F442818

General Info

Members Datasets Scaffolds Average Seq Length
433 299 866 337

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10036784|Ga0105240_100367845
Length 324
Sequence MTVVVTGVAGFVGYHVARALLGRGQHVIGIDSVNDYYDVRLKEARLAQLGQIAGFSFHRLDIADSDSLISVLERARPVSGVVHLAAQAGVRYSLQNPFAYVHSNVLGQVAVFNAVRQLDPAPALVYASSSSVYGGNRKLPFAVADRVDHPVSLYAATKRSGELLAESYAAMYGLASTGLRFFTLYGPWGRPDMAYYSFTAAILGGQPIPVFNEGRLERDFTYIDDAVIGILAALDQPTNPERLHRLYNLGNNKPEPVLRFIEVLERAVGRKAIFRFEPMQPGDVVATAAEIEDSRRDLAFEPATSIDEGLPRFVSWYKAYHGVT

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
157 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
168 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
169 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
170 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
176 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
177 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
205 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
221 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
236 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
253 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
254 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
255 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
256 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
264 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
266 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
274 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
277 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
278 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
279 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
280 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
281 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
282 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
283 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
284 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
285 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
286 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
287 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
288 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
289 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
290 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere
291 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
292 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
293 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
294 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
295 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
296 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
297 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
298 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
299 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97
Metatranscriptomes 0
Isolates 3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.39
Nodule 1.85
Rhizoplane 6
Rhizosphere 82.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10036784 3300009093 Bacteria 6294
2 JGI25406J46586_10012611 3300003203 Bacteria 3658
3 JGI25153J46596_10003408 3300003215 Bacteria 8907
4 rootL2_10012969 3300003322 Bacteria 25272
5 rootL2_10063627 3300003322 Bacteria 1977
6 Ga0065715_10013501 3300005293 Bacteria 1876
7 Ga0070658_10062172 3300005327 Bacteria 3043
8 Ga0070676_10176591 3300005328 Bacteria 1386
9 Ga0070680_100015827 3300005336 Bacteria 5921
10 Ga0070680_100144466 3300005336 Bacteria 1995
11 Ga0070682_100048792 3300005337 Bacteria 2637
12 Ga0068868_100112486 3300005338 Bacteria 2213
13 Ga0070660_100034705 3300005339 Bacteria 3813
14 Ga0070660_100156777 3300005339 Bacteria 1833
15 Ga0070689_100038243 3300005340 Bacteria 3670
16 Ga0070689_100134241 3300005340 Bacteria 1986
17 Ga0070689_100315161 3300005340 Bacteria 1305
18 Ga0070691_10088076 3300005341 Bacteria 1528
19 Ga0070661_100139130 3300005344 Bacteria 1828
20 Ga0070668_100054542 3300005347 Bacteria 3083
21 Ga0070675_100175790 3300005354 Bacteria 1849
22 Ga0070675_100206932 3300005354 Bacteria 1705
23 Ga0070671_100039169 3300005355 Bacteria 3934
24 Ga0070673_100191555 3300005364 Bacteria 1757
25 Ga0070688_100035417 3300005365 Bacteria 3032
26 Ga0070667_100097444 3300005367 Bacteria 2537
27 Ga0070709_10007255 3300005434 Bacteria 6075
28 Ga0070709_10145095 3300005434 Bacteria 1634
29 Ga0070714_100006438 3300005435 Bacteria 9068
30 Ga0070714_100145063 3300005435 Bacteria 2134
31 Ga0070713_100002174 3300005436 Bacteria 12691
32 Ga0070710_10001572 3300005437 Bacteria 10784
33 Ga0070710_10070553 3300005437 Bacteria 2013
34 Ga0070701_10079880 3300005438 Bacteria 1768
35 Ga0070711_100014780 3300005439 Bacteria 4927
36 Ga0070711_100120268 3300005439 Bacteria 1941
37 Ga0070705_100065311 3300005440 Bacteria 2178
