F442841

General Info

Members Datasets Scaffolds Average Seq Length
433 301 372 401

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10037859|Ga0157375_100378596
Length 408
Sequence VIAMDTILVVNAGSSSVKFQVFGVDGDGRLRRQIKGQMDGIGSRPRLRAADAAGDTMADRAYPIEAVPDVPAALMLASAWLRDELRLSPLAVGHRVVHGGPDYDRPVLIDHGTIARLERFTALAPLHQPHNLAPIRSLLANFPALPQVACFDTAFHRNHDEVADHYAIPRRLHEEGIRRYGFHGLSYEYIAGVLPNVAPEIAKGRVIVAHLGSGASMCAIHGGRSVESTMGFTALDGLPMGTRTGQIDPGVVLYLMTAKGMSAAEVQEFLYRDCGLKGLSGVSNDMRELQHSSDPRAAFAVDYFVYRVALQAGMLAAALQGLDGFVFTAGIGENSVGIRARIAERLEWLGVSLDPVENARSASLISREGSQIPVYVVPTDEELMIAQHTLSLLWNRHPSSSPKRERAS

Samples

Sample ID Description Type Environment
1 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
4 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
5 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
6 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
7 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
8 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
9 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
10 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
11 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
12 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
13 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
14 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
15 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
16 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
17 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
18 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
19 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
20 2922368715
21 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
22 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
23 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
24 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
25 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
26 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
27 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
28 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
29 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
30 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
31 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
32 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
33 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
34 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
35 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
36 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
37 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
38 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
39 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
40 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
41 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
42 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
43 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
44 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
45 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
46 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
47 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
48 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
49 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
50 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
51 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
52 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
53 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
54 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
55 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
56 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
57 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
58 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
59 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
60 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
61 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
62 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
69 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
73 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
111 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
155 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
160 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
161 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
169 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
170 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
173 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
174 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
175 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
176 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
191 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
210 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
218 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
226 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
230 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
231 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
232 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
237 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
238 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
239 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
260 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
261 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
262 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
263 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
264 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
265 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
266 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
267 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
282 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
283 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
284 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
285 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
286 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
287 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
288 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
289 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
290 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
291 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
292 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
293 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
294 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
295 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
