F442765

General Info

Members Datasets Scaffolds Average Seq Length
433 199 866 158

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10188164|Ga0070658_101881644
Length 194
Sequence MPRYPPGMLGSIISVIVTAFFTGALARFAVPGPDPMPAWLTILIGLIGTLIGAGIVLAVVGKDPAWVGIAGFAVSIALVIGYRRFVQKRALWGPEAYRFPERGVGVEEYRERLQRAGIDPEAIGSQMAMALQQXXXARGGAPAAAPVSREAGEIPTENPAHFLQLLEELHDSGVLSDDEYTASRTRLLESLRNP

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
60 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
93 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
94 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
95 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
96 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
97 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
109 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
110 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
195 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.07
Metatranscriptomes 3.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.24
Rhizosphere 92.61
Stem 0
Stem Tuber 0
Unclassified 10.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10188164 3300005327 Unclassified 1739
2 rootH1_10215208 3300003323 Bacteria 1575
3 rootH1_10253714 3300003323 Bacteria 1066
4 Ga0070658_10015301 3300005327 Bacteria 6140
5 Ga0070658_10021696 3300005327 Bacteria 5147
6 Ga0070658_10040926 3300005327 Bacteria 3739
7 Ga0070658_10897015 3300005327 Bacteria 771
8 Ga0070683_100024600 3300005329 Bacteria 5396
9 Ga0070683_100062132 3300005329 Bacteria 3473
10 Ga0070683_100071768 3300005329 Bacteria 3231
11 Ga0070683_100078184 3300005329 Bacteria 3094
12 Ga0070683_100208870 3300005329 Bacteria 1854
13 Ga0070683_101051729 3300005329 Bacteria 782
14 Ga0070680_100042145 3300005336 Bacteria 3703
15 Ga0070680_100119334 3300005336 Bacteria 2200
16 Ga0070680_100155737 3300005336 Bacteria 1919
17 Ga0070680_100189965 3300005336 Unclassified 1730
18 Ga0070680_100209323 3300005336 Bacteria 1645
19 Ga0070680_100495848 3300005336 Bacteria 1045
20 Ga0070680_100869189 3300005336 Archaea 778
21 Ga0070682_100079418 3300005337 Bacteria 2118
22 Ga0070660_100001460 3300005339 Bacteria 16166
23 Ga0070660_100024693 3300005339 Bacteria 4461
24 Ga0070660_100037339 3300005339 Bacteria 3683
25 Ga0070660_100093523 3300005339 Bacteria 2374
26 Ga0070660_100094169 3300005339 Bacteria 2366
27 Ga0070661_100108801 3300005344 Bacteria 2068
28 Ga0070661_100110530 3300005344 Bacteria 2052
29 Ga0070661_100111428 3300005344 Bacteria 2044
30 Ga0070661_100233732 3300005344 Unclassified 1413
31 Ga0070661_100315011 3300005344 Bacteria 1221
32 Ga0070671_100366816 3300005355 Bacteria 1230
33 Ga0070659_100011772 3300005366 Bacteria 6474
34 Ga0070659_100022030 3300005366 Bacteria 4862
35 Ga0070659_100154278 3300005366 Bacteria 1874
36 Ga0070709_10124013 3300005434 Bacteria 1755
37 Ga0070709_10605864 3300005434 Bacteria 844
38 Ga0070714_100045256 3300005435 Bacteria 3729
39 Ga0070714_100057509 3300005435 Bacteria 3329
40 Ga0070714_100458574 3300005435 Bacteria 1211
41 Ga0070713_100412692 3300005436 Unclassified 1263
42 Ga0070713_101101107 3300005436 Bacteria 768
43 Ga0070710_10314492 3300005437 Bacteria 1026
44 Ga0070711_100115353 3300005439 Bacteria 1978
45 Ga0070711_100900921 3300005439 Unclassified 755
46 Ga0070708_100767148 3300005445 Bacteria 907
47 Ga0070681_10005066 3300005458 Bacteria 12709
48 Ga0070681_10024248 3300005458 Bacteria 6106
49 Ga0070681_10119058 3300005458 Bacteria 2577
