F442798

General Info

Members Datasets Scaffolds Average Seq Length
433 231 866 263

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100423983|Ga0070704_1004239832
Length 275
Sequence VSTLRLPVIVLLLGPLAATGAFWTAQSAVAQDSKAEIEKYQRMIADSSPVELFELQGEALWRKPQGPARVSLERCDLGLGAGVLKGAYAQLPRYFKDADRVMDLETRLLHCMTNLQGRSRDEATKRVFGNENQPSEMEYLSAYIAGQSRGVKLAAGHTHPKEKAAYELGKALFFHRAGGWDMSCASCHGEENKRIRMQDLPVLHKPQSARPIMATWPAYRVSNSQFKTMQWRINDCYRQMRYPEPNFASEATIAMNTFLAVTAAGEPYRGPGTKR

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
109 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
110 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
114 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
115 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
116 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
117 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
118 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
119 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
120 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
121 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
122 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
123 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
124 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
125 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
126 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
127 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
132 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
133 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
134 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
144 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
145 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
146 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
147 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
148 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
149 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
150 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
151 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
168 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
177 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
212 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
228 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
229 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.23
Rhizosphere 99.77
Stem 0
Stem Tuber 0
Unclassified 3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100423983 3300005549 Bacteria 1140
2 Ga0070690_100000242 3300005330 Bacteria 28065
3 Ga0070690_100010579 3300005330 Bacteria 5374
4 Ga0070690_100059450 3300005330 Bacteria 2457
5 Ga0070670_100349343 3300005331 Bacteria 1299
6 Ga0070677_10024906 3300005333 Bacteria 2230
7 Ga0068869_100000383 3300005334 Bacteria 24002
8 Ga0070680_100002710 3300005336 Bacteria 13138
9 Ga0070680_100214859 3300005336 Bacteria 1623
10 Ga0070680_100221407 3300005336 Bacteria 1597
11 Ga0068868_100000919 3300005338 Bacteria 20028
12 Ga0070689_100002471 3300005340 Bacteria 12071
13 Ga0070689_100317788 3300005340 Bacteria 1299
14 Ga0070691_10013894 3300005341 Bacteria 3695
15 Ga0070691_10089999 3300005341 Bacteria 1512
16 Ga0070687_100000352 3300005343 Bacteria 15634
17 Ga0070687_100066055 3300005343 Bacteria 1926
18 Ga0070692_10003541 3300005345 Bacteria 6349
19 Ga0070692_10006640 3300005345 Bacteria 5035
20 Ga0070692_10061988 3300005345 Bacteria 1973
21 Ga0070669_100073018 3300005353 Bacteria 2541
22 Ga0070669_100321345 3300005353 Bacteria 1250
23 Ga0070673_100259424 3300005364 Bacteria 1518
24 Ga0070703_10007541 3300005406 Bacteria 3056
25 Ga0070701_10001126 3300005438 Bacteria 9770
26 Ga0070701_10071875 3300005438 Bacteria 1851
27 Ga0070701_10203050 3300005438 Bacteria 1173
28 Ga0070705_100000984 3300005440 Bacteria 15928
29 Ga0070705_100014802 3300005440 Bacteria 4022
30 Ga0070700_100001627 3300005441 Bacteria 11230
31 Ga0070700_100001720 3300005441 Bacteria 10985
32 Ga0070694_100001000 3300005444 Bacteria 16049
33 Ga0070694_100090922 3300005444 Bacteria 2141
34 Ga0070694_100257340 3300005444 Bacteria 1323
35 Ga0070694_100259586 3300005444 Bacteria 1317
36 Ga0068867_100002032 3300005459 Bacteria 14147
37 Ga0070697_100304632 3300005536 Bacteria 1370
38 Ga0070686_100000440 3300005544 Bacteria 25874
39 Ga0070686_100009534 3300005544 Bacteria 5458
40 Ga0070686_100288410 3300005544 Unclassified 1213
41 Ga0070686_100327493 3300005544 Bacteria 1144