296 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
297 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
298 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
299 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
300 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
301 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.11
Metatranscriptomes 0
Isolates 13.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.54
Nodule 11.55
Rhizoplane 7.62
Rhizosphere 66.05
Stem 0
Stem Tuber 0
Unclassified 9.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10001700 3300003215 Bacteria 13064
2 JGI25160J50197_1000954 3300003354 Bacteria 15154
3 Ga0070658_10011820 3300005327 Bacteria 7007
4 Ga0070658_10041261 3300005327 Bacteria 3723
5 Ga0070683_100000244 3300005329 Bacteria 37279
6 Ga0070683_100038701 3300005329 Bacteria 4373
7 Ga0070680_100000715 3300005336 Bacteria 23059
8 Ga0070660_100001964 3300005339 Bacteria 14177
9 Ga0070691_10060095 3300005341 Bacteria 1827
10 Ga0070709_10000274 3300005434 Bacteria 33042
11 Ga0070714_100002601 3300005435 Bacteria 13308
12 Ga0070713_100028315 3300005436 Bacteria 4424
13 Ga0070710_10000279 3300005437 Bacteria 24157
14 Ga0070711_100000568 3300005439 Bacteria 19319
15 Ga0070711_100005497 3300005439 Bacteria 7583
16 Ga0070678_100103997 3300005456 Bacteria 2207
17 Ga0070681_10031480 3300005458 Bacteria 5326
18 Ga0070706_100050349 3300005467 Bacteria 3844
19 Ga0070698_100212144 3300005471 Bacteria 1871
20 Ga0070679_100020332 3300005530 Bacteria 6470
21 Ga0070679_100107246 3300005530 Bacteria 2779
22 Ga0070684_100001779 3300005535 Bacteria 15735
23 Ga0070684_100067288 3300005535 Bacteria 3146
24 Ga0070697_100013347 3300005536 Bacteria 6444
25 Ga0070695_100173175 3300005545 Bacteria 1524
26 Ga0070665_100011784 3300005548 Bacteria 8831
27 Ga0068855_100024006 3300005563 Bacteria 7300
28 Ga0068855_100048340 3300005563 Bacteria 5021
29 Ga0068857_100005328 3300005577 Bacteria 10954
30 Ga0068859_100029372 3300005617 Bacteria 5516
31 Ga0068866_10041952 3300005718 Bacteria 2274
32 Ga0068851_10003440 3300005834 Bacteria 7047
33 Ga0068870_10037345 3300005840 Bacteria 2504
34 Ga0068860_100000223 3300005843 Bacteria 88152
35 Ga0068862_100009704 3300005844 Bacteria 7957
36 Ga0081540_1003096 3300005983 Bacteria 13322
37 Ga0081540_1006280 3300005983 Bacteria 8696
38 Ga0081540_1009914 3300005983 Bacteria 6499
39 Ga0097621_100263649 3300006237 Bacteria 1512
40 Ga0097620_100029369 3300006931 Bacteria 5516
41 Ga0099794_10020651 3300007265 Bacteria 2983
42 Ga0099795_10000287 3300007788 Bacteria 9029
43 Ga0099795_10007224 3300007788 Bacteria 3085
44 Ga0099795_10030700 3300007788 Bacteria 1847
45 Ga0105240_10003096 3300009093 Bacteria 26156
46 Ga0105240_10269329 3300009093 Bacteria 1962
47 Ga0111539_10041179 3300009094 Bacteria 5555
48 Ga0105245_10029481 3300009098 Bacteria 4849
49 Ga0105243_10162565 3300009148 Bacteria 1926
50 Ga0105243_10317470 3300009148 Bacteria 1418
51 Ga0105241_10034894 3300009174 Bacteria 3782
52 Ga0105242_10087361 3300009176 Bacteria 2618
53 Ga0105242_10149751 3300009176 Bacteria 2034
54 Ga0105248_10177054 3300009177 Bacteria 2403
55 Ga0105237_10002350 3300009545 Bacteria 23518
56 Ga0105237_10015172 3300009545 Bacteria 8028
57 Ga0105237_10331344 3300009545 Bacteria 1526
58 Ga0105238_10000408 3300009551 Bacteria 45693
59 Ga0105238_10005340 3300009551 Bacteria 12696
60 Ga0105238_10297603 3300009551 Bacteria 1597
61 Ga0105249_10211828 3300009553 Bacteria 1902
62 Ga0099796_10000343 3300010159 Bacteria 7538
63 Ga0099796_10002003 3300010159 Bacteria 4339
64 Ga0105239_10026031 3300010375 Bacteria 6441
65 Ga0105239_10039905 3300010375 Bacteria 5142
66 Ga0105239_10049244 3300010375 Bacteria 4620
67 Ga0105239_10239805 3300010375 Bacteria 2035
68 Ga0105246_10006978 3300011119 Bacteria 6908
69 Ga0105246_10141625 3300011119 Bacteria 1809
70 Ga0105246_10206284 3300011119 Bacteria 1531
71 Ga0157370_10001125 3300013104 Bacteria 33417
72 Ga0157369_10000685 3300013105 Bacteria 43830
73 Ga0157369_10029295 3300013105 Bacteria 6086
74 Ga0157369_10333207 3300013105 Bacteria 1576
75 Ga0157374_10045871 3300013296 Bacteria 4045
76 Ga0163162_10045627 3300013306 Bacteria 4390
77 Ga0163162_10114575 3300013306 Bacteria 2795
78 Ga0163162_10140413 3300013306 Bacteria 2529
79 Ga0163162_10363492 3300013306 Bacteria 1580
80 Ga0157375_10037859 3300013308 Bacteria 4626
81 Ga0157375_10060979 3300013308 Bacteria 3743
82 Ga0163163_10139360 3300014325 Bacteria 2467
83 Ga0157380_10028059 3300014326 Bacteria 4288
84 Ga0157376_10301175 3300014969 Bacteria 1518
85 Ga0209148_1001243 3300025254 Bacteria 14218
86 Ga0209233_1016756 3300025261 Bacteria 2012
87 Ga0209455_1002061 3300025272 Bacteria 8124
88 Ga0209673_1011522 3300025273 Bacteria 3640
89 Ga0209564_1003985 3300025295 Bacteria 9373
90 Ga0209758_1003003 3300025297 Bacteria 16152
91 Ga0207426_1000596 3300025302 Bacteria 47621
92 Ga0207656_10005202 3300025321 Bacteria 4577
93 Ga0207692_10002196 3300025898 Bacteria 7463
94 Ga0207642_10076278 3300025899 Bacteria 1613
95 Ga0207699_10000285 3300025906 Bacteria 27688
96 Ga0207643_10016657 3300025908 Bacteria 4009
97 Ga0207705_10021164 3300025909 Bacteria 4639
98 Ga0207684_10029390 3300025910 Bacteria 4681
99 Ga0207707_10000126 3300025912 Bacteria 78954
100 Ga0207707_10058791 3300025912 Bacteria 3345
101 Ga0207671_10030990 3300025914 Bacteria 3987
102 Ga0207671_10167986 3300025914 Bacteria 1702
103 Ga0207693_10038436 3300025915 Bacteria 3769
104 Ga0207663_10001369 3300025916 Bacteria 11308
105 Ga0207663_10005276 3300025916 Bacteria 6506
106 Ga0207660_10008935 3300025917 Bacteria 6484
107 Ga0207657_10000261 3300025919 Bacteria 55977
108 Ga0207652_10000994 3300025921 Bacteria 26203
109 Ga0207652_10053657 3300025921 Bacteria 3463
110 Ga0207694_10008232 3300025924 Bacteria 7882
111 Ga0207694_10012454 3300025924 Bacteria 6411
112 Ga0207687_10032821 3300025927 Bacteria 3518
113 Ga0207700_10020158 3300025928 Bacteria 4521
114 Ga0207664_10004606 3300025929 Bacteria 9346
115 Ga0207686_10079656 3300025934 Bacteria 2134
116 Ga0207670_10124811 3300025936 Bacteria 1877
117 Ga0207704_10053561 3300025938 Bacteria 2454
118 Ga0207689_10001027 3300025942 Bacteria 26845
119 Ga0207689_10008518 3300025942 Bacteria 8942
120 Ga0207661_10002724 3300025944 Bacteria 12164
121 Ga0207661_10053812 3300025944 Bacteria 3223
122 Ga0207679_10038975 3300025945 Bacteria 3391
123 Ga0207667_10005359 3300025949 Bacteria 15636
124 Ga0207712_10046408 3300025961 Bacteria 3012
125 Ga0207668_10011846 3300025972 Bacteria 5316