50 Ga0070681_10184730 3300005458 Bacteria 2005
51 Ga0070681_10411245 3300005458 Unclassified 1264
52 Ga0070681_10419192 3300005458 Bacteria 1251
53 Ga0070707_101050302 3300005468 Unclassified 780
54 Ga0070698_101730005 3300005471 Bacteria 578
55 Ga0070679_100037291 3300005530 Bacteria 4827
56 Ga0070679_100117832 3300005530 Bacteria 2640
57 Ga0070679_100131692 3300005530 Bacteria 2482
58 Ga0070679_100139427 3300005530 Unclassified 2405
59 Ga0070679_100152560 3300005530 Bacteria 2287
60 Ga0070679_100206987 3300005530 Bacteria 1926
61 Ga0070679_100238232 3300005530 Bacteria 1778
62 Ga0070679_100850417 3300005530 Bacteria 856
63 Ga0070684_100244783 3300005535 Bacteria 1639
64 Ga0070684_100473722 3300005535 Bacteria 1158
65 Ga0068853_100419148 3300005539 Bacteria 1255
66 Ga0068853_100434620 3300005539 Bacteria 1233
67 Ga0068853_100437789 3300005539 Unclassified 1228
68 Ga0068853_100570739 3300005539 Bacteria 1073
69 Ga0070696_100247422 3300005546 Bacteria 1347
70 Ga0070693_100566808 3300005547 Unclassified 815
71 Ga0070665_100589382 3300005548 Bacteria 1125
72 Ga0068855_100008035 3300005563 Bacteria 12748
73 Ga0068855_100009709 3300005563 Bacteria 11616
74 Ga0068855_100027256 3300005563 Bacteria 6836
75 Ga0068855_100376404 3300005563 Bacteria 1560
76 Ga0068855_101178454 3300005563 Unclassified 797
77 Ga0068857_101307018 3300005577 Bacteria 704
78 Ga0068854_100591916 3300005578 Bacteria 946
79 Ga0068856_100099873 3300005614 Bacteria 2893
80 Ga0068856_100588678 3300005614 Unclassified 1134
81 Ga0068856_100969960 3300005614 Bacteria 868
82 Ga0068852_100012209 3300005616 Bacteria 6510
83 Ga0068852_100112271 3300005616 Bacteria 2480
84 Ga0070717_10018455 3300006028 Bacteria 5447
85 Ga0070717_10238811 3300006028 Bacteria 1602
86 Ga0070717_10775831 3300006028 Bacteria 872
87 Ga0070715_10021610 3300006163 Bacteria 2498
88 Ga0070715_10214271 3300006163 Bacteria 986
89 Ga0070716_100331100 3300006173 Bacteria 1071
90 Ga0070716_100499470 3300006173 Bacteria 897
91 Ga0070712_100075312 3300006175 Bacteria 2427
92 Ga0075433_10321857 3300006852 Bacteria 1368
93 Ga0075434_100150444 3300006871 Bacteria 2348
94 Ga0068865_100256316 3300006881 Bacteria 1383
95 Ga0075436_100153889 3300006914 Bacteria 1619
96 Ga0075435_100011364 3300007076 Bacteria 6545
97 Ga0105240_10022924 3300009093 Bacteria 8271
98 Ga0105240_10070768 3300009093 Bacteria 4314
99 Ga0105240_10079396 3300009093 Bacteria 4037
100 Ga0105240_11910125 3300009093 Bacteria 618
101 Ga0105245_10116021 3300009098 Bacteria 2496
102 Ga0114129_11015631 3300009147 Bacteria 1043
103 Ga0105243_10059071 3300009148 Bacteria 3059
104 Ga0105241_10931764 3300009174 Bacteria 809
105 Ga0105241_11615315 3300009174 Bacteria 627
106 Ga0105237_10149299 3300009545 Bacteria 2333
107 Ga0105237_10304529 3300009545 Unclassified 1597
108 Ga0105238_10064143 3300009551 Bacteria 3674
109 Ga0105238_10321036 3300009551 Bacteria 1534
110 Ga0105238_10522282 3300009551 Bacteria 1190
111 Ga0105238_10823979 3300009551 Unclassified 944
112 Ga0105238_11328806 3300009551 Bacteria 745
113 Ga0105239_10208197 3300010375 Bacteria 2192
114 Ga0105239_11017233 3300010375 Bacteria 953
115 Ga0157373_10045755 3300013100 Bacteria 3123
116 Ga0157373_10125909 3300013100 Bacteria 1802
117 Ga0157370_10024491 3300013104 Bacteria 5978
118 Ga0157370_10142057 3300013104 Bacteria 2237
119 Ga0157370_10329244 3300013104 Bacteria 1408
120 Ga0157369_10019999 3300013105 Bacteria 7487
121 Ga0157369_10040684 3300013105 Bacteria 5074
122 Ga0157369_10070710 3300013105 Unclassified 3748
