Ga0105245_10011794 Ga0105245_100117944 249
210 3300009098 Ga0105245_10740663 Ga0105245_107406632 249
211 3300009147 Ga0114129_10018253 Ga0114129_100182533 249
212 3300009174 Ga0105241_10151771 Ga0105241_101517712 249
213 3300009174 Ga0105241_10336244 Ga0105241_103362441 249
214 3300009176 Ga0105242_10004361 Ga0105242_100043619 249
215 3300009177 Ga0105248_10006255 Ga0105248_1000625510 249
216 3300009177 Ga0105248_10018959 Ga0105248_100189595 249
217 3300009545 Ga0105237_10138392 Ga0105237_101383922 249
218 3300009551 Ga0105238_10021569 Ga0105238_100215696 249
219 3300009553 Ga0105249_10431489 Ga0105249_104314891 249
220 3300009553 Ga0105249_10468096 Ga0105249_104680962 249
221 3300010375 Ga0105239_10008939 Ga0105239_1000893911 249
222 3300011119 Ga0105246_10004459 Ga0105246_100044597 249
223 3300013100 Ga0157373_10052000 Ga0157373_100520003 249
224 3300013102 Ga0157371_10048328 Ga0157371_100483283 249
225 3300013104 Ga0157370_10002257 Ga0157370_1000225717 249
226 3300013104 Ga0157370_10035353 Ga0157370_100353536 249
227 3300013104 Ga0157370_10590245 Ga0157370_105902452 249
228 3300013105 Ga0157369_10095473 Ga0157369_100954733 249
229 3300013105 Ga0157369_10181359 Ga0157369_101813592 249
230 3300013105 Ga0157369_10411850 Ga0157369_104118501 249
231 3300013105 Ga0157369_10488490 Ga0157369_104884903 249
232 3300013296 Ga0157374_10065113 Ga0157374_100651134 249
233 3300013297 Ga0157378_10519897 Ga0157378_105198971 249
234 3300013306 Ga0163162_10059814 Ga0163162_100598145 249
235 3300013306 Ga0163162_10152003 Ga0163162_101520033 249
236 3300013306 Ga0163162_10577020 Ga0163162_105770202 249
237 3300013307 Ga0157372_10002903 Ga0157372_100029032 249
238 3300013307 Ga0157372_10007361 Ga0157372_100073617 249
239 3300013307 Ga0157372_10041041 Ga0157372_100410412 249
240 3300013307 Ga0157372_10043513 Ga0157372_100435133 249
241 3300013307 Ga0157372_10168705 Ga0157372_101687052 249
242 3300013307 Ga0157372_10214074 Ga0157372_102140743 249
243 3300013308 Ga0157375_10027197 Ga0157375_100271973 249
244 3300013308 Ga0157375_10216992 Ga0157375_102169923 249
245 3300014325 Ga0163163_10158670 Ga0163163_101586702 249
246 3300014326 Ga0157380_10421715 Ga0157380_104217152 249
247 3300014745 Ga0157377_10014284 Ga0157377_100142845 249
248 3300014969 Ga0157376_10149935 Ga0157376_101499353 249
249 3300020078 Ga0206352_11185906 Ga0206352_111859062 249
250 3300025315 Ga0207697_10008372 Ga0207697_100083725 249
251 3300025906 Ga0207699_10001315 Ga0207699_1000131510 249
252 3300025906 Ga0207699_10037803 Ga0207699_100378034 249
253 3300025906 Ga0207699_10120239 Ga0207699_101202393 249
254 3300025909 Ga0207705_10064956 Ga0207705_100649563 249
255 3300025911 Ga0207654_10102761 Ga0207654_101027613 249
256 3300025912 Ga0207707_10037085 Ga0207707_100370853 249
257 3300025913 Ga0207695_10066375 Ga0207695_100663753 249
258 3300025915 Ga0207693_10059649 Ga0207693_100596493 249
259 3300025916 Ga0207663_10243841 Ga0207663_102438412 249
260 3300025917 Ga0207660_10126431 Ga0207660_101264313 249
261 3300025920 Ga0207649_10004047 Ga0207649_100040476 249
262 3300025921 Ga0207652_10016297 Ga0207652_100162975 249