126 Ga0207668_10197720 3300025972 Bacteria 1599
127 Ga0207677_10042872 3300026023 Bacteria 3004
128 Ga0207678_10041283 3300026067 Bacteria 4000
129 Ga0207708_10127713 3300026075 Bacteria 1985
130 Ga0207674_10009856 3300026116 Bacteria 10874
131 Ga0207674_10112820 3300026116 Bacteria 2692
132 Ga0207675_100222706 3300026118 Bacteria 1818
133 Ga0207683_10016561 3300026121 Bacteria 6276
134 Ga0209588_1004144 3300027671 Bacteria 4065
135 Ga0209588_1006036 3300027671 Bacteria 3498
136 Ga0207428_10072284 3300027907 Bacteria 2708
137 Ga0268266_10039229 3300028379 Bacteria 4033
138 Ga0268265_10013835 3300028380 Bacteria 5492
139 Ga0268265_10018753 3300028380 Bacteria 4799
140 Ga0268264_10000119 3300028381 Bacteria 192507
141 Ga0268264_10036226 3300028381 Bacteria 4063
142 Ga0307517_10000042 3300028786 Bacteria 166943
143 Ga0307511_10077277 3300030521 Bacteria 2372
144 Ga0307513_10127371 3300031456 Bacteria 2499
145 Ga0307509_10003603 3300031507 Bacteria 23280
146 Ga0307509_10038766 3300031507 Bacteria 5196
147 Ga0307408_100025649 3300031548 Bacteria 4039
148 Ga0307508_10000020 3300031616 Bacteria 188730
149 Ga0307508_10075255 3300031616 Bacteria 2953
150 Ga0316576_10146360 3300031727 Bacteria 1780
151 Ga0307516_10000729 3300031730 Bacteria 44867
152 Ga0307516_10169497 3300031730 Bacteria 1925
153 Ga0307410_10097995 3300031852 Bacteria 2096
154 Ga0307412_10111037 3300031911 Bacteria 1958
155 Ga0307409_100159503 3300031995 Bacteria 1970
156 Ga0307416_100065481 3300032002 Bacteria 2987
157 Ga0307416_100179650 3300032002 Bacteria 1982
158 Ga0307415_100120500 3300032126 Bacteria 1966
159 Ga0307415_100188299 3300032126 Bacteria 1626
160 Ga0307510_10012646 3300033180 Bacteria 10014
161 Ga0307510_10015257 3300033180 Bacteria 9083
162 Ga0307510_10029443 3300033180 Bacteria 6250
163 Ga0373926_0003365 3300035083 Bacteria 5148
164 Ga0373934_0000416 3300035086 Bacteria 14940
165 Ga0373923_0005317 3300035111 Bacteria 4368
166 Ga0373936_0014679 3300035113 Bacteria 2997
167 Ga0373941_0022667 3300035115 Bacteria 1784
168 Ga0373953_0000591 3300035117 Bacteria 10025
169 Ga0373954_0015451 3300035118 Bacteria 3412
170 Ga0373956_0041574 3300035119 Bacteria 2041
171 Ga0373957_0003641 3300035120 Bacteria 4592
172 Ga0373957_0034917 3300035120 Bacteria 1865
173 Ga0373943_0025983 3300035170 Bacteria 2740
174 Ga0373946_0013680 3300035171 Bacteria 3053
175 Ga0373955_0018499 3300035172 Bacteria 3466
176 Ga0316574_0007473 3300035398 Bacteria 5990
177 Ga0373931_0001003 3300035691 Bacteria 11944
178 Ga0373935_0009394 3300035692 Bacteria 5850
179 Ga0373935_0012912 3300035692 Bacteria 5033
180 Ga0373935_0021698 3300035692 Bacteria 3933
181 Ga0373927_0005631 3300035695 Bacteria 8608
182 Ga0373927_0034859 3300035695 Bacteria 3273
183 Ga0373927_0041697 3300035695 Bacteria 2976
184 Ga0373927_0086399 3300035695 Bacteria 2036
185 Ga0373927_0128914 3300035695 Bacteria 1652
186 Ga0373933_0005519 3300035724 Bacteria 6889
187 Ga0373947_0004362 3300035725 Bacteria 8297
188 Ga0373947_0011419 3300035725 Bacteria 5097
189 Ga0373937_0157498 3300036401 Bacteria 2129
190 Ga0316584_0098171 3300036712 Bacteria 2193
191 Ga0373925_0017541 3300037068 Bacteria 5190
192 Ga0373925_0025755 3300037068 Bacteria 4301
193 Ga0373925_0105755 3300037068 Bacteria 2169
194 Ga0395900_0065602 3300037418 Bacteria 3730
195 Ga0436362_1248907 3300039453 Bacteria 6385
196 Ga0451800_0242243 3300041459 Bacteria 1938
197 Ga0466967_0064649 3300045976 Bacteria 3254
198 Ga0466967_0131276 3300045976 Bacteria 2326
199 Ga0495592_0045136 3300046454 Bacteria 3289
200 Ga0495603_0008149 3300046455 Bacteria 6331
201 Ga0495603_0008261 3300046455 Bacteria 6291
202 Ga0495603_0012784 3300046455 Bacteria 5076
203 Ga0495603_0052413 3300046455 Bacteria 2423
204 Ga0495629_0003064 3300046459 Bacteria 12696
205 Ga0495629_0014461 3300046459 Bacteria 5677
206 Ga0495629_0153701 3300046459 Bacteria 1599
207 Ga0495638_0056712 3300046460 Bacteria 2430
208 Ga0495638_0063382 3300046460 Bacteria 2279
209 Ga0495641_0009688 3300046461 Bacteria 5694
210 Ga0495653_0000973 3300046463 Bacteria 21997
211 Ga0495580_0016285 3300046472 Bacteria 5583
212 Ga0495582_0011061 3300046473 Bacteria 4968
213 Ga0495582_0018118 3300046473 Bacteria 3852
214 Ga0495639_0002404 3300046475 Bacteria 8188
215 Ga0495639_0002540 3300046475 Bacteria 7962
216 Ga0495639_0101336 3300046475 Bacteria 1360
217 Ga0495662_0006309 3300046476 Bacteria 5928
218 Ga0495664_0009904 3300046477 Bacteria 5347
219 Ga0495664_0019941 3300046477 Bacteria 3862
220 Ga0495664_0082686 3300046477 Bacteria 1926
221 Ga0495585_0017150 3300046492 Bacteria 4189
222 Ga0495594_0013373 3300046499 Bacteria 4284
223 Ga0495594_0015536 3300046499 Bacteria 4000
224 Ga0495618_0013565 3300046514 Bacteria 4959
225 Ga0495618_0064125 3300046514 Bacteria 2334
226 Ga0495618_0140271 3300046514 Bacteria 1546
227 Ga0495628_0017122 3300046516 Bacteria 6038
228 Ga0495628_0122885 3300046516 Bacteria 1990
229 Ga0495628_0284775 3300046516 Bacteria 1226
230 Ga0495630_0030968 3300046517 Bacteria 3982
231 Ga0495632_0036009 3300046519 Bacteria 2520
232 Ga0495632_0143497 3300046519 Bacteria 1107
233 Ga0495648_0006026 3300046524 Bacteria 9956
234 Ga0495648_0049786 3300046524 Bacteria 2565
235 Ga0495666_0023202 3300046526 Bacteria 3069
236 Ga0495652_0182408 3300046529 Bacteria 1609
237 Ga0495665_0012227 3300046531 Bacteria 4645
238 Ga0495640_0013911 3300046533 Bacteria 6107
239 Ga0495640_0062555 3300046533 Bacteria 2524
240 Ga0495609_0034148 3300046538 Bacteria 2307
241 Ga0495609_0050036 3300046538 Bacteria 1864
242 Ga0495645_0003423 3300046543 Bacteria 10755
243 Ga0495645_0033692 3300046543 Bacteria 3737
244 Ga0495645_0072743 3300046543 Bacteria 2477
245 Ga0495622_0028937 3300046557 Bacteria 2589
246 Ga0495667_0012793 3300046559 Bacteria 5685
247 Ga0495667_0032789 3300046559 Bacteria 3478
248 Ga0495634_0019249 3300046642 Bacteria 4851
249 Ga0495634_0026774 3300046642 Bacteria 4020
250 Ga0495634_0030906 3300046642 Bacteria 3692
251 Ga0495611_0006836 3300046648 Bacteria 4846
252 Ga0495625_0045151 3300046660 Bacteria 3187
253 Ga0495625_0049905 3300046660 Bacteria 3006
254 Ga0495635_0010389 3300046663 Bacteria 6511
255 Ga0495659_0003267 3300046664 Bacteria 5198
256 Ga0495599_0014544 3300046678 Bacteria 4873
257 Ga0495599_0021809 3300046678 Bacteria 3998
258 Ga0495599_0102948 3300046678 Bacteria 1779
259 Ga0495623_0108499 3300046679 Bacteria 1685
260 Ga0495646_0055872 3300046680 Bacteria 2368
261 Ga0495658_0012048 3300046683 Bacteria 4367
262 Ga0495658_0050046 3300046683 Bacteria 2362
263 Ga0495613_0016200 3300046689 Bacteria 5553