42 Ga0070686_100513368 3300005544 Bacteria 932
43 Ga0070695_100017100 3300005545 Bacteria 4399
44 Ga0070695_100079337 3300005545 Bacteria 2166
45 Ga0070695_100120699 3300005545 Unclassified 1793
46 Ga0070696_100001905 3300005546 Bacteria 13727
47 Ga0070696_100100865 3300005546 Bacteria 2069
48 Ga0070696_100176272 3300005546 Unclassified 1584
49 Ga0070696_100497675 3300005546 Bacteria 969
50 Ga0070693_100000458 3300005547 Bacteria 18306
51 Ga0070693_100278662 3300005547 Bacteria 1119
52 Ga0070704_100000205 3300005549 Bacteria 24552
53 Ga0070704_100003034 3300005549 Bacteria 9555
54 Ga0070704_100063066 3300005549 Bacteria 2659
55 Ga0068855_100002240 3300005563 Bacteria 23909
56 Ga0068854_100007086 3300005578 Bacteria 7157
57 Ga0068856_100037145 3300005614 Bacteria 4778
58 Ga0070702_100001321 3300005615 Bacteria 10043
59 Ga0070702_100059953 3300005615 Bacteria 2211
60 Ga0070702_100086763 3300005615 Bacteria 1888
61 Ga0070702_100299350 3300005615 Bacteria 1112
62 Ga0068852_100044703 3300005616 Bacteria 3764
63 Ga0068859_100001225 3300005617 Bacteria 26177
64 Ga0068859_100045338 3300005617 Bacteria 4417
65 Ga0068859_100152978 3300005617 Unclassified 2383
66 Ga0068866_10000951 3300005718 Bacteria 12735
67 Ga0068861_100000491 3300005719 Bacteria 22991
68 Ga0068863_100178920 3300005841 Bacteria 2036
69 Ga0068858_100008799 3300005842 Bacteria 9680
70 Ga0068860_100001267 3300005843 Bacteria 27601
71 Ga0068862_100002102 3300005844 Bacteria 17947
72 Ga0068862_100005468 3300005844 Bacteria 10618
73 Ga0081539_10001221 3300005985 Bacteria 45911
74 Ga0075432_10093339 3300006058 Bacteria 1104
75 Ga0097621_100000705 3300006237 Bacteria 23419
76 Ga0097621_100004853 3300006237 Bacteria 9420
77 Ga0068871_100001420 3300006358 Bacteria 16039
78 Ga0075428_100005614 3300006844 Bacteria 13936
79 Ga0075428_100006248 3300006844 Bacteria 13243
80 Ga0075428_100008698 3300006844 Bacteria 11263
81 Ga0075428_100027583 3300006844 Bacteria 6283
82 Ga0075428_100563359 3300006844 Bacteria 1218
83 Ga0075430_100007467 3300006846 Bacteria 9227
84 Ga0075430_100016575 3300006846 Bacteria 6275
85 Ga0075431_100004605 3300006847 Bacteria 13538
86 Ga0075431_100014320 3300006847 Bacteria 8021
87 Ga0075431_100033106 3300006847 Bacteria 5327
88 Ga0075431_100120177 3300006847 Bacteria 2711
89 Ga0075431_100131513 3300006847 Bacteria 2581
90 Ga0075431_100135028 3300006847 Bacteria 2543
91 Ga0075431_100528518 3300006847 Bacteria 1168
92 Ga0075433_10071651 3300006852 Bacteria 3046
93 Ga0075433_10074551 3300006852 Bacteria 2986
94 Ga0075434_100001497 3300006871 Bacteria 19730
95 Ga0075434_100055893 3300006871 Bacteria 3922
96 Ga0075434_100157031 3300006871 Bacteria 2294
97 Ga0075429_100001091 3300006880 Bacteria 21833
98 Ga0075429_100002502 3300006880 Bacteria 15457
99 Ga0068865_100000760 3300006881 Bacteria 18094
100 Ga0068865_100219226 3300006881 Bacteria 1486
101 Ga0075436_100000342 3300006914 Bacteria 29761
102 Ga0075436_100010626 3300006914 Bacteria 6313
103 Ga0075436_100039416 3300006914 Bacteria 3261
104 Ga0097620_100001225 3300006931 Bacteria 26177
105 Ga0097620_100045338 3300006931 Bacteria 4417
106 Ga0097620_100152969 3300006931 Unclassified 2383
107 Ga0075435_100000775 3300007076 Bacteria 19808
108 Ga0075435_100006382 3300007076 Bacteria 8335
109 Ga0075435_100041370 3300007076 Bacteria 3683
110 Ga0111539_10022575 3300009094 Bacteria 7731
111 Ga0111539_10026012 3300009094 Bacteria 7162
112 Ga0111539_10062899 3300009094 Bacteria 4392
113 Ga0111539_10083495 3300009094 Bacteria 3756
114 Ga0111539_10224200 3300009094 Bacteria 2189
115 Ga0111539_10314940 3300009094 Unclassified 1821
116 Ga0105245_10001829 3300009098 Bacteria 19360
117 Ga0114129_10009250 3300009147 Bacteria 14051
118 Ga0114129_10011367 3300009147 Bacteria 12681
119 Ga0114129_10013192 3300009147 Bacteria 11773
120 Ga0114129_10328120 3300009147 Bacteria 2033
121 Ga0114129_10457502 3300009147 Bacteria 1673
122 Ga0105243_10001858 3300009148 Bacteria 18028
123 Ga0105243_10062574 3300009148 Bacteria 2979
124 Ga0105241_10016386 3300009174 Bacteria 5435
125 Ga0105242_10003637 3300009176 Bacteria 12004
126 Ga0105249_10000348 3300009553 Bacteria 46377
127 Ga0105249_10009365 3300009553 Bacteria 8568
128 Ga0157378_10008762 3300013297 Bacteria 8808
129 Ga0163162_10116303 3300013306 Bacteria 2775
130 Ga0157372_10082605 3300013307 Bacteria 3638
131 Ga0157375_10225120 3300013308 Bacteria 2035
132 Ga0157375_10619841 3300013308 Bacteria 1240