263 3300025921 Ga0207652_10263572 Ga0207652_102635722 249
264 3300025921 Ga0207652_10328923 Ga0207652_103289232 249
265 3300025924 Ga0207694_10026192 Ga0207694_100261924 249
266 3300025925 Ga0207650_10031285 Ga0207650_100312852 249
267 3300025925 Ga0207650_10113460 Ga0207650_101134602 249
268 3300025926 Ga0207659_10101099 Ga0207659_101010992 249
269 3300025926 Ga0207659_10131929 Ga0207659_101319293 249
270 3300025927 Ga0207687_10110193 Ga0207687_101101932 249
271 3300025928 Ga0207700_10000633 Ga0207700_100006336 249
272 3300025928 Ga0207700_10035334 Ga0207700_100353344 249
273 3300025928 Ga0207700_10265529 Ga0207700_102655292 249
274 3300025929 Ga0207664_10020800 Ga0207664_100208005 249
275 3300025929 Ga0207664_10060722 Ga0207664_100607224 249
276 3300025929 Ga0207664_10135735 Ga0207664_101357352 249
277 3300025931 Ga0207644_10029711 Ga0207644_100297113 249
278 3300025932 Ga0207690_10050733 Ga0207690_100507333 249
279 3300025933 Ga0207706_10005722 Ga0207706_100057223 249
280 3300025933 Ga0207706_10019828 Ga0207706_100198285 249
281 3300025934 Ga0207686_10061905 Ga0207686_100619053 249
282 3300025936 Ga0207670_10326941 Ga0207670_103269413 249
283 3300025938 Ga0207704_10213004 Ga0207704_102130042 249
284 3300025939 Ga0207665_10085041 Ga0207665_100850413 249
285 3300025941 Ga0207711_10307906 Ga0207711_103079063 249
286 3300025942 Ga0207689_10002072 Ga0207689_1000207214 249
287 3300025944 Ga0207661_10004811 Ga0207661_100048115 249
288 3300025944 Ga0207661_10005194 Ga0207661_100051945 249
289 3300025944 Ga0207661_10074049 Ga0207661_100740493 249
290 3300025944 Ga0207661_10111261 Ga0207661_101112613 249
291 3300025944 Ga0207661_10128162 Ga0207661_101281623 249
292 3300025944 Ga0207661_10217787 Ga0207661_102177872 249
293 3300025945 Ga0207679_10003073 Ga0207679_100030735 249
294 3300025949 Ga0207667_10098163 Ga0207667_100981633 249
295 3300025949 Ga0207667_10308578 Ga0207667_103085781 249
296 3300025960 Ga0207651_10021159 Ga0207651_100211593 249
297 3300025961 Ga0207712_10087816 Ga0207712_100878163 249
298 3300025961 Ga0207712_10315354 Ga0207712_103153542 249
299 3300026023 Ga0207677_10088770 Ga0207677_100887703 249
300 3300026035 Ga0207703_10646822 Ga0207703_106468222 249
301 3300026041 Ga0207639_10252210 Ga0207639_102522102 249
302 3300026041 Ga0207639_10354144 Ga0207639_103541442 249
303 3300026078 Ga0207702_10044326 Ga0207702_100443264 249
304 3300026078 Ga0207702_10174180 Ga0207702_101741803 249
305 3300026088 Ga0207641_10017493 Ga0207641_100174933 249
306 3300026088 Ga0207641_10101119 Ga0207641_101011193 249
307 3300026089 Ga0207648_10098118 Ga0207648_100981182 249
308 3300026095 Ga0207676_10015349 Ga0207676_100153493 249
309 3300026116 Ga0207674_10001365 Ga0207674_100013656 249
310 3300026116 Ga0207674_10102115 Ga0207674_101021153 249
311 3300026116 Ga0207674_10686390 Ga0207674_106863902 249
312 3300026118 Ga0207675_100245823 Ga0207675_1002458232 249
313 3300026142 Ga0207698_10096031 Ga0207698_100960312 249
314 3300026142 Ga0207698_10455521 Ga0207698_104555211 249
315 3300027462 Ga0210000_1019352 Ga0210000_10193522 249