38 Ga0070694_100115155 3300005444 Bacteria 1921
39 Ga0070662_100200916 3300005457 Bacteria 1581
40 Ga0070685_10003228 3300005466 Bacteria 8293
41 Ga0070685_10047451 3300005466 Bacteria 2470
42 Ga0070699_100228220 3300005518 Bacteria 1660
43 Ga0070679_100007468 3300005530 Bacteria 10218
44 Ga0070679_100113217 3300005530 Bacteria 2699
45 Ga0070684_100137566 3300005535 Bacteria 2207
46 Ga0070684_100191759 3300005535 Bacteria 1860
47 Ga0070672_100131021 3300005543 Bacteria 2061
48 Ga0070686_100008642 3300005544 Bacteria 5706
49 Ga0070695_100050294 3300005545 Bacteria 2670
50 Ga0070696_100019736 3300005546 Bacteria 4568
51 Ga0070696_100096334 3300005546 Bacteria 2114
52 Ga0070696_100328052 3300005546 Bacteria 1180
53 Ga0070693_100029667 3300005547 Bacteria 2985
54 Ga0070665_100003089 3300005548 Bacteria 17925
55 Ga0070665_100100308 3300005548 Bacteria 2899
56 Ga0070665_100325215 3300005548 Bacteria 1542
57 Ga0070704_100099381 3300005549 Bacteria 2188
58 Ga0070664_100205097 3300005564 Bacteria 1760
59 Ga0070664_100393522 3300005564 Bacteria 1266
60 Ga0068854_100161078 3300005578 Bacteria 1738
61 Ga0068856_100214312 3300005614 Bacteria 1941
62 Ga0068856_100268869 3300005614 Bacteria 1720
63 Ga0070702_100071192 3300005615 Bacteria 2055
64 Ga0068852_100502165 3300005616 Bacteria 1208
65 Ga0068859_100108247 3300005617 Bacteria 2840
66 Ga0068859_100324384 3300005617 Bacteria 1634
67 Ga0068859_100634567 3300005617 Bacteria 1161
68 Ga0068864_100022858 3300005618 Bacteria 5245
69 Ga0068861_100046937 3300005719 Bacteria 3258
70 Ga0068861_100071532 3300005719 Bacteria 2689
71 Ga0068863_100325413 3300005841 Bacteria 1494
72 Ga0068858_100264114 3300005842 Bacteria 1637
73 Ga0068860_100161156 3300005843 Bacteria 2163
74 Ga0081455_10002164 3300005937 Bacteria 23439
75 Ga0081455_10005135 3300005937 Bacteria 14429
76 Ga0081455_10017524 3300005937 Bacteria 6862
77 Ga0081455_10075118 3300005937 Bacteria 2789
78 Ga0081540_1000003 3300005983 Bacteria 233942
79 Ga0081540_1003510 3300005983 Bacteria 12375
80 Ga0081540_1069932 3300005983 Bacteria 1628
81 Ga0081539_10006579 3300005985 Bacteria 11056
82 Ga0070717_10000145 3300006028 Bacteria 52677
83 Ga0075365_10021005 3300006038 Bacteria 4063
84 Ga0075365_10074743 3300006038 Bacteria 2286
85 Ga0075368_10013893 3300006042 Bacteria 2963
86 Ga0075363_100032653 3300006048 Bacteria 2705
87 Ga0075364_10036380 3300006051 Bacteria 3182
88 Ga0070715_10010667 3300006163 Bacteria 3282
89 Ga0070715_10031164 3300006163 Bacteria 2162
90 Ga0070716_100001181 3300006173 Bacteria 11493
91 Ga0070712_100049746 3300006175 Bacteria 2912
92 Ga0070712_100181561 3300006175 Bacteria 1640
93 Ga0070712_100365565 3300006175 Bacteria 1184
94 Ga0075362_10048926 3300006177 Bacteria 1887
95 Ga0075362_10050768 3300006177 Bacteria 1855
96 Ga0075367_10121105 3300006178 Bacteria 1612
97 Ga0075369_10023433 3300006186 Bacteria 2552
98 Ga0075366_10000683 3300006195 Bacteria 16043
99 Ga0097621_100397979 3300006237 Bacteria 1232
100 Ga0075433_10145190 3300006852 Bacteria 2109
101 Ga0075433_10178314 3300006852 Bacteria 1890
102 Ga0075434_100060274 3300006871 Bacteria 3774
103 Ga0075434_100089864 3300006871 Bacteria 3072
104 Ga0068865_100003336 3300006881 Bacteria 9612
105 Ga0068865_100146513 3300006881 Bacteria 1786
106 Ga0097620_100036260 3300006931 Bacteria 4950
107 Ga0097620_100108258 3300006931 Bacteria 2840
108 Ga0097620_100324375 3300006931 Bacteria 1634
109 Ga0097620_100634561 3300006931 Bacteria 1161
110 Ga0075435_100068074 3300007076 Bacteria 2899
111 Ga0075435_100136733 3300007076 Bacteria 2053
112 Ga0105251_10018941 3300009011 Bacteria 3647
113 Ga0105240_10141825 3300009093 Bacteria 2872
114 Ga0111539_10611391 3300009094 Bacteria 1269
115 Ga0105245_10022060 3300009098 Bacteria 5589
116 Ga0105245_10487115 3300009098 Bacteria 1247
117 Ga0105247_10028620 3300009101 Bacteria 3372
118 Ga0105247_10098234 3300009101 Bacteria 1869
119 Ga0114129_10032431 3300009147 Bacteria 7383
120 Ga0105243_10003342 3300009148 Bacteria 13016
121 Ga0105241_10011582 3300009174 Bacteria 6466
122 Ga0105242_10243960 3300009176 Bacteria 1616
123 Ga0105248_10042172 3300009177 Bacteria 5117
124 Ga0105248_10305821 3300009177 Bacteria 1790
125 Ga0105237_10214090 3300009545 Bacteria 1926
126 Ga0105238_10024303 3300009551 Bacteria 6177
127 Ga0105249_10068005 3300009553 Bacteria 3284
128 Ga0105239_10391869 3300010375 Bacteria 1571
129 Ga0105246_10017007 3300011119 Bacteria 4618
130 Ga0105246_10065552 3300011119 Bacteria 2539
131 Ga0157373_10028445 3300013100 Bacteria 4032
132 Ga0157373_10088792 3300013100 Bacteria 2178
133 Ga0157370_10267753 3300013104 Bacteria 1579
134 Ga0157374_10185808 3300013296 Bacteria 2032
135 Ga0157378_10065059 3300013297 Bacteria 3263
136 Ga0157378_10453096 3300013297 Bacteria 1274
137 Ga0163162_10078863 3300013306 Bacteria 3359