123 Ga0157369_10128992 3300013105 Bacteria 2680
124 Ga0157369_10169999 3300013105 Unclassified 2297
125 Ga0157369_10236955 3300013105 Bacteria 1907
126 Ga0157369_10436310 3300013105 Bacteria 1357
127 Ga0157374_10118407 3300013296 Bacteria 2554
128 Ga0157374_10424112 3300013296 Bacteria 1329
129 Ga0157374_10890232 3300013296 Bacteria 908
130 Ga0157378_10083567 3300013297 Bacteria 2890
131 Ga0157372_10136095 3300013307 Bacteria 2829
132 Ga0157372_10437368 3300013307 Unclassified 1525
133 Ga0157372_12622842 3300013307 Bacteria 578
134 Ga0157375_11141812 3300013308 Bacteria 913
135 Ga0182008_10419920 3300014497 Bacteria 722
136 Ga0197907_10407462 3300020069 Bacteria 796
137 Ga0197907_10476465 3300020069 Bacteria 3205
138 Ga0197907_11138377 3300020069 Unclassified 1536
139 Ga0206356_10127788 3300020070 Bacteria 1102
140 Ga0206356_10303517 3300020070 Bacteria 3479
141 Ga0206356_11404044 3300020070 Bacteria 2206
142 Ga0206356_11839125 3300020070 Bacteria 1187
143 Ga0206354_10157303 3300020081 Bacteria 1374
144 Ga0206354_10618759 3300020081 Bacteria 1966
145 Ga0206354_10996903 3300020081 Bacteria 4204
146 Ga0206354_11570409 3300020081 Archaea 728
147 Ga0206353_10116874 3300020082 Bacteria 5939
148 Ga0206353_10178039 3300020082 Bacteria 2409
149 Ga0206353_10208751 3300020082 Bacteria 3051
150 Ga0206353_10774071 3300020082 Unclassified 1029
151 Ga0206353_11857848 3300020082 Unclassified 1142
152 Ga0213871_10111273 3300021441 Unclassified 810
153 Ga0224712_10083157 3300022467 Bacteria 1326
154 Ga0207692_10271828 3300025898 Bacteria 1022
155 Ga0207685_10243897 3300025905 Bacteria 866
156 Ga0207705_10035408 3300025909 Bacteria 3571
157 Ga0207705_10047789 3300025909 Bacteria 3077
158 Ga0207705_10482476 3300025909 Unclassified 962
159 Ga0207705_11243052 3300025909 Archaea 570
160 Ga0207654_10306559 3300025911 Unclassified 1081
161 Ga0207654_10494306 3300025911 Bacteria 863
162 Ga0207707_10007247 3300025912 Bacteria 9649
163 Ga0207707_10060224 3300025912 Bacteria 3303
164 Ga0207707_10146825 3300025912 Bacteria 2062
165 Ga0207707_10234223 3300025912 Bacteria 1597
166 Ga0207707_10406987 3300025912 Unclassified 1167
167 Ga0207707_10667815 3300025912 Unclassified 875
168 Ga0207695_10062370 3300025913 Bacteria 3849
169 Ga0207695_10168012 3300025913 Bacteria 2121
170 Ga0207695_10169320 3300025913 Bacteria 2111
171 Ga0207695_11223376 3300025913 Bacteria 631
172 Ga0207695_11486791 3300025913 Unclassified 558
173 Ga0207671_10132234 3300025914 Bacteria 1916
174 Ga0207693_10055153 3300025915 Bacteria 3118
175 Ga0207693_10196562 3300025915 Bacteria 1586
176 Ga0207660_10023527 3300025917 Bacteria 4162
177 Ga0207660_10117367 3300025917 Bacteria 2011
178 Ga0207660_10185574 3300025917 Bacteria 1617
179 Ga0207660_10410795 3300025917 Unclassified 1091
180 Ga0207657_10001148 3300025919 Bacteria 28154
181 Ga0207657_10001460 3300025919 Bacteria 25308
182 Ga0207657_10006484 3300025919 Bacteria 12127
183 Ga0207657_10007323 3300025919 Bacteria 11321
184 Ga0207657_10009394 3300025919 Bacteria 9835
185 Ga0207657_10127370 3300025919 Bacteria 2090
186 Ga0207657_10563384 3300025919 Bacteria 890
187 Ga0207649_10007673 3300025920 Bacteria 5868
188 Ga0207649_10047275 3300025920 Bacteria 2648
189 Ga0207649_10130758 3300025920 Bacteria 1704
190 Ga0207652_10006911 3300025921 Bacteria 9141
191 Ga0207652_10045867 3300025921 Bacteria 3727
192 Ga0207652_10055223 3300025921 Bacteria 3415
193 Ga0207652_10067109 3300025921 Bacteria 3110
194 Ga0207652_10086031 3300025921 Bacteria 2756