133 Ga0157380_10001733 3300014326 Bacteria 14385
134 Ga0157380_10208607 3300014326 Bacteria 1739
135 Ga0157379_10179539 3300014968 Bacteria 1912
136 Ga0157376_10005398 3300014969 Bacteria 8938
137 Ga0207682_10020221 3300025893 Bacteria 2612
138 Ga0207642_10000956 3300025899 Bacteria 9028
139 Ga0207642_10085816 3300025899 Bacteria 1541
140 Ga0207688_10052223 3300025901 Bacteria 2290
141 Ga0207647_10030566 3300025904 Bacteria 3472
142 Ga0207643_10015813 3300025908 Bacteria 4110
143 Ga0207643_10049924 3300025908 Bacteria 2371
144 Ga0207684_10374315 3300025910 Bacteria 1225
145 Ga0207654_10015733 3300025911 Bacteria 3931
146 Ga0207660_10055664 3300025917 Bacteria 2828
147 Ga0207662_10000223 3300025918 Bacteria 26281
148 Ga0207662_10013362 3300025918 Bacteria 4591
149 Ga0207681_10002285 3300025923 Bacteria 12181
150 Ga0207681_10299278 3300025923 Bacteria 1272
151 Ga0207659_10303543 3300025926 Bacteria 1312
152 Ga0207687_10031936 3300025927 Bacteria 3563
153 Ga0207686_10000347 3300025934 Bacteria 33269
154 Ga0207709_10000980 3300025935 Bacteria 21307
155 Ga0207709_10001597 3300025935 Bacteria 15448
156 Ga0207670_10022085 3300025936 Bacteria 3938
157 Ga0207670_10343196 3300025936 Bacteria 1181
158 Ga0207670_10471233 3300025936 Bacteria 1015
159 Ga0207669_10502682 3300025937 Bacteria 970
160 Ga0207704_10003442 3300025938 Bacteria 7193
161 Ga0207704_10198192 3300025938 Bacteria 1467
162 Ga0207665_10038468 3300025939 Bacteria 3186
163 Ga0207691_10117952 3300025940 Bacteria 2354
164 Ga0207689_10000913 3300025942 Bacteria 28320
165 Ga0207667_10034866 3300025949 Bacteria 5401
166 Ga0207651_10099755 3300025960 Bacteria 2151
167 Ga0207712_10003645 3300025961 Bacteria 9701
168 Ga0207712_10031351 3300025961 Bacteria 3580
169 Ga0207640_10028914 3300025981 Bacteria 3395
170 Ga0207677_10005267 3300026023 Bacteria 7005
171 Ga0207703_10007115 3300026035 Bacteria 8903
172 Ga0207708_10000268 3300026075 Bacteria 40756
173 Ga0207708_10006794 3300026075 Bacteria 8464
174 Ga0207702_10026993 3300026078 Bacteria 4768
175 Ga0207641_10107209 3300026088 Bacteria 2471
176 Ga0207641_10611575 3300026088 Bacteria 1068
177 Ga0207648_10001327 3300026089 Bacteria 27511
178 Ga0207648_10002245 3300026089 Bacteria 20908
179 Ga0207648_10501119 3300026089 Bacteria 1111
180 Ga0207674_10071361 3300026116 Bacteria 3489
181 Ga0207675_100001288 3300026118 Bacteria 25119
182 Ga0207675_100004252 3300026118 Bacteria 13850
183 Ga0207698_10174045 3300026142 Bacteria 1899
184 Ga0209967_1003328 3300027364 Bacteria 2113
185 Ga0209967_1004452 3300027364 Bacteria 1862
186 Ga0209981_1001315 3300027378 Bacteria 3147
187 Ga0209996_1003190 3300027395 Bacteria 2053
188 Ga0210000_1004704 3300027462 Unclassified 1971
189 Ga0210000_1015467 3300027462 Bacteria 1149
190 Ga0209968_1002452 3300027526 Bacteria 2802
191 Ga0209968_1008615 3300027526 Bacteria 1556
192 Ga0209999_1000570 3300027543 Bacteria 5806
193 Ga0209983_1035256 3300027665 Unclassified 1072
194 Ga0207428_10000688 3300027907 Bacteria 39292
195 Ga0207428_10032549 3300027907 Bacteria 4287
196 Ga0207428_10043482 3300027907 Bacteria 3627
197 Ga0207428_10069753 3300027907 Bacteria 2763
198 Ga0207428_10095406 3300027907 Bacteria 2304
199 Ga0268265_10000837 3300028380 Bacteria 28984
200 Ga0268265_10001658 3300028380 Bacteria 18219
201 Ga0268264_10004138 3300028381 Bacteria 12410
202 Ga0265331_10013157 3300031250 Bacteria 4457
203 Ga0316579_10001219 3300031691 Bacteria 9233
204 Ga0316578_10045901 3300031728 Bacteria 2545
205 Ga0307416_100040483 3300032002 Bacteria 3621
206 Ga0307416_100075541 3300032002 Bacteria 2820
207 Ga0307416_100108594 3300032002 Bacteria 2438
208 Ga0307416_100327357 3300032002 Unclassified 1538
209 Ga0307416_100787738 3300032002 Bacteria 1046
210 Ga0307411_10112402 3300032005 Bacteria 1952
211 Ga0316583_10000962 3300032133 Bacteria 9276
212 Ga0316583_10003200 3300032133 Bacteria 5756
213 Ga0373948_0057792 3300034817 Bacteria 846
214 Ga0373958_0000509 3300034819 Bacteria 4828
215 Ga0373959_0022965 3300034820 Bacteria 1210
216 Ga0373926_0003453 3300035083 Bacteria 5096
217 Ga0373928_0015201 3300035084 Bacteria 1564
218 Ga0373929_0021823 3300035085 Bacteria 1302
219 Ga0373940_0016464 3300035088 Bacteria 1831
220 Ga0373944_0012336 3300035089 Bacteria 2352
221 Ga0373949_0004789 3300035090 Bacteria 3070
222 Ga0373951_0021169 3300035091 Bacteria 1493
223 Ga0373952_0003344 3300035092 Bacteria 2892
224 Ga0373932_0030469 3300035112 Bacteria 1496
225 Ga0373945_0001029 3300035116 Bacteria 8367