264 Ga0495613_0106297 3300046689 Bacteria 2025
265 Ga0495613_0132395 3300046689 Bacteria 1785
266 Ga0495624_0016135 3300046690 Bacteria 5030
267 Ga0495624_0029824 3300046690 Bacteria 3556
268 Ga0495670_0014282 3300046691 Bacteria 3907
269 Ga0495670_0041786 3300046691 Bacteria 2288
270 Ga0495649_0011955 3300046694 Bacteria 5072
271 Ga0495649_0068381 3300046694 Bacteria 1906
272 Ga0495600_0060635 3300046809 Bacteria 2470
273 Ga0495581_0010404 3300047315 Bacteria 5381
274 Ga0495604_0018599 3300047317 Bacteria 5566
275 Ga0495674_0019944 3300047319 Bacteria 6214
276 Ga0495674_0027087 3300047319 Bacteria 5242
277 Ga0495674_0041516 3300047319 Bacteria 4108
278 Ga0495672_0044770 3300047320 Bacteria 2652
279 Ga0495676_0049397 3300047321 Bacteria 3383
280 Ga0495676_0092553 3300047321 Bacteria 2257
281 Ga0495680_0146179 3300047322 Bacteria 1726
282 Ga0495677_0044688 3300047445 Bacteria 1624
283 Ga0495684_0009496 3300047471 Bacteria 7504
284 Ga0495684_0021641 3300047471 Bacteria 4951
285 Ga0495686_0010030 3300047472 Bacteria 6766
286 Ga0495686_0085427 3300047472 Bacteria 1922
287 Ga0495593_0001099 3300047673 Bacteria 15770
288 Ga0495593_0007286 3300047673 Bacteria 6478
289 Ga0495602_0095520 3300048088 Bacteria 2453
290 Ga0496100_0007394 3300048903 Bacteria 6059
291 Ga0496101_0002285 3300048904 Bacteria 11704
292 Ga0496102_0001763 3300048905 Bacteria 18847
293 Ga0496104_0004092 3300048907 Bacteria 12653
294 Ga0496104_0066854 3300048907 Bacteria 3413
295 Ga0496104_0143224 3300048907 Bacteria 2296
296 Ga0496105_0023368 3300048908 Bacteria 5012
297 Ga0496105_0062799 3300048908 Bacteria 3065
298 Ga0496105_0100370 3300048908 Bacteria 2390
299 Ga0496105_0308619 3300048908 Bacteria 1271
300 Ga0496106_0027973 3300048909 Bacteria 4197
301 Ga0496106_0084034 3300048909 Bacteria 2449
302 Ga0496107_0014937 3300048910 Bacteria 5438
303 Ga0496107_0189550 3300048910 Bacteria 1527
304 Ga0496108_0013291 3300048911 Bacteria 6711
305 Ga0496108_0181579 3300048911 Bacteria 1822
306 Ga0496109_0019384 3300048912 Bacteria 5998
307 Ga0496109_0240178 3300048912 Bacteria 1705
308 Ga0496110_0025516 3300048913 Bacteria 5051
309 Ga0496110_0090605 3300048913 Bacteria 2734
310 Ga0496111_0034658 3300048914 Bacteria 3605
311 Ga0496111_0090773 3300048914 Bacteria 2238
312 Ga0496112_0011009 3300048915 Bacteria 8242
313 Ga0496112_0021320 3300048915 Bacteria 6160
314 Ga0496112_0026287 3300048915 Bacteria 5598
315 Ga0496113_0010227 3300048916 Bacteria 6194
316 Ga0496113_0036634 3300048916 Bacteria 3595
317 Ga0496113_0077055 3300048916 Bacteria 2548
318 Ga0496114_0025664 3300048917 Bacteria 4818
319 Ga0496114_0128586 3300048917 Bacteria 2186
320 Ga0496115_0000894 3300048918 Bacteria 21630
321 Ga0496115_0201976 3300048918 Bacteria 1642
322 Ga0496116_0022088 3300048919 Bacteria 4783
323 Ga0496118_0068886 3300048921 Bacteria 2567
324 Ga0496119_0034283 3300048922 Bacteria 3348
325 Ga0496119_0069738 3300048922 Bacteria 2065
326 Ga0496119_0072486 3300048922 Bacteria 2012
327 Ga0496121_0000285 3300048924 Bacteria 104880
328 Ga0496121_0016671 3300048924 Bacteria 7563
329 Ga0496121_0021499 3300048924 Bacteria 6316
330 Ga0496121_0034825 3300048924 Bacteria 4524
331 Ga0496124_0012217 3300048927 Bacteria 8495
332 Ga0496125_0024489 3300048928 Bacteria 5550
333 Ga0496125_0052164 3300048928 Bacteria 3365
334 Ga0496126_0014434 3300048929 Bacteria 7986
335 Ga0496126_0030150 3300048929 Bacteria 5143
336 Ga0496126_0146366 3300048929 Bacteria 2029
337 Ga0496126_0163635 3300048929 Bacteria 1900
338 Ga0496126_0193002 3300048929 Bacteria 1724
339 Ga0495682_0004061 3300049460 Bacteria 6366
340 Ga0501031_0091674 3300049568 Bacteria 1982
341 Ga0501032_0014271 3300049569 Bacteria 5628
342 Ga0501033_0003682 3300049570 Bacteria 12469
343 Ga0501037_0000773 3300049573 Bacteria 24066
344 Ga0501038_0005830 3300049574 Bacteria 11394
345 Ga0501039_0005692 3300049575 Bacteria 9440
346 Ga0501043_0008414 3300049579 Bacteria 8125
347 Ga0501046_0019536 3300049580 Bacteria 5618
348 Ga0501068_0099841 3300049584 Bacteria 1798
349 Ga0501035_0001412 3300049822 Bacteria 24616
350 Ga0501044_0063642 3300049823 Bacteria 3768
351 nmdc:mga0yw44_25594_c1 3300050492 Bacteria 3358
352 nmdc:mga0yw44_51591_c1 3300050492 Bacteria 2491
353 nmdc:mga08y16_37480_c1 3300050511 Bacteria 5091
354 Ga0495601_0041929 3300053077 Bacteria 2870
355 Ga0495601_0148511 3300053077 Bacteria 1530
356 Ga0495612_0008508 3300053078 Bacteria 4161
357 Ga0495612_0018128 3300053078 Bacteria 2818
358 Ga0495595_0050459 3300053084 Bacteria 1927
359 Ga0500647_0021574 3300053091 Bacteria 3006
360 Ga0500641_0029665 3300053096 Bacteria 2144
361 Ga0500595_001341 3300053119 Bacteria 13308
362 Ga0500595_001691 3300053119 Bacteria 11581
363 Ga0500595_010863 3300053119 Bacteria 3594
364 Ga0500642_0013509 3300053130 Bacteria 3005
365 Ga0500561_0006830 3300053137 Bacteria 2196
366 Ga0500561_0011604 3300053137 Bacteria 1858
367 Ga0500577_0046928 3300053142 Bacteria 1603
368 Ga0500622_0008020 3300053156 Bacteria 5943
369 Ga0500634_0038226 3300053161 Bacteria 2610
370 Ga0500636_0072049 3300053177 Bacteria 2003
371 Ga0500645_008652 3300053730 Bacteria 3457
372 Ga0501084_0327081 3300054114 Bacteria 1295

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035120 Ga0373957_0034917 Ga0373957_0034917_833_1849 329
2 3300010159 Ga0099796_10000343 Ga0099796_1000034311 333
3 3300046519 Ga0495632_0143497 Ga0495632_0143497_79_1083 333
4 3300047322 Ga0495680_0146179 Ga0495680_0146179_16_1020 333
5 3300053142 Ga0500577_0046928 Ga0500577_0046928_29_1033 333
6 3300046475 Ga0495639_0101336 Ga0495639_0101336_337_1341 334
7 3300046477 Ga0495664_0082686 Ga0495664_0082686_907_1911 334
8 3300046694 Ga0495649_0068381 Ga0495649_0068381_864_1868 334
9 3300048917 Ga0496114_0128586 Ga0496114_0128586_1162_2166 334
10 3300046689 Ga0495613_0132395 Ga0495613_0132395_14_1069 342
11 3300047321 Ga0495676_0092553 Ga0495676_0092553_1164_2219 342
12 3300048088 Ga0495602_0095520 Ga0495602_0095520_1306_2364 351
13 3300046516 Ga0495628_0284775 Ga0495628_0284775_84_1196 361
14 3300046679 Ga0495623_0108499 Ga0495623_0108499_50_1162 361
15 3300054114 Ga0501084_0327081 Ga0501084_0327081_192_1277 361
16 iso_pu_bacteria 8016583857 8016587374 366
17 3300009093 Ga0105240_10269329 Ga0105240_102693292 369
18 3300046514 Ga0495618_0064125 Ga0495618_0064125_324_1523 390
19 3300048918 Ga0496115_0201976 Ga0496115_0201976_452_1624 390
20 3300005843 Ga0068860_100000223 Ga0068860_10000022328 392
21 3300028381 Ga0268264_10000119 Ga0268264_10000119110 392
22 3300031616 Ga0307508_10000020 Ga0307508_1000002090 392