195 Ga0207652_10153132 3300025921 Bacteria 2065
196 Ga0207652_10195653 3300025921 Bacteria 1819
197 Ga0207652_10235648 3300025921 Bacteria 1650
198 Ga0207652_10435264 3300025921 Bacteria 1182
199 Ga0207646_11296171 3300025922 Bacteria 636
200 Ga0207694_10114141 3300025924 Bacteria 2151
201 Ga0207694_10316165 3300025924 Bacteria 1288
202 Ga0207694_10386036 3300025924 Bacteria 1163
203 Ga0207694_10538361 3300025924 Unclassified 979
204 Ga0207687_10205189 3300025927 Bacteria 1543
205 Ga0207700_10116131 3300025928 Bacteria 2162
206 Ga0207664_10153404 3300025929 Unclassified 1959
207 Ga0207664_10234788 3300025929 Bacteria 1595
208 Ga0207664_10771730 3300025929 Unclassified 865
209 Ga0207664_11037052 3300025929 Bacteria 734
210 Ga0207644_10348313 3300025931 Bacteria 1202
211 Ga0207690_10055721 3300025932 Bacteria 2663
212 Ga0207690_10110936 3300025932 Bacteria 1976
213 Ga0207690_10238437 3300025932 Bacteria 1400
214 Ga0207686_10065023 3300025934 Bacteria 2324
215 Ga0207709_10067241 3300025935 Bacteria 2261
216 Ga0207704_10133696 3300025938 Bacteria 1723
217 Ga0207665_10150551 3300025939 Bacteria 1666
218 Ga0207665_10287122 3300025939 Bacteria 1226
219 Ga0207665_10460932 3300025939 Bacteria 977
220 Ga0207661_10069729 3300025944 Bacteria 2867
221 Ga0207661_10118770 3300025944 Bacteria 2248
222 Ga0207661_10145336 3300025944 Bacteria 2045
223 Ga0207661_10266087 3300025944 Bacteria 1529
224 Ga0207661_10695047 3300025944 Unclassified 935
225 Ga0207667_10040605 3300025949 Bacteria 4955
226 Ga0207667_10049382 3300025949 Bacteria 4444
227 Ga0207667_10261629 3300025949 Unclassified 1769
228 Ga0207667_10354668 3300025949 Bacteria 1496
229 Ga0207667_10383401 3300025949 Bacteria 1432
230 Ga0207667_10529574 3300025949 Bacteria 1193
231 Ga0207667_11426730 3300025949 Bacteria 665
232 Ga0207640_10331985 3300025981 Bacteria 1215
233 Ga0207639_10073112 3300026041 Bacteria 2687
234 Ga0207639_10349285 3300026041 Bacteria 1321
235 Ga0207639_10447011 3300026041 Unclassified 1173
236 Ga0207639_10529848 3300026041 Bacteria 1079
237 Ga0207639_11347516 3300026041 Bacteria 670
238 Ga0207678_10084075 3300026067 Bacteria 2722
239 Ga0207702_10466202 3300026078 Bacteria 1228
240 Ga0207674_10035233 3300026116 Bacteria 5225
241 Ga0207674_11232318 3300026116 Bacteria 718
242 Ga0207674_11927897 3300026116 Bacteria 557
243 Ga0207698_10060957 3300026142 Bacteria 2937
244 Ga0207698_10087770 3300026142 Bacteria 2534
245 Ga0207698_10617216 3300026142 Bacteria 1071
246 Ga0207698_12201204 3300026142 Bacteria 564
247 Ga0265326_10135103 3300028558 Bacteria 703
248 Ga0265319_1020825 3300028563 Bacteria 2419
249 Ga0265334_10236626 3300028573 Unclassified 630
250 Ga0265318_10007233 3300028577 Bacteria 5039
251 Ga0265322_10003946 3300028654 Bacteria 4446
252 Ga0265322_10010167 3300028654 Bacteria 2728
253 Ga0265336_10098000 3300028666 Bacteria 874
254 Ga0265336_10155211 3300028666 Bacteria 681
255 Ga0265338_10003498 3300028800 Bacteria 22042
256 Ga0265338_10016437 3300028800 Bacteria 8054
257 Ga0265338_10026425 3300028800 Bacteria 5855
258 Ga0265338_10045158 3300028800 Bacteria 4055
259 Ga0265338_10253165 3300028800 Bacteria 1298
260 Ga0265330_10020776 3300031235 Bacteria 3000
261 Ga0265330_10064905 3300031235 Bacteria 1585
262 Ga0265325_10015319 3300031241 Bacteria 4313
263 Ga0265325_10039657 3300031241 Bacteria 2478
264 Ga0265329_10214975 3300031242 Bacteria 635
265 Ga0265339_10009571 3300031249 Bacteria 6074
266 Ga0265339_10110585 3300031249 Bacteria 1422