138 Ga0163162_10098682 3300013306 Bacteria 3011
139 Ga0163162_10115117 3300013306 Bacteria 2789
140 Ga0163162_10254230 3300013306 Bacteria 1889
141 Ga0157372_10521485 3300013307 Bacteria 1385
142 Ga0157375_10221404 3300013308 Bacteria 2051
143 Ga0163163_10008161 3300014325 Bacteria 9285
144 Ga0163163_10106583 3300014325 Bacteria 2829
145 Ga0157380_10066178 3300014326 Bacteria 2906
146 Ga0157379_10009770 3300014968 Bacteria 8359
147 Ga0157379_10160933 3300014968 Bacteria 2026
148 Ga0163161_10040937 3300017792 Bacteria 3329
149 Ga0213873_10010885 3300021358 Bacteria 1931
150 Ga0213875_10064615 3300021388 Bacteria 1710
151 Ga0209233_1009777 3300025261 Bacteria 2904
152 Ga0209758_1003134 3300025297 Bacteria 15604
153 Ga0207697_10008012 3300025315 Bacteria 4665
154 Ga0207653_10043937 3300025885 Bacteria 1472
155 Ga0207692_10001804 3300025898 Bacteria 8121
156 Ga0207692_10054227 3300025898 Bacteria 2046
157 Ga0207642_10054229 3300025899 Bacteria 1828
158 Ga0207710_10008485 3300025900 Bacteria 4332
159 Ga0207688_10008512 3300025901 Bacteria 5584
160 Ga0207688_10095171 3300025901 Bacteria 1714
161 Ga0207680_10113217 3300025903 Bacteria 1763
162 Ga0207699_10002006 3300025906 Bacteria 9614
163 Ga0207699_10035160 3300025906 Bacteria 2849
164 Ga0207699_10130381 3300025906 Bacteria 1639
165 Ga0207645_10022233 3300025907 Bacteria 4128
166 Ga0207643_10065545 3300025908 Bacteria 2081
167 Ga0207654_10004600 3300025911 Bacteria 6967
168 Ga0207693_10003437 3300025915 Bacteria 13514
169 Ga0207660_10019768 3300025917 Bacteria 4508
170 Ga0207660_10130750 3300025917 Bacteria 1911
171 Ga0207660_10188228 3300025917 Bacteria 1606
172 Ga0207662_10024440 3300025918 Bacteria 3477
173 Ga0207662_10107520 3300025918 Bacteria 1736
174 Ga0207657_10007133 3300025919 Bacteria 11476
175 Ga0207657_10103233 3300025919 Bacteria 2363
176 Ga0207657_10145585 3300025919 Bacteria 1933
177 Ga0207657_10371787 3300025919 Bacteria 1126
178 Ga0207652_10246798 3300025921 Bacteria 1610
179 Ga0207681_10244203 3300025923 Bacteria 1399
180 Ga0207694_10040801 3300025924 Bacteria 3575
181 Ga0207659_10256393 3300025926 Bacteria 1421
182 Ga0207687_10016883 3300025927 Bacteria 4799
183 Ga0207700_10069876 3300025928 Bacteria 2697
184 Ga0207700_10109656 3300025928 Bacteria 2218
185 Ga0207664_10015721 3300025929 Bacteria 5502
186 Ga0207664_10062629 3300025929 Bacteria 2971
187 Ga0207644_10019223 3300025931 Bacteria 4630
188 Ga0207706_10025928 3300025933 Bacteria 5249
189 Ga0207686_10019347 3300025934 Bacteria 3870
190 Ga0207709_10129708 3300025935 Bacteria 1716
191 Ga0207709_10190006 3300025935 Bacteria 1458
192 Ga0207670_10247355 3300025936 Bacteria 1376
193 Ga0207670_10274744 3300025936 Bacteria 1311
194 Ga0207669_10284567 3300025937 Bacteria 1249
195 Ga0207704_10076035 3300025938 Bacteria 2150
196 Ga0207704_10127221 3300025938 Bacteria 1756
197 Ga0207665_10000265 3300025939 Bacteria 36482
198 Ga0207665_10181487 3300025939 Bacteria 1524
199 Ga0207691_10059624 3300025940 Bacteria 3469
200 Ga0207711_10161106 3300025941 Bacteria 2031
201 Ga0207711_10445534 3300025941 Bacteria 1205
202 Ga0207689_10011270 3300025942 Bacteria 7672
203 Ga0207689_10026799 3300025942 Bacteria 4826
204 Ga0207689_10036991 3300025942 Bacteria 4051
205 Ga0207679_10192388 3300025945 Bacteria 1697
206 Ga0207679_10213117 3300025945 Bacteria 1621
207 Ga0207667_10022704 3300025949 Bacteria 6922
208 Ga0207712_10044316 3300025961 Bacteria 3074
209 Ga0207712_10148345 3300025961 Bacteria 1809
210 Ga0207712_10292538 3300025961 Bacteria 1333
211 Ga0207668_10044495 3300025972 Bacteria 3020
212 Ga0207640_10379988 3300025981 Bacteria 1144
213 Ga0207677_10152986 3300026023 Bacteria 1782
214 Ga0207677_10247977 3300026023 Bacteria 1444
215 Ga0207703_10020020 3300026035 Bacteria 5228
216 Ga0207703_10203559 3300026035 Bacteria 1760
217 Ga0207639_10377092 3300026041 Bacteria 1273
218 Ga0207678_10020266 3300026067 Bacteria 5836
219 Ga0207678_10042834 3300026067 Bacteria 3919
220 Ga0207678_10204133 3300026067 Bacteria 1690
221 Ga0207641_10070957 3300026088 Bacteria 2994
222 Ga0207648_10098908 3300026089 Bacteria 2555
223 Ga0207676_10124025 3300026095 Bacteria 2183
224 Ga0207674_10060720 3300026116 Bacteria 3822
225 Ga0207674_10081040 3300026116 Bacteria 3248
226 Ga0207675_100030151 3300026118 Bacteria 5051
227 Ga0207675_100071292 3300026118 Bacteria 3248
228 Ga0207683_10006706 3300026121 Bacteria 9851
229 Ga0207683_10027799 3300026121 Bacteria 4888
230 Ga0207683_10077828 3300026121 Bacteria 2938
231 Ga0207428_10161743 3300027907 Bacteria 1700
232 Ga0268266_10003520 3300028379 Bacteria 15543
233 Ga0268266_10010718 3300028379 Bacteria 7987
234 Ga0268266_10012789 3300028379 Bacteria 7250
235 Ga0268265_10016767 3300028380 Bacteria 5041
236 Ga0268265_10221763 3300028380 Bacteria 1655
237 Ga0268264_10220235 3300028381 Bacteria 1747