316 3300027471 Ga0209995_1003730 Ga0209995_10037304 249
317 3300028379 Ga0268266_10076947 Ga0268266_100769473 249
318 3300028380 Ga0268265_10056253 Ga0268265_100562534 249
319 3300028380 Ga0268265_10104789 Ga0268265_101047893 249
320 3300028381 Ga0268264_10009948 Ga0268264_100099485 249
321 3300028381 Ga0268264_10522391 Ga0268264_105223912 249
322 3300031238 Ga0265332_10017263 Ga0265332_100172633 249
323 3300031251 Ga0265327_10033939 Ga0265327_100339393 249
324 3300031727 Ga0316576_10368767 Ga0316576_103687672 249
325 3300031731 Ga0307405_10053691 Ga0307405_100536914 249
326 3300031824 Ga0307413_10081931 Ga0307413_100819313 249
327 3300031824 Ga0307413_10121918 Ga0307413_101219182 249
328 3300031824 Ga0307413_10186023 Ga0307413_101860233 249
329 3300031824 Ga0307413_10285561 Ga0307413_102855612 249
330 3300031852 Ga0307410_10153310 Ga0307410_101533102 249
331 3300031901 Ga0307406_10061282 Ga0307406_100612823 249
332 3300031903 Ga0307407_10034797 Ga0307407_100347973 249
333 3300031903 Ga0307407_10046212 Ga0307407_100462122 249
334 3300031903 Ga0307407_10132414 Ga0307407_101324142 249
335 3300031911 Ga0307412_10012283 Ga0307412_100122835 249
336 3300031911 Ga0307412_10048180 Ga0307412_100481803 249
337 3300031995 Ga0307409_100177420 Ga0307409_1001774203 249
338 3300032002 Ga0307416_100005833 Ga0307416_1000058336 249
339 3300032004 Ga0307414_10357480 Ga0307414_103574802 249
340 3300035111 Ga0373923_0052388 Ga0373923_0052388_622_1374 249
341 3300035116 Ga0373945_0011217 Ga0373945_0011217_1485_2249 249
342 3300035117 Ga0373953_0003399 Ga0373953_0003399_1240_1992 249
343 3300035118 Ga0373954_0012335 Ga0373954_0012335_554_1306 249
344 3300035172 Ga0373955_0001896 Ga0373955_0001896_7630_8382 249
345 3300035691 Ga0373931_0003254 Ga0373931_0003254_3242_3997 249
346 3300035695 Ga0373927_0076975 Ga0373927_0076975_1323_2087 249
347 3300035695 Ga0373927_0133595 Ga0373927_0133595_43_798 249
348 3300036401 Ga0373937_0363057 Ga0373937_0363057_93_845 249
349 3300037068 Ga0373925_0098036 Ga0373925_0098036_160_924 249
350 3300039437 Ga0436365_1220956 Ga0436365_1220956_751_1506 249
351 3300042876 Ga0451577_0036930 Ga0451577_0036930_149_904 249
352 3300044673 Ga0453683_0122418 Ga0453683_0122418_484_1248 249
353 3300044694 Ga0466963_0099635 Ga0466963_0099635_1171_1926 249
354 3300044712 Ga0453684_0000617 Ga0453684_0000617_109443_110204 249
355 3300044712 Ga0453684_0065064 Ga0453684_0065064_3124_3879 249
356 3300045049 Ga0466959_0050360 Ga0466959_0050360_2083_2835 249
357 3300045051 Ga0451576_0027705 Ga0451576_0027705_4346_5101 249
358 3300045051 Ga0451576_0056758 Ga0451576_0056758_2244_3008 249
359 3300045836 Ga0466958_0080965 Ga0466958_0080965_836_1588 249
360 3300045976 Ga0466967_0349824 Ga0466967_0349824_419_1174 249
361 3300046454 Ga0495592_0005002 Ga0495592_0005002_7918_8670 249
362 3300046459 Ga0495629_0018684 Ga0495629_0018684_1991_2758 249
363 3300046462 Ga0495651_0003057 Ga0495651_0003057_8314_9066 249
364 3300046463 Ga0495653_0008227 Ga0495653_0008227_294_1046 249
365 3300046472 Ga0495580_0055088 Ga0495580_0055088_1783_2547 249