267 Ga0265331_10042860 3300031250 Bacteria 2194
268 Ga0265331_10151937 3300031250 Bacteria 1051
269 Ga0265327_10024813 3300031251 Bacteria 3510
270 Ga0265327_10039260 3300031251 Bacteria 2573
271 Ga0265327_10107500 3300031251 Bacteria 1337
272 Ga0265316_10011663 3300031344 Bacteria 7914
273 Ga0265316_10090809 3300031344 Bacteria 2330
274 Ga0265316_10579375 3300031344 Unclassified 797
275 Ga0265313_10003489 3300031595 Bacteria 12688
276 Ga0265314_10002807 3300031711 Bacteria 17390
277 Ga0265314_10003773 3300031711 Bacteria 14480
278 Ga0265314_10020235 3300031711 Bacteria 5139
279 Ga0373954_0522776 3300035118 Bacteria 588
280 Ga0373956_0280527 3300035119 Bacteria 793
281 Ga0373957_0100516 3300035120 Bacteria 1157
282 Ga0373955_0041767 3300035172 Bacteria 2460
283 Ga0373955_0158764 3300035172 Bacteria 1333
284 Ga0373924_0105190 3300035410 Bacteria 1217
285 Ga0373924_0213507 3300035410 Bacteria 852
286 Ga0373931_0214222 3300035691 Bacteria 1157
287 Ga0373933_0053333 3300035724 Bacteria 2422
288 Ga0373933_0191916 3300035724 Bacteria 1305
289 Ga0373937_0060672 3300036401 Bacteria 3475
290 Ga0395899_0024440 3300037312 Bacteria 4567
291 Ga0395900_0556118 3300037418 Bacteria 1091
292 Ga0395900_0612617 3300037418 Bacteria 1028
293 Ga0395898_0401179 3300037466 Bacteria 1307
294 Ga0395898_0505053 3300037466 Bacteria 1150
295 Ga0395898_1407542 3300037466 Bacteria 625
296 Ga0395905_0047556 3300037471 Bacteria 4019
297 Ga0436364_1479632 3300037853 Bacteria 3803
298 Ga0395901_0300968 3300038443 Bacteria 1663
299 Ga0436365_1366736 3300039437 Bacteria 5865
300 Ga0436360_1185694 3300039438 Bacteria 1251
301 Ga0436363_1005099 3300039450 Bacteria 937
302 Ga0439448_0090425 3300042005 Bacteria 1034
303 Ga0466966_0029227 3300044684 Bacteria 3588
304 Ga0466966_0189614 3300044684 Bacteria 1246
305 Ga0466961_0011643 3300044693 Bacteria 5623
306 Ga0466963_0010128 3300044694 Bacteria 5700
307 Ga0466963_0040399 3300044694 Bacteria 3058
308 Ga0466963_0167907 3300044694 Bacteria 1529
309 Ga0466963_0468251 3300044694 Bacteria 889
310 Ga0466964_0076460 3300044706 Unclassified 1427
311 Ga0466968_0181558 3300044735 Archaea 979
312 Ga0466970_0039114 3300044765 Bacteria 2517
313 Ga0466957_0073244 3300044842 Bacteria 2122
314 Ga0466957_0437002 3300044842 Archaea 900
315 Ga0466959_0049876 3300045049 Bacteria 3074
316 Ga0466959_0221905 3300045049 Bacteria 1310
317 Ga0466959_0234259 3300045049 Unclassified 1270
318 Ga0466958_0067010 3300045836 Bacteria 2192
319 Ga0466958_0125214 3300045836 Bacteria 1611
320 Ga0466967_0037245 3300045976 Bacteria 4161
321 Ga0466967_0038820 3300045976 Bacteria 4087
322 Ga0466967_0106610 3300045976 Bacteria 2569
323 Ga0466967_0306344 3300045976 Bacteria 1529
324 Ga0466967_0419868 3300045976 Bacteria 1303
325 Ga0466967_0429149 3300045976 Bacteria 1289
326 Ga0466967_0894496 3300045976 Unclassified 883
327 Ga0495603_0042970 3300046455 Bacteria 2700
328 Ga0495629_0452759 3300046459 Bacteria 869
329 Ga0495651_0010120 3300046462 Bacteria 7243
330 Ga0495651_0034048 3300046462 Bacteria 3972
331 Ga0495653_0014814 3300046463 Bacteria 6359
332 Ga0495653_0256414 3300046463 Bacteria 1158
333 Ga0495582_0281470 3300046473 Bacteria 955
334 Ga0495594_0118758 3300046499 Bacteria 1494
335 Ga0495594_0335524 3300046499 Bacteria 861
336 Ga0495608_0006860 3300046511 Bacteria 8069
337 Ga0495618_0160217 3300046514 Bacteria 1435
338 Ga0495628_0324965 3300046516 Bacteria 1135
339 Ga0495628_0738494 3300046516 Bacteria 693
340 Ga0495628_0827850 3300046516 Bacteria 646