238 Ga0265337_1000250 3300028556 Bacteria 29184
239 Ga0265325_10000053 3300031241 Bacteria 77918
240 Ga0265325_10038429 3300031241 Bacteria 2526
241 Ga0265340_10014213 3300031247 Bacteria 4165
242 Ga0265339_10001034 3300031249 Bacteria 21208
243 Ga0265331_10041003 3300031250 Bacteria 2250
244 Ga0265313_10032472 3300031595 Bacteria 2665
245 Ga0265314_10002155 3300031711 Bacteria 20584
246 Ga0265314_10008989 3300031711 Bacteria 8499
247 Ga0265342_10000954 3300031712 Bacteria 28791
248 Ga0307413_10342515 3300031824 Bacteria 1150
249 Ga0307410_10146451 3300031852 Bacteria 1753
250 Ga0307409_100108860 3300031995 Bacteria 2318
251 Ga0307414_10062579 3300032004 Bacteria 2642
252 Ga0307415_100098171 3300032126 Bacteria 2140
253 Ga0373926_0028032 3300035083 Bacteria 1976
254 Ga0373944_0005309 3300035089 Bacteria 3388
255 Ga0373951_0002572 3300035091 Bacteria 4559
256 Ga0373936_0022463 3300035113 Bacteria 2456
257 Ga0373954_0005693 3300035118 Bacteria 5406
258 Ga0373954_0013257 3300035118 Bacteria 3672
259 Ga0373943_0001738 3300035170 Bacteria 9877
260 Ga0373946_0054624 3300035171 Bacteria 1681
261 Ga0373955_0002538 3300035172 Bacteria 7986
262 Ga0373961_0001489 3300035241 Bacteria 6855
263 Ga0373962_0006224 3300035242 Bacteria 2887
264 Ga0373962_0040725 3300035242 Bacteria 1307
265 Ga0373924_0005203 3300035410 Bacteria 4592
266 Ga0373924_0084262 3300035410 Bacteria 1355
267 Ga0373931_0009518 3300035691 Bacteria 4645
268 Ga0373935_0025423 3300035692 Bacteria 3649
269 Ga0373935_0058894 3300035692 Bacteria 2454
270 Ga0373927_0009273 3300035695 Bacteria 6600
271 Ga0373933_0167291 3300035724 Bacteria 1398
272 Ga0373947_0007515 3300035725 Bacteria 6305
273 Ga0373947_0015555 3300035725 Bacteria 4370
274 Ga0373937_0079525 3300036401 Bacteria 3030
275 Ga0373925_0014297 3300037068 Bacteria 5742
276 Ga0373925_0026861 3300037068 Bacteria 4214
277 Ga0373925_0153002 3300037068 Bacteria 1812
278 Ga0436364_0650169 3300037853 Bacteria 2410
279 Ga0436360_0654994 3300039438 Bacteria 8074
280 Ga0466972_0144708 3300044658 Bacteria 1118
281 Ga0466966_0106983 3300044684 Bacteria 1726
282 Ga0453684_0073767 3300044712 Bacteria 4300
283 Ga0466957_0020434 3300044842 Bacteria 3897
284 Ga0466960_0106618 3300044901 Bacteria 1450
285 Ga0495592_0013943 3300046454 Bacteria 6105
286 Ga0495603_0013671 3300046455 Bacteria 4912
287 Ga0495603_0016198 3300046455 Bacteria 4510
288 Ga0495629_0000875 3300046459 Bacteria 24261
289 Ga0495638_0000001 3300046460 Bacteria 1114121
290 Ga0495641_0013172 3300046461 Bacteria 4566
291 Ga0495651_0011085 3300046462 Bacteria 6933
292 Ga0495580_0139365 3300046472 Bacteria 1681
293 Ga0495582_0002081 3300046473 Bacteria 11192
294 Ga0495662_0010543 3300046476 Bacteria 4521
295 Ga0495608_0187345 3300046511 Bacteria 1307
296 Ga0495628_0041236 3300046516 Bacteria 3685
297 Ga0495628_0180945 3300046516 Bacteria 1595
298 Ga0495652_0054907 3300046529 Bacteria 3390
299 Ga0495665_0009115 3300046531 Bacteria 5377
300 Ga0495640_0010134 3300046533 Bacteria 7304
301 Ga0495587_0019919 3300046536 Bacteria 4146
302 Ga0495622_0029702 3300046557 Bacteria 2554
303 Ga0495667_0003730 3300046559 Bacteria 10251
304 Ga0495657_0050996 3300046675 Bacteria 2780
305 Ga0495647_0026764 3300046681 Bacteria 2115
306 Ga0495647_0039151 3300046681 Bacteria 1796
307 Ga0495613_0025427 3300046689 Bacteria 4411
308 Ga0495624_0077277 3300046690 Bacteria 2065
309 Ga0495624_0089814 3300046690 Bacteria 1895
310 Ga0495649_0017234 3300046694 Bacteria 4079
311 Ga0495600_0121576 3300046809 Bacteria 1698
312 Ga0495581_0034674 3300047315 Bacteria 2919
313 Ga0495581_0142860 3300047315 Bacteria 1397
314 Ga0495604_0026274 3300047317 Bacteria 4636
315 Ga0495604_0123031 3300047317 Bacteria 1875
316 Ga0495676_0106802 3300047321 Bacteria 2062
317 Ga0495676_0207563 3300047321 Bacteria 1357
318 Ga0495676_0225735 3300047321 Bacteria 1289
319 Ga0495680_0003824 3300047322 Bacteria 14615
320 Ga0495680_0062166 3300047322 Bacteria 2872
321 Ga0495675_0083554 3300047444 Bacteria 2010
322 Ga0495593_0018424 3300047673 Bacteria 3922
323 Ga0495614_0062847 3300048089 Bacteria 1596
324 Ga0496101_0041308 3300048904 Bacteria 3288
325 Ga0496101_0168376 3300048904 Bacteria 1683
326 Ga0496102_0110985 3300048905 Bacteria 2556
327 Ga0496103_0123017 3300048906 Bacteria 1653
328 Ga0496105_0162266 3300048908 Bacteria 1835
329 Ga0496106_0449219 3300048909 Bacteria 1035
330 Ga0496108_0111538 3300048911 Bacteria 2339
331 Ga0496108_0221945 3300048911 Bacteria 1642
332 Ga0496109_0035838 3300048912 Bacteria 4478
333 Ga0496109_0044564 3300048912 Bacteria 4024
334 Ga0496109_0326184 3300048912 Bacteria 1449
335 Ga0496110_0107336 3300048913 Bacteria 2506
336 Ga0496110_0140359 3300048913 Bacteria 2184
337 Ga0496110_0148898 3300048913 Bacteria 2118
338 Ga0496111_0032388 3300048914 Bacteria 3727