366 3300046473 Ga0495582_0004569 Ga0495582_0004569_2715_3482 249
367 3300046473 Ga0495582_0083763 Ga0495582_0083763_248_1012 249
368 3300046499 Ga0495594_0004546 Ga0495594_0004546_3114_3869 249
369 3300046499 Ga0495594_0012340 Ga0495594_0012340_1302_2063 249
370 3300046499 Ga0495594_0141394 Ga0495594_0141394_132_887 249
371 3300046516 Ga0495628_0005595 Ga0495628_0005595_8313_9065 249
372 3300046517 Ga0495630_0041452 Ga0495630_0041452_1164_1916 249
373 3300046526 Ga0495666_0026398 Ga0495666_0026398_769_1533 249
374 3300046529 Ga0495652_0134860 Ga0495652_0134860_550_1302 249
375 3300046531 Ga0495665_0137461 Ga0495665_0137461_160_915 249
376 3300046533 Ga0495640_0085801 Ga0495640_0085801_380_1132 249
377 3300046535 Ga0495586_0036288 Ga0495586_0036288_1780_2535 249
378 3300046543 Ga0495645_0004316 Ga0495645_0004316_7501_8253 249
379 3300046642 Ga0495634_0100785 Ga0495634_0100785_378_1130 249
380 3300046663 Ga0495635_0016076 Ga0495635_0016076_3821_4573 249
381 3300046678 Ga0495599_0003366 Ga0495599_0003366_7927_8679 249
382 3300046683 Ga0495658_0083995 Ga0495658_0083995_919_1686 249
383 3300046809 Ga0495600_0042968 Ga0495600_0042968_1542_2294 249
384 3300046809 Ga0495600_0096991 Ga0495600_0096991_932_1699 249
385 3300047315 Ga0495581_0042835 Ga0495581_0042835_522_1286 249
386 3300047317 Ga0495604_0004690 Ga0495604_0004690_8467_9219 249
387 3300047319 Ga0495674_0090226 Ga0495674_0090226_537_1289 249
388 3300047322 Ga0495680_0025804 Ga0495680_0025804_1447_2199 249
389 3300047444 Ga0495675_0005691 Ga0495675_0005691_652_1404 249
390 3300047445 Ga0495677_0054342 Ga0495677_0054342_422_1177 249
391 3300047471 Ga0495684_0007844 Ga0495684_0007844_7348_8100 249
392 3300048088 Ga0495602_0072044 Ga0495602_0072044_926_1678 249
393 3300048904 Ga0496101_0072742 Ga0496101_0072742_400_1149 249
394 3300048905 Ga0496102_0002168 Ga0496102_0002168_10430_11179 249
395 3300048906 Ga0496103_0010140 Ga0496103_0010140_4513_5262 249
396 3300048907 Ga0496104_0018711 Ga0496104_0018711_1406_2155 249
397 3300048908 Ga0496105_0106207 Ga0496105_0106207_1250_1999 249
398 3300048909 Ga0496106_0030552 Ga0496106_0030552_2969_3718 249
399 3300048911 Ga0496108_0140132 Ga0496108_0140132_1185_1934 249
400 3300048912 Ga0496109_0005313 Ga0496109_0005313_5289_6038 249
401 3300048913 Ga0496110_0029093 Ga0496110_0029093_3427_4176 249
402 3300048914 Ga0496111_0004841 Ga0496111_0004841_3523_4272 249
403 3300048915 Ga0496112_0005923 Ga0496112_0005923_633_1388 249
404 3300048915 Ga0496112_0035687 Ga0496112_0035687_4081_4830 249
405 3300048916 Ga0496113_0001879 Ga0496113_0001879_3835_4584 249
406 3300048918 Ga0496115_0010495 Ga0496115_0010495_5009_5758 249
407 3300048918 Ga0496115_0131245 Ga0496115_0131245_1103_1885 249
408 3300049568 Ga0501031_0000459 Ga0501031_0000459_7914_8672 249
409 3300049570 Ga0501033_0000005 Ga0501033_0000005_172461_173219 249
410 3300049571 Ga0501034_0000259 Ga0501034_0000259_11791_12549 249
411 3300049571 Ga0501034_0237906 Ga0501034_0237906_235_990 249
412 3300049572 Ga0501036_0007883 Ga0501036_0007883_5617_6375 249
413 3300049573 Ga0501037_0132183 Ga0501037_0132183_858_1616 249