341 Ga0495652_0096776 3300046529 Bacteria 2403
342 Ga0495652_0130468 3300046529 Bacteria 1990
343 Ga0495652_0255416 3300046529 Bacteria 1297
344 Ga0495652_0604809 3300046529 Bacteria 747
345 Ga0495587_0006343 3300046536 Bacteria 7710
346 Ga0495667_0004616 3300046559 Bacteria 9313
347 Ga0495635_0084827 3300046663 Bacteria 2167
348 Ga0495635_0235061 3300046663 Bacteria 1237
349 Ga0495657_0109521 3300046675 Bacteria 1751
350 Ga0495657_0127228 3300046675 Bacteria 1599
351 Ga0495657_0775282 3300046675 Archaea 549
352 Ga0495599_0011081 3300046678 Bacteria 5532
353 Ga0495599_0230567 3300046678 Bacteria 1131
354 Ga0495623_0006923 3300046679 Bacteria 7368
355 Ga0495623_0392374 3300046679 Bacteria 748
356 Ga0495646_0076708 3300046680 Bacteria 1957
357 Ga0495613_0240770 3300046689 Bacteria 1265
358 Ga0495600_0008688 3300046809 Bacteria 6250
359 Ga0495604_0011071 3300047317 Bacteria 7159
360 Ga0495680_0043364 3300047322 Bacteria 3562
361 Ga0495680_0233917 3300047322 Bacteria 1307
362 Ga0495675_0005423 3300047444 Bacteria 7776
363 Ga0495675_0101580 3300047444 Bacteria 1799
364 Ga0495684_0013735 3300047471 Bacteria 6234
365 Ga0495684_0897356 3300047471 Bacteria 571
366 Ga0495602_0279970 3300048088 Bacteria 1229
367 Ga0495602_0571127 3300048088 Bacteria 781
368 Ga0495602_0862479 3300048088 Bacteria 604
369 Ga0496100_0004702 3300048903 Bacteria 7277
370 Ga0496101_0001173 3300048904 Bacteria 15695
371 Ga0496101_0066511 3300048904 Bacteria 2629
372 Ga0496102_0012168 3300048905 Bacteria 7439
373 Ga0496102_0873721 3300048905 Unclassified 821
374 Ga0496103_0412023 3300048906 Bacteria 868
375 Ga0496104_0029106 3300048907 Bacteria 5122
376 Ga0496105_0004217 3300048908 Bacteria 10801
377 Ga0496106_0032792 3300048909 Bacteria 3873
378 Ga0496106_0613990 3300048909 Bacteria 870
379 Ga0496107_0005064 3300048910 Bacteria 8981
380 Ga0496107_0008786 3300048910 Bacteria 7000
381 Ga0496107_0082360 3300048910 Bacteria 2346
382 Ga0496108_0020827 3300048911 Bacteria 5392
383 Ga0496109_0002119 3300048912 Bacteria 16507
384 Ga0496109_0515002 3300048912 Bacteria 1129
385 Ga0496110_0024522 3300048913 Bacteria 5141
386 Ga0496111_0040335 3300048914 Bacteria 3349
387 Ga0496111_1020085 3300048914 Bacteria 592
388 Ga0496112_0053330 3300048915 Bacteria 3971
389 Ga0496112_0119547 3300048915 Bacteria 2605
390 Ga0496112_0135129 3300048915 Bacteria 2437
391 Ga0496112_0222081 3300048915 Bacteria 1845
392 Ga0496114_0080289 3300048917 Bacteria 2754
393 Ga0496115_0002222 3300048918 Bacteria 13918
394 Ga0496115_0013771 3300048918 Bacteria 6123
395 Ga0496115_1062396 3300048918 Bacteria 616
396 Ga0501034_0044011 3300049571 Bacteria 4516
397 Ga0501047_0088150 3300049581 Bacteria 2980
398 Ga0501047_0196056 3300049581 Bacteria 1882
399 Ga0501067_0000957 3300049583 Bacteria 15468
400 Ga0501067_0056928 3300049583 Unclassified 2165
401 Ga0501069_0047306 3300049585 Bacteria 2387
402 Ga0501069_0110701 3300049585 Bacteria 1564
403 Ga0501069_0270495 3300049585 Unclassified 993
404 Ga0501070_0009651 3300049586 Bacteria 8159
405 Ga0501070_0013386 3300049586 Bacteria 6917
406 Ga0501070_0123498 3300049586 Bacteria 2139
407 Ga0501072_0005959 3300049588 Bacteria 9289
408 Ga0501073_0055654 3300049589 Bacteria 2767
409 Ga0501074_0017470 3300049590 Bacteria 5207
410 Ga0501074_0074904 3300049590 Bacteria 2430
411 Ga0501074_0171072 3300049590 Bacteria 1550
412 Ga0501079_0033119 3300049741 Bacteria 3974
413 Ga0501080_0056398 3300049742 Bacteria 3658
414 Ga0501080_0961247 3300049742 Bacteria 742