23 3300053177 Ga0500636_0072049 Ga0500636_0072049_100_1314 394
24 3300031727 Ga0316576_10146360 Ga0316576_101463602 395
25 3300035083 Ga0373926_0003365 Ga0373926_0003365_1935_3149 395
26 3300035111 Ga0373923_0005317 Ga0373923_0005317_2642_3856 395
27 3300035119 Ga0373956_0041574 Ga0373956_0041574_184_1398 395
28 3300035170 Ga0373943_0025983 Ga0373943_0025983_793_2007 395
29 3300035398 Ga0316574_0007473 Ga0316574_0007473_3654_4841 395
30 3300035692 Ga0373935_0021698 Ga0373935_0021698_2653_3867 395
31 3300035695 Ga0373927_0041697 Ga0373927_0041697_793_2007 395
32 3300035725 Ga0373947_0004362 Ga0373947_0004362_4994_6208 395
33 3300036712 Ga0316584_0098171 Ga0316584_0098171_37_1224 395
34 3300037068 Ga0373925_0017541 Ga0373925_0017541_1222_2436 395
35 3300046455 Ga0495603_0052413 Ga0495603_0052413_367_1581 395
36 3300046459 Ga0495629_0153701 Ga0495629_0153701_75_1289 395
37 3300046473 Ga0495582_0018118 Ga0495582_0018118_1424_2638 395
38 3300046475 Ga0495639_0002404 Ga0495639_0002404_2666_3880 395
39 3300046533 Ga0495640_0013911 Ga0495640_0013911_1689_2903 395
40 3300046543 Ga0495645_0033692 Ga0495645_0033692_2346_3560 395
41 3300046559 Ga0495667_0032789 Ga0495667_0032789_841_2055 395
42 3300046642 Ga0495634_0030906 Ga0495634_0030906_86_1300 395
43 3300046678 Ga0495599_0021809 Ga0495599_0021809_1009_2223 395
44 3300046683 Ga0495658_0050046 Ga0495658_0050046_348_1562 395
45 3300046690 Ga0495624_0016135 Ga0495624_0016135_2337_3551 395
46 3300047319 Ga0495674_0041516 Ga0495674_0041516_2192_3406 395
47 3300047471 Ga0495684_0009496 Ga0495684_0009496_3502_4716 395
48 3300047673 Ga0495593_0007286 Ga0495593_0007286_2449_3663 395
49 3300053077 Ga0495601_0041929 Ga0495601_0041929_1143_2357 395
50 3300053078 Ga0495612_0008508 Ga0495612_0008508_2129_3343 395
51 3300005983 Ga0081540_1003096 Ga0081540_10030962 396
52 iso_pu_bacteria 2513237094 2513643679 400
53 iso_pu_bacteria 2513237098 2513671920 400
54 iso_pu_bacteria 2524023205 2524437213 400
55 iso_pu_bacteria 2524023210 2524463767 400
56 iso_pu_bacteria 2524023228 2524541691 400
57 iso_pu_bacteria 2528768022 2528850068 400
58 iso_pu_bacteria 2721755755 2723846680 400
59 iso_pu_bacteria 2744054633 2745076432 400
60 iso_pu_bacteria 2824661429 2824665989 400
61 iso_pu_bacteria 2876761206 2876763948 400
62 iso_pu_bacteria 2879099564 2879103919 400
63 iso_pu_bacteria 2879110137 2879115000 400
64 iso_pu_bacteria 2885383462 2885387245 400
65 iso_pu_bacteria 2889033259 2889040886 400
66 iso_pu_bacteria 2903768456 2903771202 400
67 iso_pu_bacteria 2904690495 2904694347 400
68 iso_pu_bacteria 2906635258 2906643065 400
69 iso_pu_bacteria 2906660503 2906661955 400
70 iso_pu_bacteria 2922368715 2922373901 400
71 iso_pu_bacteria 2929615660 2929617608 400
72 iso_pu_bacteria 2929624759 2929627313 400
73 iso_pu_bacteria 2932784394 2932787345 400
74 iso_pu_bacteria 2932809354 2932815200 400
75 iso_pu_bacteria 2932818245 2932820602 400
76 iso_pu_bacteria 2932828146 2932831653 400
77 iso_pu_bacteria 2933577622 2933579564 400
78 iso_pu_bacteria 2935616580 2935622295 400
79 iso_pu_bacteria 2935638405 2935642934 400
80 iso_pu_bacteria 2935665750 2935668035 400
81 iso_pu_bacteria 2935675223 2935678893 400
82 iso_pu_bacteria 2935684952 2935688784 400
83 iso_pu_bacteria 2935694250 2935696137 400
84 iso_pu_bacteria 2935703347 2935706904 400
85 iso_pu_bacteria 2935713505 2935715803 400
86 iso_pu_bacteria 2935722832 2935725633 400
87 iso_pu_bacteria 2935732158 2935738088 400
88 iso_pu_bacteria 2935741537 2935747463 400
89 iso_pu_bacteria 2935750917 2935753962 400
90 iso_pu_bacteria 2935760218 2935762967 400
91 iso_pu_bacteria 2935801545 2935808554 400
92 iso_pu_bacteria 2935810662 2935812750 400
93 iso_pu_bacteria 2935827899 2935830401 400
94 iso_pu_bacteria 2935837841 2935840432 400
95 iso_pu_bacteria 2935855204 2935860637 400
96 iso_pu_bacteria 2935864058 2935865330 400
97 iso_pu_bacteria 2935873716 2935877926 400
98 iso_pu_bacteria 2935992306 2935996122 400
99 iso_pu_bacteria 2936002035 2936006256 400
100 iso_pu_bacteria 2936037263 2936041338 400
101 iso_pu_bacteria 2940556831 2940560662 400
102 iso_pu_bacteria 2941538514 2941541437 400
103 iso_pu_bacteria 3005710791 3005712856 400
104 iso_pu_bacteria 8006984368 8006985580 400
105 iso_pu_bacteria 8017057580 8017062690 400
106 iso_pu_bacteria 8019576017 8019582095 400
107 iso_pu_bacteria 8019586578 8019589781 400
108 iso_pu_bacteria 8019608314 8019617065 400
109 iso_pu_bacteria 8055742211 8055746777 400
110 iso_pu_bacteria 8056967851 8056973180 400
111 3300046691 Ga0495670_0041786 Ga0495670_0041786_276_1493 401
112 iso_pu_bacteria 2876808645 2876816564 402
113 3300005327 Ga0070658_10041261 Ga0070658_100412612 403
114 3300005329 Ga0070683_100000244 Ga0070683_1000002443 403
115 3300005329 Ga0070683_100038701 Ga0070683_1000387013 403
116 3300005336 Ga0070680_100000715 Ga0070680_10000071520 403
117 3300005339 Ga0070660_100001964 Ga0070660_1000019649 403
118 3300005341 Ga0070691_10060095 Ga0070691_100600952 403
119 3300005434 Ga0070709_10000274 Ga0070709_1000027418 403
120 3300005435 Ga0070714_100002601 Ga0070714_1000026013 403
121 3300005436 Ga0070713_100028315 Ga0070713_1000283155 403
122 3300005437 Ga0070710_10000279 Ga0070710_1000027914 403
123 3300005439 Ga0070711_100000568 Ga0070711_1000005687 403
124 3300005458 Ga0070681_10031480 Ga0070681_100314804 403
125 3300005530 Ga0070679_100020332 Ga0070679_1000203325 403
126 3300005530 Ga0070679_100107246 Ga0070679_1001072461 403
127 3300005535 Ga0070684_100001779 Ga0070684_1000017795 403
128 3300005563 Ga0068855_100024006 Ga0068855_1000240063 403
129 3300005563 Ga0068855_100048340 Ga0068855_1000483403 403
130 3300005577 Ga0068857_100005328 Ga0068857_1000053282 403
131 3300005834 Ga0068851_10003440 Ga0068851_100034402 403
132 3300006237 Ga0097621_100263649 Ga0097621_1002636491 403
133 3300007788 Ga0099795_10030700 Ga0099795_100307002 403
134 3300009093 Ga0105240_10003096 Ga0105240_1000309616 403
135 3300009174 Ga0105241_10034894 Ga0105241_100348943 403
136 3300009545 Ga0105237_10002350 Ga0105237_100023506 403
137 3300009545 Ga0105237_10015172 Ga0105237_100151722 403
138 3300009551 Ga0105238_10000408 Ga0105238_1000040826 403
139 3300009551 Ga0105238_10005340 Ga0105238_100053404 403
140 3300010375 Ga0105239_10026031 Ga0105239_100260313 403
141 3300013105 Ga0157369_10000685 Ga0157369_1000068539 403
142 3300013105 Ga0157369_10029295 Ga0157369_100292953 403
143 3300013105 Ga0157369_10333207 Ga0157369_103332071 403
144 3300025272 Ga0209455_1002061 Ga0209455_10020613 403
145 3300025321 Ga0207656_10005202 Ga0207656_100052022 403