226 Ga0373954_0000034 3300035118 Bacteria 52216
227 Ga0373956_0023176 3300035119 Bacteria 2662
228 Ga0373960_0028317 3300035121 Bacteria 1545
229 Ga0373943_0025866 3300035170 Bacteria 2745
230 Ga0373942_0032369 3300035207 Bacteria 1388
231 Ga0373961_0006298 3300035241 Bacteria 2853
232 Ga0373961_0067967 3300035241 Bacteria 1096
233 Ga0373962_0005983 3300035242 Bacteria 2936
234 Ga0373924_0007989 3300035410 Bacteria 3830
235 Ga0373931_0000108 3300035691 Bacteria 37813
236 Ga0373931_0019744 3300035691 Bacteria 3366
237 Ga0373931_0039037 3300035691 Bacteria 2487
238 Ga0373931_0249692 3300035691 Unclassified 1078
239 Ga0373935_0057015 3300035692 Bacteria 2491
240 Ga0373927_0028818 3300035695 Bacteria 3620
241 Ga0373933_0003835 3300035724 Bacteria 8308
242 Ga0373947_0044704 3300035725 Bacteria 2648
243 Ga0373937_0000166 3300036401 Bacteria 63970
244 Ga0373937_0002871 3300036401 Bacteria 14389
245 Ga0373937_0036349 3300036401 Bacteria 4488
246 Ga0316582_0152088 3300036647 Bacteria 1564
247 Ga0373925_0070708 3300037068 Bacteria 2638
248 Ga0439453_0006094 3300041408 Bacteria 1864
249 Ga0451807_0107223 3300041486 Bacteria 4573
250 Ga0439431_0022131 3300041997 Unclassified 1530
251 Ga0439441_005516 3300042001 Bacteria 1971
252 Ga0439441_013289 3300042001 Bacteria 1426
253 Ga0439443_006240 3300042003 Bacteria 1626
254 Ga0439434_0001773 3300042435 Bacteria 6273
255 Ga0439435_0000023 3300042436 Bacteria 16449
256 Ga0439435_0002785 3300042436 Bacteria 3531
257 Ga0439444_0004755 3300042437 Bacteria 1986
258 Ga0439460_0038226 3300042461 Bacteria 1399
259 Ga0439460_0084112 3300042461 Bacteria 1002
260 Ga0451577_0001434 3300042876 Bacteria 31748
261 Ga0451577_0056518 3300042876 Bacteria 3501
262 Ga0451577_0409546 3300042876 Bacteria 1231
263 Ga0451577_0437546 3300042876 Bacteria 1187
264 Ga0466965_0062681 3300044683 Bacteria 1860
265 Ga0453684_0483393 3300044712 Bacteria 1373
266 Ga0453684_0527907 3300044712 Bacteria 1303
267 Ga0451576_0002547 3300045051 Bacteria 26935
268 Ga0451576_0004241 3300045051 Bacteria 18821
269 Ga0451576_0004835 3300045051 Bacteria 17249
270 Ga0451576_0008449 3300045051 Bacteria 12089
271 Ga0451576_0016589 3300045051 Bacteria 8123
272 Ga0451576_0018414 3300045051 Bacteria 7656
273 Ga0451576_0130102 3300045051 Bacteria 2624
274 Ga0451576_0151516 3300045051 Bacteria 2418
275 Ga0451576_0400754 3300045051 Bacteria 1439
276 Ga0451576_0645549 3300045051 Bacteria 1112
277 Ga0495592_0009933 3300046454 Bacteria 7166
278 Ga0495629_0131153 3300046459 Bacteria 1746
279 Ga0495653_0117953 3300046463 Bacteria 1896
280 Ga0495580_0013561 3300046472 Bacteria 6216
281 Ga0495582_0041040 3300046473 Bacteria 2549
282 Ga0495639_0007423 3300046475 Bacteria 4706
283 Ga0495594_0081101 3300046499 Bacteria 1811
284 Ga0495608_0001125 3300046511 Bacteria 18924
285 Ga0495608_0079457 3300046511 Bacteria 2133
286 Ga0495618_0012659 3300046514 Bacteria 5125
287 Ga0495628_0000532 3300046516 Bacteria 34861
288 Ga0495630_0068216 3300046517 Bacteria 2674
289 Ga0495644_0052234 3300046523 Bacteria 1535
290 Ga0495666_0003228 3300046526 Bacteria 8213
291 Ga0495666_0248851 3300046526 Bacteria 810
292 Ga0495640_0001145 3300046533 Bacteria 20719
293 Ga0495640_0078937 3300046533 Bacteria 2192
294 Ga0495586_0000593 3300046535 Bacteria 21002
295 Ga0495586_0010097 3300046535 Bacteria 5024
296 Ga0495586_0219596 3300046535 Bacteria 1080
297 Ga0495587_0085331 3300046536 Bacteria 1828
298 Ga0495598_0011958 3300046537 Bacteria 2116
299 Ga0495667_0024441 3300046559 Bacteria 4068
300 Ga0495667_0083367 3300046559 Bacteria 2076
301 Ga0495656_0018210 3300046615 Bacteria 2693
302 Ga0495634_0010374 3300046642 Bacteria 6826
303 Ga0495659_0101610 3300046664 Bacteria 1114
304 Ga0495647_0000131 3300046681 Bacteria 19061
305 Ga0495647_0091422 3300046681 Bacteria 1248
306 Ga0495658_0004345 3300046683 Bacteria 6983
307 Ga0495658_0014716 3300046683 Bacteria 4000
308 Ga0495613_0027799 3300046689 Bacteria 4209
309 Ga0495624_0093099 3300046690 Bacteria 1858
310 Ga0495624_0196886 3300046690 Bacteria 1225
311 Ga0495600_0003987 3300046809 Bacteria 8775
312 Ga0495604_0006650 3300047317 Bacteria 9161
313 Ga0495636_0016308 3300047318 Bacteria 2966
314 Ga0495674_0187263 3300047319 Bacteria 1722
315 Ga0495676_0107293 3300047321 Bacteria 2056
316 Ga0495680_0001364 3300047322 Bacteria 26513
317 Ga0495675_0201346 3300047444 Bacteria 1212
318 Ga0501297_015159 3300049520 Bacteria 920
319 Ga0501031_0099137 3300049568 Bacteria 1901