415 Ga0501080_1065625 3300049742 Unclassified 699
416 Ga0501083_0018041 3300049744 Bacteria 4919
417 Ga0501035_0665521 3300049822 Bacteria 843
418 Ga0501044_0736199 3300049823 Unclassified 869
419 nmdc:mga05p37_1014312_c1 3300050507 Bacteria 880
420 nmdc:mga0n895_3002_c1 3300050512 Bacteria 13402
421 nmdc:mga0rr50_23906_c1 3300050513 Bacteria 4225
422 nmdc:mga08x19_196229_c1 3300050514 Bacteria 1382
423 nmdc:mga08x19_765799_c1 3300050514 Unclassified 685
424 nmdc:mga0a205_317659_c1 3300050515 Bacteria 1429
425 Ga0495601_0020948 3300053077 Bacteria 3998
426 Ga0495612_0389170 3300053078 Archaea 633
427 Ga0495595_0030983 3300053084 Bacteria 2402
428 Ga0495595_0712311 3300053084 Bacteria 514
429 Ga0495619_0024543 3300053085 Bacteria 3867
430 Ga0495619_0138597 3300053085 Bacteria 1674
431 Ga0501084_0119118 3300054114 Bacteria 2219
432 Ga0466962_0195912 3300061719 Bacteria 986
433 Ga0530510_0166083 3300061734 Bacteria 1634
434 Ga0070658_10188164
435 rootH1_10215208
436 rootH1_10253714
437 Ga0070658_10015301
438 Ga0070658_10021696
439 Ga0070658_10040926
440 Ga0070658_10897015
441 Ga0070683_100024600
442 Ga0070683_100062132
443 Ga0070683_100071768
444 Ga0070683_100078184
445 Ga0070683_100208870
446 Ga0070683_101051729
447 Ga0070680_100042145
448 Ga0070680_100119334
449 Ga0070680_100155737
450 Ga0070680_100189965
451 Ga0070680_100209323
452 Ga0070680_100495848
453 Ga0070680_100869189
454 Ga0070682_100079418
455 Ga0070660_100001460
456 Ga0070660_100024693
457 Ga0070660_100037339
458 Ga0070660_100093523
459 Ga0070660_100094169
460 Ga0070661_100108801
461 Ga0070661_100110530
462 Ga0070661_100111428
463 Ga0070661_100233732
464 Ga0070661_100315011
465 Ga0070671_100366816
466 Ga0070659_100011772
467 Ga0070659_100022030
468 Ga0070659_100154278
469 Ga0070709_10124013
470 Ga0070709_10605864
471 Ga0070714_100045256
472 Ga0070714_100057509
473 Ga0070714_100458574
474 Ga0070713_100412692
475 Ga0070713_101101107
476 Ga0070710_10314492
477 Ga0070711_100115353
478 Ga0070711_100900921
479 Ga0070708_100767148
480 Ga0070681_10005066
481 Ga0070681_10024248
482 Ga0070681_10119058
483 Ga0070681_10184730
484 Ga0070681_10411245
485 Ga0070681_10419192
486 Ga0070707_101050302
487 Ga0070698_101730005
488 Ga0070679_100037291
489 Ga0070679_100117832
490 Ga0070679_100131692
491 Ga0070679_100139427
492 Ga0070679_100152560
493 Ga0070679_100206987
494 Ga0070679_100238232
495 Ga0070679_100850417
496 Ga0070684_100244783
497 Ga0070684_100473722
498 Ga0068853_100419148
499 Ga0068853_100434620
500 Ga0068853_100437789
501 Ga0068853_100570739
502 Ga0070696_100247422
503 Ga0070693_100566808
504 Ga0070665_100589382
505 Ga0068855_100008035
506 Ga0068855_100009709
507 Ga0068855_100027256
508 Ga0068855_100376404
509 Ga0068855_101178454
510 Ga0068857_101307018
511 Ga0068854_100591916
512 Ga0068856_100099873
513 Ga0068856_100588678
514 Ga0068856_100969960
515 Ga0068852_100012209
516 Ga0068852_100112271
517 Ga0070717_10018455
518 Ga0070717_10238811
519 Ga0070717_10775831
520 Ga0070715_10021610
521 Ga0070715_10214271
522 Ga0070716_100331100
523 Ga0070716_100499470
524 Ga0070712_100075312
525 Ga0075433_10321857
526 Ga0075434_100150444
527 Ga0068865_100256316
528 Ga0075436_100153889
529 Ga0075435_100011364
530 Ga0105240_10022924
531 Ga0105240_10070768
532 Ga0105240_10079396
533 Ga0105240_11910125
534 Ga0105245_10116021
535 Ga0114129_11015631
536 Ga0105243_10059071
537 Ga0105241_10931764
538 Ga0105241_11615315
539 Ga0105237_10149299
540 Ga0105237_10304529
541 Ga0105238_10064143
542 Ga0105238_10321036