339 Ga0496112_0049919 3300048915 Bacteria 4101
340 Ga0496112_0051378 3300048915 Bacteria 4043
341 Ga0496112_0555820 3300048915 Bacteria 1081
342 Ga0496113_0016647 3300048916 Bacteria 5083
343 Ga0496113_0017879 3300048916 Bacteria 4928
344 Ga0496113_0053175 3300048916 Bacteria 3027
345 Ga0496113_0158842 3300048916 Bacteria 1786
346 Ga0496114_0010689 3300048917 Bacteria 7305
347 Ga0496115_0119726 3300048918 Bacteria 2165
348 Ga0496115_0126245 3300048918 Bacteria 2107
349 Ga0496115_0359122 3300048918 Bacteria 1187
350 Ga0496121_0077879 3300048924 Bacteria 2638
351 Ga0496121_0109884 3300048924 Bacteria 2105
352 Ga0496124_0209480 3300048927 Bacteria 1476
353 Ga0501031_0020555 3300049568 Bacteria 4304
354 Ga0501032_0010657 3300049569 Bacteria 6617
355 Ga0501033_0218137 3300049570 Bacteria 1358
356 Ga0501034_0050543 3300049571 Bacteria 4193
357 Ga0501034_0052315 3300049571 Bacteria 4114
358 Ga0501034_0062682 3300049571 Bacteria 3734
359 Ga0501034_0166923 3300049571 Bacteria 2170
360 Ga0501036_0058223 3300049572 Bacteria 3273
361 Ga0501037_0006555 3300049573 Bacteria 8520
362 Ga0501037_0225449 3300049573 Bacteria 1317
363 Ga0501038_0012755 3300049574 Bacteria 7676
364 Ga0501038_0335843 3300049574 Bacteria 1179
365 Ga0501039_0013895 3300049575 Bacteria 6160
366 Ga0501042_0116899 3300049578 Bacteria 1920
367 Ga0501043_0147370 3300049579 Bacteria 1842
368 Ga0501043_0187665 3300049579 Bacteria 1609
369 Ga0501047_0310083 3300049581 Bacteria 1419
370 Ga0501048_0008156 3300049582 Bacteria 7922
371 Ga0501067_0024052 3300049583 Bacteria 3378
372 Ga0501067_0107955 3300049583 Bacteria 1547
373 Ga0501069_0088783 3300049585 Bacteria 1747
374 Ga0501070_0338977 3300049586 Bacteria 1221
375 Ga0501071_0197316 3300049587 Bacteria 1511
376 Ga0501073_0017482 3300049589 Bacteria 5194
377 Ga0501073_0112399 3300049589 Bacteria 1889
378 Ga0501074_0206742 3300049590 Bacteria 1399
379 Ga0501076_0360254 3300049592 Bacteria 1195
380 Ga0501236_002505 3300049670 Bacteria 2111
381 Ga0501079_0052021 3300049741 Bacteria 3163
382 Ga0501080_0004302 3300049742 Bacteria 12645
383 Ga0501083_0024209 3300049744 Bacteria 4208
384 Ga0501035_0058046 3300049822 Bacteria 3449
385 Ga0501044_0001046 3300049823 Bacteria 33251
386 Ga0501044_0325863 3300049823 Bacteria 1459
387 Ga0501044_0346885 3300049823 Bacteria 1405
388 Ga0501045_0006385 3300049824 Bacteria 8162
389 nmdc:mga03683_25880_c1 3300050489 Bacteria 2309
390 nmdc:mga03683_39931_c1 3300050489 Bacteria 1922
391 nmdc:mga0k408_14171_c1 3300050493 Bacteria 4387
392 nmdc:mga0k408_17808_c1 3300050493 Bacteria 3960
393 nmdc:mga06z11_39561_c1 3300050494 Bacteria 2347
394 nmdc:mga04h51_5977_c1 3300050495 Bacteria 2049
395 nmdc:mga07m45_31280_c1 3300050496 Bacteria 2949
396 nmdc:mga07m45_31947_c1 3300050496 Bacteria 2919
397 nmdc:mga05p37_169120_c1 3300050507 Bacteria 2666
398 nmdc:mga05p37_21969_c1 3300050507 Bacteria 7730
399 nmdc:mga08y16_26137_c1 3300050511 Bacteria 6157
400 nmdc:mga0n895_7805_c1 3300050512 Bacteria 9222
401 nmdc:mga0rr50_63076_c1 3300050513 Bacteria 2798
402 nmdc:mga0rr50_73140_c1 3300050513 Bacteria 2620
403 nmdc:mga0a205_24887_c1 3300050515 Bacteria 5697
404 nmdc:mga0a205_64992_c1 3300050515 Bacteria 3524
405 Ga0495612_0008457 3300053078 Bacteria 4174
406 Ga0495595_0026424 3300053084 Bacteria 2580
407 Ga0495595_0036015 3300053084 Bacteria 2244
408 Ga0495619_0043925 3300053085 Bacteria 2931
409 Ga0495619_0208993 3300053085 Bacteria 1352
410 Ga0500643_004385 3300053087 Bacteria 6403
411 Ga0500644_0000369 3300053088 Bacteria 22061
412 Ga0500566_0012802 3300053094 Bacteria 4938
413 Ga0500641_0033274 3300053096 Bacteria 2045
414 Ga0500595_000029 3300053119 Bacteria 122318
415 Ga0500588_0048742 3300053146 Bacteria 1311
416 Ga0500616_0000009 3300053153 Bacteria 779095
417 Ga0500620_028566 3300053155 Bacteria 1745
418 Ga0500627_0026978 3300053158 Bacteria 2375
419 Ga0500639_040115 3300053163 Bacteria 2464
420 Ga0500645_000143 3300053730 Bacteria 56081
421 2509152946 2508501128 Bacteria 8613869
422 2513676203 2513237098 Bacteria 9902361
423 2513891790 2513237141 Bacteria 8496279
424 2524002035 2523533628 Bacteria 4098242
425 2876817297 2876808645 Bacteria 8824342
426 2879113469 2879110137 Bacteria 8907982
427 2885387758 2885383462 Bacteria 9473874
428 2903776058 2903768456 Bacteria 9749579
429 2922367593 2922361189 Bacteria 7436256
430 2922391570 2922386360 Bacteria 7017218
431 8006986130 8006984368 Bacteria 9651211
432 8019659198 8019648815 Bacteria 10014479
433 8056684949 8056681323 Bacteria 8472857
434 Ga0105240_10036784
435 JGI25406J46586_10012611
436 JGI25153J46596_10003408
437 rootL2_10012969
438 rootL2_10063627
439 Ga0065715_10013501
440 Ga0070658_10062172
441 Ga0070676_10176591
442 Ga0070680_100015827
443 Ga0070680_100144466
444 Ga0070682_100048792
445 Ga0068868_100112486