146 3300025898 Ga0207692_10002196 Ga0207692_100021967 403
147 3300025906 Ga0207699_10000285 Ga0207699_100002859 403
148 3300025912 Ga0207707_10000126 Ga0207707_1000012634 403
149 3300025912 Ga0207707_10058791 Ga0207707_100587912 403
150 3300025914 Ga0207671_10030990 Ga0207671_100309902 403
151 3300025915 Ga0207693_10038436 Ga0207693_100384362 403
152 3300025916 Ga0207663_10001369 Ga0207663_1000136912 403
153 3300025917 Ga0207660_10008935 Ga0207660_100089355 403
154 3300025919 Ga0207657_10000261 Ga0207657_1000026131 403
155 3300025921 Ga0207652_10000994 Ga0207652_100009949 403
156 3300025921 Ga0207652_10053657 Ga0207652_100536573 403
157 3300025924 Ga0207694_10008232 Ga0207694_100082325 403
158 3300025924 Ga0207694_10012454 Ga0207694_100124542 403
159 3300025928 Ga0207700_10020158 Ga0207700_100201583 403
160 3300025929 Ga0207664_10004606 Ga0207664_100046068 403
161 3300025944 Ga0207661_10002724 Ga0207661_100027243 403
162 3300025949 Ga0207667_10005359 Ga0207667_1000535914 403
163 3300026067 Ga0207678_10041283 Ga0207678_100412832 403
164 3300026116 Ga0207674_10009856 Ga0207674_1000985611 403
165 3300026116 Ga0207674_10112820 Ga0207674_101128203 403
166 3300037418 Ga0395900_0065602 Ga0395900_0065602_2167_3378 403
167 3300039453 Ga0436362_1248907 Ga0436362_1248907_959_2170 403
168 3300045976 Ga0466967_0064649 Ga0466967_0064649_1453_2664 403
169 3300046477 Ga0495664_0009904 Ga0495664_0009904_477_1688 403
170 3300046543 Ga0495645_0003423 Ga0495645_0003423_1348_2559 403
171 3300046678 Ga0495599_0102948 Ga0495599_0102948_242_1453 403
172 3300048924 Ga0496121_0016671 Ga0496121_0016671_5683_6903 403
173 3300048929 Ga0496126_0030150 Ga0496126_0030150_2348_3559 403
174 3300053078 Ga0495612_0018128 Ga0495612_0018128_1514_2725 403
175 3300003215 JGI25153J46596_10001700 JGI25153J46596_100017005 404
176 3300003354 JGI25160J50197_1000954 JGI25160J50197_100095412 404
177 3300005327 Ga0070658_10011820 Ga0070658_100118203 404
178 3300005439 Ga0070711_100005497 Ga0070711_1000054977 404
179 3300005456 Ga0070678_100103997 Ga0070678_1001039972 404
180 3300005467 Ga0070706_100050349 Ga0070706_1000503494 404
181 3300005471 Ga0070698_100212144 Ga0070698_1002121442 404
182 3300005535 Ga0070684_100067288 Ga0070684_1000672884 404
183 3300005536 Ga0070697_100013347 Ga0070697_1000133472 404
184 3300005545 Ga0070695_100173175 Ga0070695_1001731752 404
185 3300005548 Ga0070665_100011784 Ga0070665_1000117843 404
186 3300005617 Ga0068859_100029372 Ga0068859_1000293724 404
187 3300005718 Ga0068866_10041952 Ga0068866_100419522 404
188 3300005840 Ga0068870_10037345 Ga0068870_100373452 404
189 3300005844 Ga0068862_100009704 Ga0068862_1000097047 404
190 3300005983 Ga0081540_1006280 Ga0081540_10062804 404
191 3300005983 Ga0081540_1009914 Ga0081540_10099144 404
192 3300006931 Ga0097620_100029369 Ga0097620_1000293694 404
193 3300007265 Ga0099794_10020651 Ga0099794_100206512 404
194 3300007788 Ga0099795_10000287 Ga0099795_100002877 404
195 3300007788 Ga0099795_10007224 Ga0099795_100072243 404
196 3300009094 Ga0111539_10041179 Ga0111539_100411794 404
197 3300009098 Ga0105245_10029481 Ga0105245_100294813 404
198 3300009148 Ga0105243_10162565 Ga0105243_101625652 404
199 3300009148 Ga0105243_10317470 Ga0105243_103174702 404
200 3300009176 Ga0105242_10087361 Ga0105242_100873612 404
201 3300009176 Ga0105242_10149751 Ga0105242_101497512 404
202 3300009177 Ga0105248_10177054 Ga0105248_101770542 404
203 3300009545 Ga0105237_10331344 Ga0105237_103313441 404
204 3300009551 Ga0105238_10297603 Ga0105238_102976032 404
205 3300009553 Ga0105249_10211828 Ga0105249_102118282 404
206 3300010159 Ga0099796_10002003 Ga0099796_100020033 404
207 3300010375 Ga0105239_10039905 Ga0105239_100399052 404
208 3300010375 Ga0105239_10049244 Ga0105239_100492442 404
209 3300010375 Ga0105239_10239805 Ga0105239_102398052 404
210 3300011119 Ga0105246_10006978 Ga0105246_100069782 404
211 3300011119 Ga0105246_10141625 Ga0105246_101416252 404
212 3300011119 Ga0105246_10206284 Ga0105246_102062841 404
213 3300013104 Ga0157370_10001125 Ga0157370_1000112529 404
214 3300013296 Ga0157374_10045871 Ga0157374_100458714 404
215 3300013306 Ga0163162_10045627 Ga0163162_100456272 404
216 3300013306 Ga0163162_10114575 Ga0163162_101145752 404
217 3300013306 Ga0163162_10140413 Ga0163162_101404132 404
218 3300013306 Ga0163162_10363492 Ga0163162_103634921 404
219 3300013308 Ga0157375_10037859 Ga0157375_100378596 404
220 3300013308 Ga0157375_10060979 Ga0157375_100609793 404
221 3300014325 Ga0163163_10139360 Ga0163163_101393603 404
222 3300014326 Ga0157380_10028059 Ga0157380_100280595 404
223 3300014969 Ga0157376_10301175 Ga0157376_103011752 404
224 3300025254 Ga0209148_1001243 Ga0209148_10012433 404
225 3300025261 Ga0209233_1016756 Ga0209233_10167562 404
226 3300025273 Ga0209673_1011522 Ga0209673_10115224 404
227 3300025295 Ga0209564_1003985 Ga0209564_10039854 404
228 3300025297 Ga0209758_1003003 Ga0209758_100300314 404
229 3300025302 Ga0207426_1000596 Ga0207426_100059641 404
230 3300025899 Ga0207642_10076278 Ga0207642_100762782 404
231 3300025908 Ga0207643_10016657 Ga0207643_100166572 404
232 3300025909 Ga0207705_10021164 Ga0207705_100211642 404
233 3300025910 Ga0207684_10029390 Ga0207684_100293903 404
234 3300025914 Ga0207671_10167986 Ga0207671_101679862 404
235 3300025916 Ga0207663_10005276 Ga0207663_100052762 404
236 3300025927 Ga0207687_10032821 Ga0207687_100328213 404
237 3300025934 Ga0207686_10079656 Ga0207686_100796562 404
238 3300025936 Ga0207670_10124811 Ga0207670_101248112 404
239 3300025938 Ga0207704_10053561 Ga0207704_100535612 404
240 3300025942 Ga0207689_10001027 Ga0207689_100010273 404
241 3300025942 Ga0207689_10008518 Ga0207689_100085182 404
242 3300025944 Ga0207661_10053812 Ga0207661_100538122 404
243 3300025945 Ga0207679_10038975 Ga0207679_100389752 404
244 3300025961 Ga0207712_10046408 Ga0207712_100464082 404
245 3300025972 Ga0207668_10011846 Ga0207668_100118465 404
246 3300025972 Ga0207668_10197720 Ga0207668_101977202 404
247 3300026023 Ga0207677_10042872 Ga0207677_100428722 404
248 3300026075 Ga0207708_10127713 Ga0207708_101277132 404
249 3300026118 Ga0207675_100222706 Ga0207675_1002227062 404
250 3300026121 Ga0207683_10016561 Ga0207683_100165613 404
251 3300027671 Ga0209588_1004144 Ga0209588_10041442 404
252 3300027671 Ga0209588_1006036 Ga0209588_10060362 404
253 3300027907 Ga0207428_10072284 Ga0207428_100722841 404
254 3300028379 Ga0268266_10039229 Ga0268266_100392293 404
255 3300028380 Ga0268265_10013835 Ga0268265_100138353 404
256 3300028380 Ga0268265_10018753 Ga0268265_100187537 404