320 Ga0501031_0193355 3300049568 Unclassified 1328
321 Ga0501033_0011644 3300049570 Bacteria 6726
322 Ga0501033_0230126 3300049570 Bacteria 1317
323 Ga0501036_0007126 3300049572 Bacteria 9101
324 Ga0501036_0032156 3300049572 Bacteria 4433
325 Ga0501036_0040455 3300049572 Bacteria 3943
326 Ga0501036_0063829 3300049572 Bacteria 3118
327 Ga0501037_0031612 3300049573 Bacteria 3909
328 Ga0501038_0002619 3300049574 Bacteria 16824
329 Ga0501038_0059253 3300049574 Bacteria 3280
330 Ga0501038_0212016 3300049574 Bacteria 1549
331 Ga0501039_0012143 3300049575 Bacteria 6567
332 Ga0501039_0098399 3300049575 Bacteria 2282
333 Ga0501039_0123440 3300049575 Bacteria 2030
334 Ga0501039_0175160 3300049575 Bacteria 1687
335 Ga0501039_0188476 3300049575 Bacteria 1622
336 Ga0501040_0000846 3300049576 Bacteria 19189
337 Ga0501040_0002650 3300049576 Bacteria 11542
338 Ga0501040_0025121 3300049576 Bacteria 4003
339 Ga0501040_0154377 3300049576 Bacteria 1621
340 Ga0501041_0008774 3300049577 Bacteria 5949
341 Ga0501041_0011220 3300049577 Bacteria 5293
342 Ga0501041_0195480 3300049577 Bacteria 1267
343 Ga0501041_0238545 3300049577 Bacteria 1142
344 Ga0501042_0007028 3300049578 Bacteria 7348
345 Ga0501042_0113172 3300049578 Bacteria 1954
346 Ga0501042_0303381 3300049578 Bacteria 1154
347 Ga0501046_0001577 3300049580 Bacteria 21793
348 Ga0501046_0106801 3300049580 Bacteria 2142
349 Ga0501046_0139404 3300049580 Bacteria 1836
350 Ga0501046_0153398 3300049580 Bacteria 1737
351 Ga0501048_0002530 3300049582 Bacteria 13982
352 Ga0501048_0021146 3300049582 Bacteria 4765
353 Ga0501067_0040569 3300049583 Bacteria 2585
354 Ga0501068_0107192 3300049584 Bacteria 1735
355 Ga0501068_0116208 3300049584 Bacteria 1666
356 Ga0501070_0080057 3300049586 Bacteria 2703
357 Ga0501071_0000428 3300049587 Bacteria 21030
358 Ga0501071_0132572 3300049587 Bacteria 1852
359 Ga0501071_0348628 3300049587 Bacteria 1126
360 Ga0501072_0000896 3300049588 Bacteria 21852
361 Ga0501072_0003229 3300049588 Bacteria 12234
362 Ga0501072_0055735 3300049588 Bacteria 3115
363 Ga0501072_0064517 3300049588 Bacteria 2888
364 Ga0501074_0012568 3300049590 Bacteria 6155
365 Ga0501074_0100425 3300049590 Bacteria 2071
366 Ga0501075_0001354 3300049591 Bacteria 15928
367 Ga0501075_0011507 3300049591 Bacteria 6263
368 Ga0501076_0001233 3300049592 Bacteria 17022
369 Ga0501076_0003155 3300049592 Bacteria 11495
370 Ga0501076_0241159 3300049592 Bacteria 1479
371 Ga0501077_0000758 3300049593 Bacteria 19509
372 Ga0501079_0005659 3300049741 Bacteria 9327
373 Ga0501079_0056086 3300049741 Bacteria 3040
374 Ga0501080_0008023 3300049742 Bacteria 9566
375 Ga0501080_0025989 3300049742 Bacteria 5440
376 Ga0501080_0197254 3300049742 Bacteria 1849
377 Ga0501081_0005214 3300049743 Bacteria 8369
378 Ga0501081_0008825 3300049743 Bacteria 6553
379 Ga0501283_032394 3300049779 Bacteria 881
380 Ga0501035_0003301 3300049822 Bacteria 15464
381 Ga0501035_0195639 3300049822 Bacteria 1737
382 Ga0501044_0066919 3300049823 Bacteria 3662
383 Ga0501045_0001196 3300049824 Bacteria 17269
384 Ga0501045_0013679 3300049824 Bacteria 5736
385 Ga0501045_0108144 3300049824 Bacteria 2061
386 nmdc:mga05p37_200_c1 3300050507 Bacteria 59779
387 nmdc:mga05p37_400741_c1 3300050507 Bacteria 1602
388 nmdc:mga05p37_622565_c1 3300050507 Bacteria 1214
389 nmdc:mga05p37_65090_c1 3300050507 Bacteria 4486
390 nmdc:mga05p37_7607_c1 3300050507 Bacteria 12783
391 nmdc:mga05p37_828605_c1 3300050507 Bacteria 1008
392 nmdc:mga09592_10_c1 3300050508 Bacteria 106937
393 nmdc:mga09592_2555_c1 3300050508 Bacteria 14730
394 nmdc:mga09592_305430_c1 3300050508 Bacteria 1379
395 nmdc:mga0qj67_10335_c1 3300050509 Bacteria 6973
396 nmdc:mga0qj67_1788_c1 3300050509 Bacteria 15213
397 nmdc:mga06r32_20352_c1 3300050510 Bacteria 6108
398 nmdc:mga06r32_337612_c1 3300050510 Bacteria 1492
399 nmdc:mga06r32_652254_c1 3300050510 Bacteria 1021
400 nmdc:mga06r32_68471_c1 3300050510 Bacteria 3429
401 nmdc:mga06r32_84952_c1 3300050510 Bacteria 3086
402 nmdc:mga06r32_87016_c1 3300050510 Bacteria 3048
403 nmdc:mga08y16_20706_c1 3300050511 Bacteria 6942
404 nmdc:mga08y16_22121_c1 3300050511 Bacteria 6712
405 nmdc:mga08y16_2521_c1 3300050511 Bacteria 18816
406 nmdc:mga08y16_38253_c1 3300050511 Bacteria 5039
407 nmdc:mga08y16_40108_c1 3300050511 Bacteria 4909
408 nmdc:mga08y16_471229_c1 3300050511 Bacteria 1278
409 nmdc:mga0n895_178_c1 3300050512 Bacteria 38979
410 nmdc:mga0n895_257186_c1 3300050512 Bacteria 1772