446 Ga0070660_100034705
447 Ga0070660_100156777
448 Ga0070689_100038243
449 Ga0070689_100134241
450 Ga0070689_100315161
451 Ga0070691_10088076
452 Ga0070661_100139130
453 Ga0070668_100054542
454 Ga0070675_100175790
455 Ga0070675_100206932
456 Ga0070671_100039169
457 Ga0070673_100191555
458 Ga0070688_100035417
459 Ga0070667_100097444
460 Ga0070709_10007255
461 Ga0070709_10145095
462 Ga0070714_100006438
463 Ga0070714_100145063
464 Ga0070713_100002174
465 Ga0070710_10001572
466 Ga0070710_10070553
467 Ga0070701_10079880
468 Ga0070711_100014780
469 Ga0070711_100120268
470 Ga0070705_100065311
471 Ga0070694_100115155
472 Ga0070662_100200916
473 Ga0070685_10003228
474 Ga0070685_10047451
475 Ga0070699_100228220
476 Ga0070679_100007468
477 Ga0070679_100113217
478 Ga0070684_100137566
479 Ga0070684_100191759
480 Ga0070672_100131021
481 Ga0070686_100008642
482 Ga0070695_100050294
483 Ga0070696_100019736
484 Ga0070696_100096334
485 Ga0070696_100328052
486 Ga0070693_100029667
487 Ga0070665_100003089
488 Ga0070665_100100308
489 Ga0070665_100325215
490 Ga0070704_100099381
491 Ga0070664_100205097
492 Ga0070664_100393522
493 Ga0068854_100161078
494 Ga0068856_100214312
495 Ga0068856_100268869
496 Ga0070702_100071192
497 Ga0068852_100502165
498 Ga0068859_100108247
499 Ga0068859_100324384
500 Ga0068859_100634567
501 Ga0068864_100022858
502 Ga0068861_100046937
503 Ga0068861_100071532
504 Ga0068863_100325413
505 Ga0068858_100264114
506 Ga0068860_100161156
507 Ga0081455_10002164
508 Ga0081455_10005135
509 Ga0081455_10017524
510 Ga0081455_10075118
511 Ga0081540_1000003
512 Ga0081540_1003510
513 Ga0081540_1069932
514 Ga0081539_10006579
515 Ga0070717_10000145
516 Ga0075365_10021005
517 Ga0075365_10074743
518 Ga0075368_10013893
519 Ga0075363_100032653
520 Ga0075364_10036380
521 Ga0070715_10010667
522 Ga0070715_10031164
523 Ga0070716_100001181
524 Ga0070712_100049746
525 Ga0070712_100181561
526 Ga0070712_100365565
527 Ga0075362_10048926
528 Ga0075362_10050768
529 Ga0075367_10121105
530 Ga0075369_10023433
531 Ga0075366_10000683
532 Ga0097621_100397979
533 Ga0075433_10145190
534 Ga0075433_10178314
535 Ga0075434_100060274
536 Ga0075434_100089864
537 Ga0068865_100003336
538 Ga0068865_100146513
539 Ga0097620_100036260
540 Ga0097620_100108258
541 Ga0097620_100324375
542 Ga0097620_100634561
543 Ga0075435_100068074
544 Ga0075435_100136733
545 Ga0105251_10018941
546 Ga0105240_10141825
547 Ga0111539_10611391
548 Ga0105245_10022060
549 Ga0105245_10487115
550 Ga0105247_10028620
551 Ga0105247_10098234
552 Ga0114129_10032431
553 Ga0105243_10003342
554 Ga0105241_10011582
555 Ga0105242_10243960
556 Ga0105248_10042172
557 Ga0105248_10305821
558 Ga0105237_10214090
559 Ga0105238_10024303
560 Ga0105249_10068005
561 Ga0105239_10391869
562 Ga0105246_10017007
563 Ga0105246_10065552
564 Ga0157373_10028445
565 Ga0157373_10088792
566 Ga0157370_10267753
567 Ga0157374_10185808
568 Ga0157378_10065059
569 Ga0157378_10453096
570 Ga0163162_10078863
571 Ga0163162_10098682
572 Ga0163162_10115117
573 Ga0163162_10254230
574 Ga0157372_10521485
575 Ga0157375_10221404
576 Ga0163163_10008161
577 Ga0163163_10106583
578 Ga0157380_10066178
579 Ga0157379_10009770
580 Ga0157379_10160933
581 Ga0163161_10040937
582 Ga0213873_10010885
583 Ga0213875_10064615
584 Ga0209233_1009777
585 Ga0209758_1003134
586 Ga0207697_10008012
587 Ga0207653_10043937
588 Ga0207692_10001804
589 Ga0207692_10054227
590 Ga0207642_10054229
591 Ga0207710_10008485
592 Ga0207688_10008512
593 Ga0207688_10095171
594 Ga0207680_10113217
595 Ga0207699_10002006
596 Ga0207699_10035160
597 Ga0207699_10130381
598 Ga0207645_10022233
599 Ga0207643_10065545
600 Ga0207654_10004600
601 Ga0207693_10003437
602 Ga0207660_10019768
603 Ga0207660_10130750
604 Ga0207660_10188228
605 Ga0207662_10024440
606 Ga0207662_10107520
607 Ga0207657_10007133
608 Ga0207657_10103233
609 Ga0207657_10145585
610 Ga0207657_10371787
611 Ga0207652_10246798
612 Ga0207681_10244203
613 Ga0207694_10040801
614 Ga0207659_10256393
615 Ga0207687_10016883
616 Ga0207700_10069876
617 Ga0207700_10109656
618 Ga0207664_10015721
619 Ga0207664_10062629
620 Ga0207644_10019223
621 Ga0207706_10025928
622 Ga0207686_10019347
623 Ga0207709_10129708
624 Ga0207709_10190006
625 Ga0207670_10247355
626 Ga0207670_10274744
627 Ga0207669_10284567
628 Ga0207704_10076035
629 Ga0207704_10127221
630 Ga0207665_10000265
631 Ga0207665_10181487
632 Ga0207691_10059624
633 Ga0207711_10161106
634 Ga0207711_10445534
635 Ga0207689_10011270
636 Ga0207689_10026799
637 Ga0207689_10036991
638 Ga0207679_10192388
639 Ga0207679_10213117
640 Ga0207667_10022704
641 Ga0207712_10044316
642 Ga0207712_10148345
643 Ga0207712_10292538
644 Ga0207668_10044495
645 Ga0207640_10379988
646 Ga0207677_10152986
647 Ga0207677_10247977
648 Ga0207703_10020020
649 Ga0207703_10203559
650 Ga0207639_10377092