257 3300028381 Ga0268264_10036226 Ga0268264_100362262 404
258 3300028786 Ga0307517_10000042 Ga0307517_1000004214 404
259 3300030521 Ga0307511_10077277 Ga0307511_100772772 404
260 3300031456 Ga0307513_10127371 Ga0307513_101273712 404
261 3300031507 Ga0307509_10003603 Ga0307509_100036032 404
262 3300031507 Ga0307509_10038766 Ga0307509_100387663 404
263 3300031548 Ga0307408_100025649 Ga0307408_1000256495 404
264 3300031616 Ga0307508_10075255 Ga0307508_100752553 404
265 3300031730 Ga0307516_10000729 Ga0307516_1000072927 404
266 3300031730 Ga0307516_10169497 Ga0307516_101694972 404
267 3300031852 Ga0307410_10097995 Ga0307410_100979952 404
268 3300031911 Ga0307412_10111037 Ga0307412_101110372 404
269 3300031995 Ga0307409_100159503 Ga0307409_1001595032 404
270 3300032002 Ga0307416_100065481 Ga0307416_1000654812 404
271 3300032002 Ga0307416_100179650 Ga0307416_1001796502 404
272 3300032126 Ga0307415_100120500 Ga0307415_1001205002 404
273 3300032126 Ga0307415_100188299 Ga0307415_1001882992 404
274 3300033180 Ga0307510_10012646 Ga0307510_100126465 404
275 3300033180 Ga0307510_10015257 Ga0307510_100152574 404
276 3300033180 Ga0307510_10029443 Ga0307510_100294432 404
277 3300035086 Ga0373934_0000416 Ga0373934_0000416_3080_4297 404
278 3300035113 Ga0373936_0014679 Ga0373936_0014679_985_2202 404
279 3300035115 Ga0373941_0022667 Ga0373941_0022667_139_1353 404
280 3300035117 Ga0373953_0000591 Ga0373953_0000591_5272_6489 404
281 3300035118 Ga0373954_0015451 Ga0373954_0015451_1397_2614 404
282 3300035120 Ga0373957_0003641 Ga0373957_0003641_1679_2896 404
283 3300035171 Ga0373946_0013680 Ga0373946_0013680_995_2212 404
284 3300035172 Ga0373955_0018499 Ga0373955_0018499_815_2032 404
285 3300035691 Ga0373931_0001003 Ga0373931_0001003_6692_7906 404
286 3300035692 Ga0373935_0009394 Ga0373935_0009394_572_1786 404
287 3300035692 Ga0373935_0012912 Ga0373935_0012912_2615_3832 404
288 3300035695 Ga0373927_0005631 Ga0373927_0005631_2662_3879 404
289 3300035695 Ga0373927_0034859 Ga0373927_0034859_200_1414 404
290 3300035695 Ga0373927_0086399 Ga0373927_0086399_268_1485 404
291 3300035695 Ga0373927_0128914 Ga0373927_0128914_412_1629 404
292 3300035724 Ga0373933_0005519 Ga0373933_0005519_2480_3697 404
293 3300035725 Ga0373947_0011419 Ga0373947_0011419_1641_2858 404
294 3300036401 Ga0373937_0157498 Ga0373937_0157498_561_1778 404
295 3300037068 Ga0373925_0025755 Ga0373925_0025755_1666_2880 404
296 3300037068 Ga0373925_0105755 Ga0373925_0105755_778_1995 404
297 3300041459 Ga0451800_0242243 Ga0451800_0242243_595_1812 404
298 3300045976 Ga0466967_0131276 Ga0466967_0131276_626_1840 404
299 3300046454 Ga0495592_0045136 Ga0495592_0045136_669_1886 404
300 3300046455 Ga0495603_0008149 Ga0495603_0008149_4296_5513 404
301 3300046455 Ga0495603_0008261 Ga0495603_0008261_3382_4596 404
302 3300046455 Ga0495603_0012784 Ga0495603_0012784_898_2115 404
303 3300046459 Ga0495629_0003064 Ga0495629_0003064_10541_11758 404
304 3300046459 Ga0495629_0014461 Ga0495629_0014461_2070_3287 404
305 3300046460 Ga0495638_0056712 Ga0495638_0056712_862_2076 404
306 3300046460 Ga0495638_0063382 Ga0495638_0063382_141_1355 404
307 3300046461 Ga0495641_0009688 Ga0495641_0009688_2951_4168 404
308 3300046463 Ga0495653_0000973 Ga0495653_0000973_19446_20663 404
309 3300046472 Ga0495580_0016285 Ga0495580_0016285_1785_3002 404
310 3300046473 Ga0495582_0011061 Ga0495582_0011061_2392_3609 404
311 3300046475 Ga0495639_0002540 Ga0495639_0002540_2399_3616 404
312 3300046476 Ga0495662_0006309 Ga0495662_0006309_2616_3833 404
313 3300046477 Ga0495664_0019941 Ga0495664_0019941_2037_3254 404
314 3300046492 Ga0495585_0017150 Ga0495585_0017150_144_1361 404
315 3300046499 Ga0495594_0013373 Ga0495594_0013373_2571_3788 404
316 3300046499 Ga0495594_0015536 Ga0495594_0015536_105_1319 404
317 3300046514 Ga0495618_0013565 Ga0495618_0013565_1754_2971 404
318 3300046514 Ga0495618_0140271 Ga0495618_0140271_81_1298 404
319 3300046516 Ga0495628_0017122 Ga0495628_0017122_1535_2752 404
320 3300046516 Ga0495628_0122885 Ga0495628_0122885_423_1640 404
321 3300046517 Ga0495630_0030968 Ga0495630_0030968_1977_3194 404
322 3300046519 Ga0495632_0036009 Ga0495632_0036009_130_1344 404
323 3300046524 Ga0495648_0006026 Ga0495648_0006026_1259_2476 404
324 3300046524 Ga0495648_0049786 Ga0495648_0049786_522_1736 404
325 3300046526 Ga0495666_0023202 Ga0495666_0023202_684_1901 404
326 3300046529 Ga0495652_0182408 Ga0495652_0182408_166_1383 404
327 3300046531 Ga0495665_0012227 Ga0495665_0012227_767_1984 404
328 3300046533 Ga0495640_0062555 Ga0495640_0062555_317_1534 404
329 3300046538 Ga0495609_0034148 Ga0495609_0034148_473_1690 404
330 3300046538 Ga0495609_0050036 Ga0495609_0050036_361_1575 404
331 3300046543 Ga0495645_0072743 Ga0495645_0072743_226_1443 404
332 3300046557 Ga0495622_0028937 Ga0495622_0028937_47_1261 404
333 3300046559 Ga0495667_0012793 Ga0495667_0012793_4410_5627 404
334 3300046642 Ga0495634_0019249 Ga0495634_0019249_2665_3882 404
335 3300046642 Ga0495634_0026774 Ga0495634_0026774_1363_2580 404
336 3300046648 Ga0495611_0006836 Ga0495611_0006836_3350_4567 404
337 3300046660 Ga0495625_0045151 Ga0495625_0045151_1546_2760 404
338 3300046660 Ga0495625_0049905 Ga0495625_0049905_385_1599 404
339 3300046663 Ga0495635_0010389 Ga0495635_0010389_768_1985 404
340 3300046664 Ga0495659_0003267 Ga0495659_0003267_136_1353 404
341 3300046678 Ga0495599_0014544 Ga0495599_0014544_961_2178 404
342 3300046680 Ga0495646_0055872 Ga0495646_0055872_356_1573 404
343 3300046683 Ga0495658_0012048 Ga0495658_0012048_2574_3791 404
344 3300046689 Ga0495613_0016200 Ga0495613_0016200_1764_2981 404
345 3300046689 Ga0495613_0106297 Ga0495613_0106297_582_1799 404
346 3300046690 Ga0495624_0029824 Ga0495624_0029824_802_2019 404
347 3300046691 Ga0495670_0014282 Ga0495670_0014282_1270_2487 404
348 3300046694 Ga0495649_0011955 Ga0495649_0011955_355_1569 404
349 3300046809 Ga0495600_0060635 Ga0495600_0060635_403_1620 404
350 3300047315 Ga0495581_0010404 Ga0495581_0010404_3376_4593 404
351 3300047317 Ga0495604_0018599 Ga0495604_0018599_3886_5103 404
352 3300047319 Ga0495674_0019944 Ga0495674_0019944_1213_2430 404
353 3300047319 Ga0495674_0027087 Ga0495674_0027087_1425_2642 404
354 3300047320 Ga0495672_0044770 Ga0495672_0044770_265_1482 404
355 3300047321 Ga0495676_0049397 Ga0495676_0049397_1941_3158 404
356 3300047445 Ga0495677_0044688 Ga0495677_0044688_275_1492 404
357 3300047471 Ga0495684_0021641 Ga0495684_0021641_2451_3668 404
358 3300047472 Ga0495686_0010030 Ga0495686_0010030_2193_3407 404
359 3300047472 Ga0495686_0085427 Ga0495686_0085427_375_1592 404