411 nmdc:mga0n895_37231_c1 3300050512 Bacteria 4705
412 nmdc:mga0n895_53565_c1 3300050512 Bacteria 3965
413 nmdc:mga0n895_9970_c1 3300050512 Bacteria 8358
414 nmdc:mga0rr50_38266_c1 3300050513 Bacteria 3470
415 nmdc:mga0rr50_618683_c1 3300050513 Bacteria 924
416 nmdc:mga0rr50_71954_c1 3300050513 Bacteria 2640
417 nmdc:mga0rr50_79222_c1 3300050513 Bacteria 2530
418 nmdc:mga08x19_2191_c1 3300050514 Bacteria 11947
419 nmdc:mga08x19_42746_c1 3300050514 Bacteria 2890
420 nmdc:mga0a205_135814_c1 3300050515 Bacteria 2360
421 nmdc:mga0a205_156158_c1 3300050515 Bacteria 2180
422 nmdc:mga0a205_7499_c1 3300050515 Bacteria 9880
423 Ga0495601_0005687 3300053077 Bacteria 7266
424 Ga0501084_0351227 3300054114 Bacteria 1246
425 Ga0501084_0636343 3300054114 Bacteria 901
426 Ga0590071_015306 3300059421 Unclassified 1800
427 Ga0590074_026078 3300059423 Bacteria 1021
428 Ga0590077_012171 3300059426 Bacteria 1781
429 Ga0501082_0000187 3300060353 Bacteria 53600
430 Ga0501082_0017450 3300060353 Bacteria 6184
431 Ga0501082_0054334 3300060353 Bacteria 3452
432 Ga0530510_0000309 3300061734 Bacteria 31225
433 Ga0530510_0000779 3300061734 Bacteria 20734
434 Ga0070704_100423983
435 Ga0070690_100000242
436 Ga0070690_100010579
437 Ga0070690_100059450
438 Ga0070670_100349343
439 Ga0070677_10024906
440 Ga0068869_100000383
441 Ga0070680_100002710
442 Ga0070680_100214859
443 Ga0070680_100221407
444 Ga0068868_100000919
445 Ga0070689_100002471
446 Ga0070689_100317788
447 Ga0070691_10013894
448 Ga0070691_10089999
449 Ga0070687_100000352
450 Ga0070687_100066055
451 Ga0070692_10003541
452 Ga0070692_10006640
453 Ga0070692_10061988
454 Ga0070669_100073018
455 Ga0070669_100321345
456 Ga0070673_100259424
457 Ga0070703_10007541
458 Ga0070701_10001126
459 Ga0070701_10071875
460 Ga0070701_10203050
461 Ga0070705_100000984
462 Ga0070705_100014802
463 Ga0070700_100001627
464 Ga0070700_100001720
465 Ga0070694_100001000
466 Ga0070694_100090922
467 Ga0070694_100257340
468 Ga0070694_100259586
469 Ga0068867_100002032
470 Ga0070697_100304632
471 Ga0070686_100000440
472 Ga0070686_100009534
473 Ga0070686_100288410
474 Ga0070686_100327493
475 Ga0070686_100513368
476 Ga0070695_100017100
477 Ga0070695_100079337
478 Ga0070695_100120699
479 Ga0070696_100001905
480 Ga0070696_100100865
481 Ga0070696_100176272
482 Ga0070696_100497675
483 Ga0070693_100000458
484 Ga0070693_100278662
485 Ga0070704_100000205
486 Ga0070704_100003034
487 Ga0070704_100063066
488 Ga0068855_100002240
489 Ga0068854_100007086
490 Ga0068856_100037145
491 Ga0070702_100001321
492 Ga0070702_100059953
493 Ga0070702_100086763
494 Ga0070702_100299350
495 Ga0068852_100044703
496 Ga0068859_100001225
497 Ga0068859_100045338
498 Ga0068859_100152978
499 Ga0068866_10000951
500 Ga0068861_100000491
501 Ga0068863_100178920
502 Ga0068858_100008799
503 Ga0068860_100001267
504 Ga0068862_100002102
505 Ga0068862_100005468
506 Ga0081539_10001221
507 Ga0075432_10093339
508 Ga0097621_100000705
509 Ga0097621_100004853
510 Ga0068871_100001420
511 Ga0075428_100005614
512 Ga0075428_100006248
513 Ga0075428_100008698
514 Ga0075428_100027583
515 Ga0075428_100563359
516 Ga0075430_100007467
517 Ga0075430_100016575
518 Ga0075431_100004605
519 Ga0075431_100014320
520 Ga0075431_100033106
521 Ga0075431_100120177
522 Ga0075431_100131513
523 Ga0075431_100135028
524 Ga0075431_100528518
525 Ga0075433_10071651
526 Ga0075433_10074551
527 Ga0075434_100001497
528 Ga0075434_100055893
529 Ga0075434_100157031
530 Ga0075429_100001091
531 Ga0075429_100002502
532 Ga0068865_100000760
533 Ga0068865_100219226
534 Ga0075436_100000342
535 Ga0075436_100010626
536 Ga0075436_100039416
537 Ga0097620_100001225
538 Ga0097620_100045338
539 Ga0097620_100152969
540 Ga0075435_100000775
541 Ga0075435_100006382
542 Ga0075435_100041370
543 Ga0111539_10022575
544 Ga0111539_10026012
545 Ga0111539_10062899
546 Ga0111539_10083495
547 Ga0111539_10224200
548 Ga0111539_10314940
549 Ga0105245_10001829
550 Ga0114129_10009250
551 Ga0114129_10011367
552 Ga0114129_10013192
553 Ga0114129_10328120
554 Ga0114129_10457502
555 Ga0105243_10001858
556 Ga0105243_10062574
557 Ga0105241_10016386
558 Ga0105242_10003637
559 Ga0105249_10000348
560 Ga0105249_10009365
561 Ga0157378_10008762
562 Ga0163162_10116303
563 Ga0157372_10082605
564 Ga0157375_10225120
565 Ga0157375_10619841
566 Ga0157380_10001733
567 Ga0157380_10208607
568 Ga0157379_10179539
569 Ga0157376_10005398
570 Ga0207682_10020221
571 Ga0207642_10000956
572 Ga0207642_10085816
573 Ga0207688_10052223