651 Ga0207678_10020266
652 Ga0207678_10042834
653 Ga0207678_10204133
654 Ga0207641_10070957
655 Ga0207648_10098908
656 Ga0207676_10124025
657 Ga0207674_10060720
658 Ga0207674_10081040
659 Ga0207675_100030151
660 Ga0207675_100071292
661 Ga0207683_10006706
662 Ga0207683_10027799
663 Ga0207683_10077828
664 Ga0207428_10161743
665 Ga0268266_10003520
666 Ga0268266_10010718
667 Ga0268266_10012789
668 Ga0268265_10016767
669 Ga0268265_10221763
670 Ga0268264_10220235
671 Ga0265337_1000250
672 Ga0265325_10000053
673 Ga0265325_10038429
674 Ga0265340_10014213
675 Ga0265339_10001034
676 Ga0265331_10041003
677 Ga0265313_10032472
678 Ga0265314_10002155
679 Ga0265314_10008989
680 Ga0265342_10000954
681 Ga0307413_10342515
682 Ga0307410_10146451
683 Ga0307409_100108860
684 Ga0307414_10062579
685 Ga0307415_100098171
686 Ga0373926_0028032
687 Ga0373944_0005309
688 Ga0373951_0002572
689 Ga0373936_0022463
690 Ga0373954_0005693
691 Ga0373954_0013257
692 Ga0373943_0001738
693 Ga0373946_0054624
694 Ga0373955_0002538
695 Ga0373961_0001489
696 Ga0373962_0006224
697 Ga0373962_0040725
698 Ga0373924_0005203
699 Ga0373924_0084262
700 Ga0373931_0009518
701 Ga0373935_0025423
702 Ga0373935_0058894
703 Ga0373927_0009273
704 Ga0373933_0167291
705 Ga0373947_0007515
706 Ga0373947_0015555
707 Ga0373937_0079525
708 Ga0373925_0014297
709 Ga0373925_0026861
710 Ga0373925_0153002
711 Ga0436364_0650169
712 Ga0436360_0654994
713 Ga0466972_0144708
714 Ga0466966_0106983
715 Ga0453684_0073767
716 Ga0466957_0020434
717 Ga0466960_0106618
718 Ga0495592_0013943
719 Ga0495603_0013671
720 Ga0495603_0016198
721 Ga0495629_0000875
722 Ga0495638_0000001
723 Ga0495641_0013172
724 Ga0495651_0011085
725 Ga0495580_0139365
726 Ga0495582_0002081
727 Ga0495662_0010543
728 Ga0495608_0187345
729 Ga0495628_0041236
730 Ga0495628_0180945
731 Ga0495652_0054907
732 Ga0495665_0009115
733 Ga0495640_0010134
734 Ga0495587_0019919
735 Ga0495622_0029702
736 Ga0495667_0003730
737 Ga0495657_0050996
738 Ga0495647_0026764
739 Ga0495647_0039151
740 Ga0495613_0025427
741 Ga0495624_0077277
742 Ga0495624_0089814
743 Ga0495649_0017234
744 Ga0495600_0121576
745 Ga0495581_0034674
746 Ga0495581_0142860
747 Ga0495604_0026274
748 Ga0495604_0123031
749 Ga0495676_0106802
750 Ga0495676_0207563
751 Ga0495676_0225735
752 Ga0495680_0003824
753 Ga0495680_0062166
754 Ga0495675_0083554
755 Ga0495593_0018424
756 Ga0495614_0062847
757 Ga0496101_0041308
758 Ga0496101_0168376
759 Ga0496102_0110985
760 Ga0496103_0123017
761 Ga0496105_0162266
762 Ga0496106_0449219
763 Ga0496108_0111538
764 Ga0496108_0221945
765 Ga0496109_0035838
766 Ga0496109_0044564
767 Ga0496109_0326184
768 Ga0496110_0107336
769 Ga0496110_0140359
770 Ga0496110_0148898
771 Ga0496111_0032388
772 Ga0496112_0049919
773 Ga0496112_0051378
774 Ga0496112_0555820
775 Ga0496113_0016647
776 Ga0496113_0017879
777 Ga0496113_0053175
778 Ga0496113_0158842
779 Ga0496114_0010689
780 Ga0496115_0119726
781 Ga0496115_0126245
782 Ga0496115_0359122
783 Ga0496121_0077879
784 Ga0496121_0109884
785 Ga0496124_0209480
786 Ga0501031_0020555
787 Ga0501032_0010657
788 Ga0501033_0218137
789 Ga0501034_0050543
790 Ga0501034_0052315
791 Ga0501034_0062682
792 Ga0501034_0166923
793 Ga0501036_0058223
794 Ga0501037_0006555
795 Ga0501037_0225449
796 Ga0501038_0012755
797 Ga0501038_0335843
798 Ga0501039_0013895
799 Ga0501042_0116899
800 Ga0501043_0147370
801 Ga0501043_0187665
802 Ga0501047_0310083
803 Ga0501048_0008156
804 Ga0501067_0024052
805 Ga0501067_0107955
806 Ga0501069_0088783
807 Ga0501070_0338977
808 Ga0501071_0197316
809 Ga0501073_0017482
810 Ga0501073_0112399
811 Ga0501074_0206742
812 Ga0501076_0360254
813 Ga0501236_002505
814 Ga0501079_0052021
815 Ga0501080_0004302
816 Ga0501083_0024209
817 Ga0501035_0058046
818 Ga0501044_0001046
819 Ga0501044_0325863
820 Ga0501044_0346885
821 Ga0501045_0006385
822 nmdc:mga03683_25880_c1
823 nmdc:mga03683_39931_c1
824 nmdc:mga0k408_14171_c1
825 nmdc:mga0k408_17808_c1
826 nmdc:mga06z11_39561_c1
827 nmdc:mga04h51_5977_c1
828 nmdc:mga07m45_31280_c1
829 nmdc:mga07m45_31947_c1
830 nmdc:mga05p37_169120_c1
831 nmdc:mga05p37_21969_c1
832 nmdc:mga08y16_26137_c1
833 nmdc:mga0n895_7805_c1
834 nmdc:mga0rr50_63076_c1
835 nmdc:mga0rr50_73140_c1
836 nmdc:mga0a205_24887_c1
837 nmdc:mga0a205_64992_c1
838 Ga0495612_0008457
839 Ga0495595_0026424
840 Ga0495595_0036015
841 Ga0495619_0043925
842 Ga0495619_0208993
843 Ga0500643_004385
844 Ga0500644_0000369
845 Ga0500566_0012802
846 Ga0500641_0033274
847 Ga0500595_000029
848 Ga0500588_0048742
849 Ga0500616_0000009
850 Ga0500620_028566
851 Ga0500627_0026978
852 Ga0500639_040115
853 Ga0500645_000143
854 2509152946
855 2513676203
856 2513891790
857 2524002035
858 2876817297
859 2879113469
860 2885387758
861 2903776058
862 2922367593
863 2922391570
864 8006986130
865 8019659198
866 8056684949