414 3300049574 Ga0501038_0007600 Ga0501038_0007600_2947_3705 249
415 3300049575 Ga0501039_0002829 Ga0501039_0002829_2878_3636 249
416 3300049579 Ga0501043_0008234 Ga0501043_0008234_4690_5448 249
417 3300049581 Ga0501047_0163276 Ga0501047_0163276_1214_1972 249
418 3300049581 Ga0501047_0212237 Ga0501047_0212237_458_1213 249
419 3300049586 Ga0501070_0187825 Ga0501070_0187825_117_872 249
420 3300049669 Ga0501235_002543 Ga0501235_002543_843_1595 249
421 3300049822 Ga0501035_0010943 Ga0501035_0010943_7510_8268 249
422 3300049823 Ga0501044_0030786 Ga0501044_0030786_1710_2468 249
423 3300049823 Ga0501044_0546151 Ga0501044_0546151_144_899 249
424 3300049824 Ga0501045_0000307 Ga0501045_0000307_22105_22863 249
425 3300050507 nmdc:mga05p37_32338_c1 nmdc:mga05p37_32338_c1_1909_2688 249
426 3300050508 nmdc:mga09592_1400_c1 nmdc:mga09592_1400_c1_10243_11022 249
427 3300050511 nmdc:mga08y16_158556_c1 nmdc:mga08y16_158556_c1_1510_2265 249
428 3300050512 nmdc:mga0n895_215246_c1 nmdc:mga0n895_215246_c1_12_764 249
429 3300050513 nmdc:mga0rr50_382474_c1 nmdc:mga0rr50_382474_c1_32_805 249
430 3300050515 nmdc:mga0a205_71927_c1 nmdc:mga0a205_71927_c1_586_1335 249
431 3300053077 Ga0495601_0281812 Ga0495601_0281812_230_982 249
432 3300053078 Ga0495612_0000807 Ga0495612_0000807_3547_4299 249
433 3300053085 Ga0495619_0003992 Ga0495619_0003992_7392_8144 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05138

PaaA_PaaC

Phenylacetic acid catabolic protein

42

301

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pwq-assembly5.cif.gz_K the phenylacetyl-coa monooxygenase paaac subcomplex 0.9864 6 238
3pwq-assembly5.cif.gz_K the phenylacetyl-coa monooxygenase paaac subcomplex 0.974 6 238
4iit-assembly1.cif.gz_C-2 the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa 0.9733 3 249
4ii4-assembly1.cif.gz_C the phenylacetyl-coa monooxygenase - mutant paaa e49q k68q - paac wild type subcomplex with benzoyl-coa 0.9713 1 249
4ii4-assembly1.cif.gz_C the phenylacetyl-coa monooxygenase - mutant paaa e49q k68q - paac wild type subcomplex with benzoyl-coa 0.9675 1 249
ID Description Score Start End Superfamily
3pwqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9708 1 249 1.20.1260.10
3pwqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.967 1 249 1.20.1260.10
3pwqH00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8358 4 243 1.20.1260.10
3pwqH00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.805 4 243 1.20.1260.10
4mudC00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.778 4 209 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A699WU94-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaI 0.9974 39 159 GO:0005829
GO:0010124
AF-A0A3D0ZKV3-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaI 0.993 102 199 GO:0005829
GO:0010124
AF-A0A6N8PLU7-F1-model_v4 deleted 0.9917 90 215
AF-A0A4Q2LMM2-F1-model_v4 deleted 0.9909 50 138
AF-A0A377CVP2-F1-model_v4 Multicomponent oxygenase/reductase subunit for phenylacetic acid degradation 0.9892 61 174 GO:0005829
GO:0010124

Feature Viewer

pLDDT pTM Quality
94.11 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map