574 Ga0207647_10030566
575 Ga0207643_10015813
576 Ga0207643_10049924
577 Ga0207684_10374315
578 Ga0207654_10015733
579 Ga0207660_10055664
580 Ga0207662_10000223
581 Ga0207662_10013362
582 Ga0207681_10002285
583 Ga0207681_10299278
584 Ga0207659_10303543
585 Ga0207687_10031936
586 Ga0207686_10000347
587 Ga0207709_10000980
588 Ga0207709_10001597
589 Ga0207670_10022085
590 Ga0207670_10343196
591 Ga0207670_10471233
592 Ga0207669_10502682
593 Ga0207704_10003442
594 Ga0207704_10198192
595 Ga0207665_10038468
596 Ga0207691_10117952
597 Ga0207689_10000913
598 Ga0207667_10034866
599 Ga0207651_10099755
600 Ga0207712_10003645
601 Ga0207712_10031351
602 Ga0207640_10028914
603 Ga0207677_10005267
604 Ga0207703_10007115
605 Ga0207708_10000268
606 Ga0207708_10006794
607 Ga0207702_10026993
608 Ga0207641_10107209
609 Ga0207641_10611575
610 Ga0207648_10001327
611 Ga0207648_10002245
612 Ga0207648_10501119
613 Ga0207674_10071361
614 Ga0207675_100001288
615 Ga0207675_100004252
616 Ga0207698_10174045
617 Ga0209967_1003328
618 Ga0209967_1004452
619 Ga0209981_1001315
620 Ga0209996_1003190
621 Ga0210000_1004704
622 Ga0210000_1015467
623 Ga0209968_1002452
624 Ga0209968_1008615
625 Ga0209999_1000570
626 Ga0209983_1035256
627 Ga0207428_10000688
628 Ga0207428_10032549
629 Ga0207428_10043482
630 Ga0207428_10069753
631 Ga0207428_10095406
632 Ga0268265_10000837
633 Ga0268265_10001658
634 Ga0268264_10004138
635 Ga0265331_10013157
636 Ga0316579_10001219
637 Ga0316578_10045901
638 Ga0307416_100040483
639 Ga0307416_100075541
640 Ga0307416_100108594
641 Ga0307416_100327357
642 Ga0307416_100787738
643 Ga0307411_10112402
644 Ga0316583_10000962
645 Ga0316583_10003200
646 Ga0373948_0057792
647 Ga0373958_0000509
648 Ga0373959_0022965
649 Ga0373926_0003453
650 Ga0373928_0015201
651 Ga0373929_0021823
652 Ga0373940_0016464
653 Ga0373944_0012336
654 Ga0373949_0004789
655 Ga0373951_0021169
656 Ga0373952_0003344
657 Ga0373932_0030469
658 Ga0373945_0001029
659 Ga0373954_0000034
660 Ga0373956_0023176
661 Ga0373960_0028317
662 Ga0373943_0025866
663 Ga0373942_0032369
664 Ga0373961_0006298
665 Ga0373961_0067967
666 Ga0373962_0005983
667 Ga0373924_0007989
668 Ga0373931_0000108
669 Ga0373931_0019744
670 Ga0373931_0039037
671 Ga0373931_0249692
672 Ga0373935_0057015
673 Ga0373927_0028818
674 Ga0373933_0003835
675 Ga0373947_0044704
676 Ga0373937_0000166
677 Ga0373937_0002871
678 Ga0373937_0036349
679 Ga0316582_0152088
680 Ga0373925_0070708
681 Ga0439453_0006094
682 Ga0451807_0107223
683 Ga0439431_0022131
684 Ga0439441_005516
685 Ga0439441_013289
686 Ga0439443_006240
687 Ga0439434_0001773
688 Ga0439435_0000023
689 Ga0439435_0002785
690 Ga0439444_0004755
691 Ga0439460_0038226
692 Ga0439460_0084112
693 Ga0451577_0001434
694 Ga0451577_0056518
695 Ga0451577_0409546
696 Ga0451577_0437546
697 Ga0466965_0062681
698 Ga0453684_0483393
699 Ga0453684_0527907
700 Ga0451576_0002547
701 Ga0451576_0004241
702 Ga0451576_0004835
703 Ga0451576_0008449
704 Ga0451576_0016589
705 Ga0451576_0018414
706 Ga0451576_0130102
707 Ga0451576_0151516
708 Ga0451576_0400754
709 Ga0451576_0645549
710 Ga0495592_0009933
711 Ga0495629_0131153
712 Ga0495653_0117953
713 Ga0495580_0013561
714 Ga0495582_0041040
715 Ga0495639_0007423
716 Ga0495594_0081101
717 Ga0495608_0001125
718 Ga0495608_0079457
719 Ga0495618_0012659
720 Ga0495628_0000532
721 Ga0495630_0068216
722 Ga0495644_0052234
723 Ga0495666_0003228
724 Ga0495666_0248851
725 Ga0495640_0001145
726 Ga0495640_0078937
727 Ga0495586_0000593
728 Ga0495586_0010097
729 Ga0495586_0219596
730 Ga0495587_0085331
731 Ga0495598_0011958
732 Ga0495667_0024441
733 Ga0495667_0083367
734 Ga0495656_0018210
735 Ga0495634_0010374
736 Ga0495659_0101610
737 Ga0495647_0000131
738 Ga0495647_0091422
739 Ga0495658_0004345
740 Ga0495658_0014716
741 Ga0495613_0027799
742 Ga0495624_0093099
743 Ga0495624_0196886
744 Ga0495600_0003987
745 Ga0495604_0006650
746 Ga0495636_0016308
747 Ga0495674_0187263
748 Ga0495676_0107293
749 Ga0495680_0001364
750 Ga0495675_0201346
751 Ga0501297_015159
752 Ga0501031_0099137
753 Ga0501031_0193355
754 Ga0501033_0011644
755 Ga0501033_0230126
756 Ga0501036_0007126
757 Ga0501036_0032156
758 Ga0501036_0040455
759 Ga0501036_0063829
760 Ga0501037_0031612
761 Ga0501038_0002619
762 Ga0501038_0059253
763 Ga0501038_0212016
764 Ga0501039_0012143
765 Ga0501039_0098399
766 Ga0501039_0123440
767 Ga0501039_0175160
768 Ga0501039_0188476
769 Ga0501040_0000846
770 Ga0501040_0002650
771 Ga0501040_0025121