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

3

250

0.93

PF04321

RmlD_sub_bind

RmlD substrate binding domain

1

295

0.84

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

4

313

0.83

PF08659

KR

KR domain

1

161

0.8

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

4

272

0.72

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

3

243

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u4q-assembly1.cif.gz_B 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad. 0.9643 2 336
5u4q-assembly1.cif.gz_B 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad. 0.9612 2 336
5u4q-assembly1.cif.gz_A 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad. 0.9603 2 335
5u4q-assembly1.cif.gz_A 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad. 0.9516 2 335
6zla-assembly2.cif.gz_D-2 crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with nad 0.9233 4 332
ID Description Score Start End Superfamily
5u4qA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9499 4 335 3.40.50.720
3zdnC01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.947 4 34 3.50.50.60
5u4qA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9379 4 335 3.40.50.720
af_O65936_46_234_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9219 3 34 3.50.50.60
af_O65404_36_399_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9214 3 34 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A529I3D6-F1-model_v4 deleted 0.9891 180 335
AF-A0A523M0X6-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9863 4 129
AF-A0A2E1M331-F1-model_v4 Capsular biosynthesis protein CpsI 0.984 4 335
AF-B9TG48-F1-model_v4 UDP-glucuronate 5-epimerase, putative (EC 5.1.3.12) 0.9836 193 335 GO:0016853
AF-A0A3C0Q6Z7-F1-model_v4 Capsular biosynthesis protein CpsI 0.9825 164 335

Map