360 3300047673 Ga0495593_0001099 Ga0495593_0001099_11935_13152 404
361 3300048903 Ga0496100_0007394 Ga0496100_0007394_2785_3999 404
362 3300048904 Ga0496101_0002285 Ga0496101_0002285_5052_6266 404
363 3300048905 Ga0496102_0001763 Ga0496102_0001763_3788_5002 404
364 3300048907 Ga0496104_0004092 Ga0496104_0004092_2278_3492 404
365 3300048907 Ga0496104_0066854 Ga0496104_0066854_1605_2819 404
366 3300048907 Ga0496104_0143224 Ga0496104_0143224_905_2119 404
367 3300048908 Ga0496105_0023368 Ga0496105_0023368_2312_3526 404
368 3300048908 Ga0496105_0062799 Ga0496105_0062799_838_2052 404
369 3300048908 Ga0496105_0100370 Ga0496105_0100370_496_1710 404
370 3300048908 Ga0496105_0308619 Ga0496105_0308619_28_1254 404
371 3300048909 Ga0496106_0027973 Ga0496106_0027973_1697_2911 404
372 3300048909 Ga0496106_0084034 Ga0496106_0084034_706_1923 404
373 3300048910 Ga0496107_0014937 Ga0496107_0014937_3308_4522 404
374 3300048910 Ga0496107_0189550 Ga0496107_0189550_64_1278 404
375 3300048911 Ga0496108_0013291 Ga0496108_0013291_3142_4356 404
376 3300048911 Ga0496108_0181579 Ga0496108_0181579_359_1573 404
377 3300048912 Ga0496109_0019384 Ga0496109_0019384_533_1747 404
378 3300048912 Ga0496109_0240178 Ga0496109_0240178_248_1462 404
379 3300048913 Ga0496110_0025516 Ga0496110_0025516_2329_3543 404
380 3300048913 Ga0496110_0090605 Ga0496110_0090605_810_2024 404
381 3300048914 Ga0496111_0034658 Ga0496111_0034658_352_1566 404
382 3300048914 Ga0496111_0090773 Ga0496111_0090773_850_2064 404
383 3300048915 Ga0496112_0011009 Ga0496112_0011009_1006_2220 404
384 3300048915 Ga0496112_0021320 Ga0496112_0021320_941_2155 404
385 3300048915 Ga0496112_0026287 Ga0496112_0026287_1476_2690 404
386 3300048916 Ga0496113_0010227 Ga0496113_0010227_1284_2498 404
387 3300048916 Ga0496113_0036634 Ga0496113_0036634_767_1981 404
388 3300048916 Ga0496113_0077055 Ga0496113_0077055_1013_2227 404
389 3300048917 Ga0496114_0025664 Ga0496114_0025664_1435_2649 404
390 3300048918 Ga0496115_0000894 Ga0496115_0000894_9414_10628 404
391 3300048919 Ga0496116_0022088 Ga0496116_0022088_982_2196 404
392 3300048921 Ga0496118_0068886 Ga0496118_0068886_733_1947 404
393 3300048922 Ga0496119_0034283 Ga0496119_0034283_890_2104 404
394 3300048922 Ga0496119_0069738 Ga0496119_0069738_363_1577 404
395 3300048922 Ga0496119_0072486 Ga0496119_0072486_769_1983 404
396 3300048924 Ga0496121_0000285 Ga0496121_0000285_80516_81733 404
397 3300048924 Ga0496121_0021499 Ga0496121_0021499_3296_4510 404
398 3300048924 Ga0496121_0034825 Ga0496121_0034825_642_1856 404
399 3300048927 Ga0496124_0012217 Ga0496124_0012217_1626_2840 404
400 3300048928 Ga0496125_0024489 Ga0496125_0024489_921_2135 404
401 3300048928 Ga0496125_0052164 Ga0496125_0052164_1590_2804 404
402 3300048929 Ga0496126_0014434 Ga0496126_0014434_4829_6043 404
403 3300048929 Ga0496126_0146366 Ga0496126_0146366_673_1896 404
404 3300048929 Ga0496126_0163635 Ga0496126_0163635_495_1709 404
405 3300048929 Ga0496126_0193002 Ga0496126_0193002_304_1518 404
406 3300049460 Ga0495682_0004061 Ga0495682_0004061_34_1248 404
407 3300049568 Ga0501031_0091674 Ga0501031_0091674_712_1926 404
408 3300049569 Ga0501032_0014271 Ga0501032_0014271_3770_4984 404
409 3300049570 Ga0501033_0003682 Ga0501033_0003682_4839_6053 404
410 3300049573 Ga0501037_0000773 Ga0501037_0000773_17558_18772 404
411 3300049574 Ga0501038_0005830 Ga0501038_0005830_7876_9090 404
412 3300049575 Ga0501039_0005692 Ga0501039_0005692_3983_5197 404
413 3300049579 Ga0501043_0008414 Ga0501043_0008414_4896_6110 404
414 3300049580 Ga0501046_0019536 Ga0501046_0019536_550_1764 404
415 3300049584 Ga0501068_0099841 Ga0501068_0099841_23_1237 404
416 3300049822 Ga0501035_0001412 Ga0501035_0001412_2019_3233 404
417 3300049823 Ga0501044_0063642 Ga0501044_0063642_1813_3027 404
418 3300050492 nmdc:mga0yw44_25594_c1 nmdc:mga0yw44_25594_c1_214_1428 404
419 3300050492 nmdc:mga0yw44_51591_c1 nmdc:mga0yw44_51591_c1_659_1873 404
420 3300050511 nmdc:mga08y16_37480_c1 nmdc:mga08y16_37480_c1_2960_4177 404
421 3300053077 Ga0495601_0148511 Ga0495601_0148511_185_1402 404
422 3300053084 Ga0495595_0050459 Ga0495595_0050459_385_1602 404
423 3300053091 Ga0500647_0021574 Ga0500647_0021574_271_1485 404
424 3300053096 Ga0500641_0029665 Ga0500641_0029665_51_1268 404
425 3300053119 Ga0500595_001341 Ga0500595_001341_478_1695 404
426 3300053119 Ga0500595_001691 Ga0500595_001691_2707_3924 404
427 3300053119 Ga0500595_010863 Ga0500595_010863_2076_3293 404
428 3300053130 Ga0500642_0013509 Ga0500642_0013509_742_1959 404
429 3300053137 Ga0500561_0006830 Ga0500561_0006830_935_2149 404
430 3300053137 Ga0500561_0011604 Ga0500561_0011604_262_1479 404
431 3300053156 Ga0500622_0008020 Ga0500622_0008020_3613_4827 404
432 3300053161 Ga0500634_0038226 Ga0500634_0038226_461_1678 404
433 3300053730 Ga0500645_008652 Ga0500645_008652_627_1844 404

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00871

Acetate_kinase

Acetokinase family

6

387

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3khy-assembly1.cif.gz_B crystal structure of a propionate kinase from francisella tularensis subsp. tularensis schu s4 0.8705 1 384
6ioy-assembly2.cif.gz_C crystal structure of porphyromonas gingivalis acetate kinase 0.8653 1 388
3khy-assembly1.cif.gz_B crystal structure of a propionate kinase from francisella tularensis subsp. tularensis schu s4 0.8579 1 384
4iz9-assembly1.cif.gz_A-2 crystal structure of an acetate kinase from mycobacterium avium bound to an unknown acid-apcpp conjugate and manganese 0.8538 2 389
4ijn-assembly1.cif.gz_B crystal structure of an acetate kinase from mycobacterium smegmatis bound to amp and sulfate 0.8485 3 384
ID Description Score Start End Superfamily
4dq8B01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8772 1 192 3.30.420.40
2iirA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8744 2 193 3.30.420.40
3khyB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8623 2 193 3.30.420.40
2iirA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.862 201 389 3.30.420.40
4dq8B01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8583 1 192 3.30.420.40
ID Description Score Start End GO Terms
AF-C4YWP3-F1-model_v4 Acetate kinase (EC 2.7.2.1) 0.9581 279 388 GO:0006083
GO:0008776
AF-A0A257MZU7-F1-model_v4 Acetate kinase 0.9568 2 144 GO:0005524
GO:0006083
GO:0008776
GO:0047761
AF-A0A2D8B7I3-F1-model_v4 deleted 0.9521 2 186
AF-A0A356HIE3-F1-model_v4 deleted 0.9514 2 193
AF-A0A3N5EPQ3-F1-model_v4 Acetate kinase 0.9494 274 390 GO:0005829
GO:0006083
GO:0008776

Feature Viewer

pLDDT pTM Quality
80.94 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map