772 Ga0501040_0154377
773 Ga0501041_0008774
774 Ga0501041_0011220
775 Ga0501041_0195480
776 Ga0501041_0238545
777 Ga0501042_0007028
778 Ga0501042_0113172
779 Ga0501042_0303381
780 Ga0501046_0001577
781 Ga0501046_0106801
782 Ga0501046_0139404
783 Ga0501046_0153398
784 Ga0501048_0002530
785 Ga0501048_0021146
786 Ga0501067_0040569
787 Ga0501068_0107192
788 Ga0501068_0116208
789 Ga0501070_0080057
790 Ga0501071_0000428
791 Ga0501071_0132572
792 Ga0501071_0348628
793 Ga0501072_0000896
794 Ga0501072_0003229
795 Ga0501072_0055735
796 Ga0501072_0064517
797 Ga0501074_0012568
798 Ga0501074_0100425
799 Ga0501075_0001354
800 Ga0501075_0011507
801 Ga0501076_0001233
802 Ga0501076_0003155
803 Ga0501076_0241159
804 Ga0501077_0000758
805 Ga0501079_0005659
806 Ga0501079_0056086
807 Ga0501080_0008023
808 Ga0501080_0025989
809 Ga0501080_0197254
810 Ga0501081_0005214
811 Ga0501081_0008825
812 Ga0501283_032394
813 Ga0501035_0003301
814 Ga0501035_0195639
815 Ga0501044_0066919
816 Ga0501045_0001196
817 Ga0501045_0013679
818 Ga0501045_0108144
819 nmdc:mga05p37_200_c1
820 nmdc:mga05p37_400741_c1
821 nmdc:mga05p37_622565_c1
822 nmdc:mga05p37_65090_c1
823 nmdc:mga05p37_7607_c1
824 nmdc:mga05p37_828605_c1
825 nmdc:mga09592_10_c1
826 nmdc:mga09592_2555_c1
827 nmdc:mga09592_305430_c1
828 nmdc:mga0qj67_10335_c1
829 nmdc:mga0qj67_1788_c1
830 nmdc:mga06r32_20352_c1
831 nmdc:mga06r32_337612_c1
832 nmdc:mga06r32_652254_c1
833 nmdc:mga06r32_68471_c1
834 nmdc:mga06r32_84952_c1
835 nmdc:mga06r32_87016_c1
836 nmdc:mga08y16_20706_c1
837 nmdc:mga08y16_22121_c1
838 nmdc:mga08y16_2521_c1
839 nmdc:mga08y16_38253_c1
840 nmdc:mga08y16_40108_c1
841 nmdc:mga08y16_471229_c1
842 nmdc:mga0n895_178_c1
843 nmdc:mga0n895_257186_c1
844 nmdc:mga0n895_37231_c1
845 nmdc:mga0n895_53565_c1
846 nmdc:mga0n895_9970_c1
847 nmdc:mga0rr50_38266_c1
848 nmdc:mga0rr50_618683_c1
849 nmdc:mga0rr50_71954_c1
850 nmdc:mga0rr50_79222_c1
851 nmdc:mga08x19_2191_c1
852 nmdc:mga08x19_42746_c1
853 nmdc:mga0a205_135814_c1
854 nmdc:mga0a205_156158_c1
855 nmdc:mga0a205_7499_c1
856 Ga0495601_0005687
857 Ga0501084_0351227
858 Ga0501084_0636343
859 Ga0590071_015306
860 Ga0590074_026078
861 Ga0590077_012171
862 Ga0501082_0000187
863 Ga0501082_0017450
864 Ga0501082_0054334
865 Ga0530510_0000309
866 Ga0530510_0000779

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21342

SoxA-TsdA_cyt-c

SoxA/TsdA, cytochrome c domain

56

153

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ocd-assembly2.cif.gz_C diheme soxax - c236m mutant 0.9394 42 264
3oa8-assembly1.cif.gz_E diheme soxax 0.9384 37 264
3oa8-assembly1.cif.gz_E diheme soxax 0.9344 37 264
3ocd-assembly2.cif.gz_C diheme soxax - c236m mutant 0.9118 42 264
1h31-assembly3.cif.gz_E oxidised soxax complex from rhodovulum sulfidophilum 0.8433 38 265
ID Description Score Start End Superfamily
3oa8A02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9637 42 140 1.10.760.10
3oa8A02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.945 42 140 1.10.760.10
3oa8E01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8698 140 264 1.10.760.10
3oa8E01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8451 140 264 1.10.760.10
2oz1C01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8029 148 264 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A258B4Y7-F1-model_v4 Sulfur oxidation c-type cytochrome SoxA 0.9727 206 265 GO:0009055
GO:0020037
AF-A0A1V3N8B8-F1-model_v4 Sulfur oxidation c-type cytochrome SoxA 0.9591 205 265 GO:0009055
GO:0020037
AF-A0A1F4CZ69-F1-model_v4 L-cysteine S-thiosulfotransferase subunit SoxA (EC 2.8.5.2) (Protein SoxA) (SoxAX cytochrome complex subunit A) (Sulfur oxidizing protein A) (Thiosulfate-oxidizing multienzyme system protein SoxA) 0.9515 51 265 GO:0009055
GO:0016669
GO:0016740
GO:0019417
GO:0020037
GO:0042597
GO:0046872
GO:0070069
AF-A0A1F4CZ69-F1-model_v4 L-cysteine S-thiosulfotransferase subunit SoxA (EC 2.8.5.2) (Protein SoxA) (SoxAX cytochrome complex subunit A) (Sulfur oxidizing protein A) (Thiosulfate-oxidizing multienzyme system protein SoxA) 0.9472 51 265 GO:0009055
GO:0016669
GO:0016740
GO:0019417
GO:0020037
GO:0042597
GO:0046872
GO:0070069
AF-A0A2D5FKV0-F1-model_v4 L-cysteine S-thiosulfotransferase subunit SoxA (EC 2.8.5.2) (Protein SoxA) (SoxAX cytochrome complex subunit A) (Sulfur oxidizing protein A) (Thiosulfate-oxidizing multienzyme system protein SoxA) 0.9453 37 265 GO:0009055
GO:0016669
GO:0016740
GO:0019417
GO:0020037
GO:0042597
GO:0046872
GO:0070069

Map