543 Ga0105238_10522282
544 Ga0105238_10823979
545 Ga0105238_11328806
546 Ga0105239_10208197
547 Ga0105239_11017233
548 Ga0157373_10045755
549 Ga0157373_10125909
550 Ga0157370_10024491
551 Ga0157370_10142057
552 Ga0157370_10329244
553 Ga0157369_10019999
554 Ga0157369_10040684
555 Ga0157369_10070710
556 Ga0157369_10128992
557 Ga0157369_10169999
558 Ga0157369_10236955
559 Ga0157369_10436310
560 Ga0157374_10118407
561 Ga0157374_10424112
562 Ga0157374_10890232
563 Ga0157378_10083567
564 Ga0157372_10136095
565 Ga0157372_10437368
566 Ga0157372_12622842
567 Ga0157375_11141812
568 Ga0182008_10419920
569 Ga0197907_10407462
570 Ga0197907_10476465
571 Ga0197907_11138377
572 Ga0206356_10127788
573 Ga0206356_10303517
574 Ga0206356_11404044
575 Ga0206356_11839125
576 Ga0206354_10157303
577 Ga0206354_10618759
578 Ga0206354_10996903
579 Ga0206354_11570409
580 Ga0206353_10116874
581 Ga0206353_10178039
582 Ga0206353_10208751
583 Ga0206353_10774071
584 Ga0206353_11857848
585 Ga0213871_10111273
586 Ga0224712_10083157
587 Ga0207692_10271828
588 Ga0207685_10243897
589 Ga0207705_10035408
590 Ga0207705_10047789
591 Ga0207705_10482476
592 Ga0207705_11243052
593 Ga0207654_10306559
594 Ga0207654_10494306
595 Ga0207707_10007247
596 Ga0207707_10060224
597 Ga0207707_10146825
598 Ga0207707_10234223
599 Ga0207707_10406987
600 Ga0207707_10667815
601 Ga0207695_10062370
602 Ga0207695_10168012
603 Ga0207695_10169320
604 Ga0207695_11223376
605 Ga0207695_11486791
606 Ga0207671_10132234
607 Ga0207693_10055153
608 Ga0207693_10196562
609 Ga0207660_10023527
610 Ga0207660_10117367
611 Ga0207660_10185574
612 Ga0207660_10410795
613 Ga0207657_10001148
614 Ga0207657_10001460
615 Ga0207657_10006484
616 Ga0207657_10007323
617 Ga0207657_10009394
618 Ga0207657_10127370
619 Ga0207657_10563384
620 Ga0207649_10007673
621 Ga0207649_10047275
622 Ga0207649_10130758
623 Ga0207652_10006911
624 Ga0207652_10045867
625 Ga0207652_10055223
626 Ga0207652_10067109
627 Ga0207652_10086031
628 Ga0207652_10153132
629 Ga0207652_10195653
630 Ga0207652_10235648
631 Ga0207652_10435264
632 Ga0207646_11296171
633 Ga0207694_10114141
634 Ga0207694_10316165
635 Ga0207694_10386036
636 Ga0207694_10538361
637 Ga0207687_10205189
638 Ga0207700_10116131
639 Ga0207664_10153404
640 Ga0207664_10234788
641 Ga0207664_10771730
642 Ga0207664_11037052
643 Ga0207644_10348313
644 Ga0207690_10055721
645 Ga0207690_10110936
646 Ga0207690_10238437
647 Ga0207686_10065023
648 Ga0207709_10067241
649 Ga0207704_10133696
650 Ga0207665_10150551
651 Ga0207665_10287122
652 Ga0207665_10460932
653 Ga0207661_10069729
654 Ga0207661_10118770
655 Ga0207661_10145336
656 Ga0207661_10266087
657 Ga0207661_10695047
658 Ga0207667_10040605
659 Ga0207667_10049382
660 Ga0207667_10261629
661 Ga0207667_10354668
662 Ga0207667_10383401
663 Ga0207667_10529574
664 Ga0207667_11426730
665 Ga0207640_10331985
666 Ga0207639_10073112
667 Ga0207639_10349285
668 Ga0207639_10447011
669 Ga0207639_10529848
670 Ga0207639_11347516
671 Ga0207678_10084075
672 Ga0207702_10466202
673 Ga0207674_10035233
674 Ga0207674_11232318
675 Ga0207674_11927897
676 Ga0207698_10060957
677 Ga0207698_10087770
678 Ga0207698_10617216
679 Ga0207698_12201204
680 Ga0265326_10135103
681 Ga0265319_1020825
682 Ga0265334_10236626
683 Ga0265318_10007233
684 Ga0265322_10003946
685 Ga0265322_10010167
686 Ga0265336_10098000
687 Ga0265336_10155211
688 Ga0265338_10003498
689 Ga0265338_10016437
690 Ga0265338_10026425
691 Ga0265338_10045158
692 Ga0265338_10253165
693 Ga0265330_10020776
694 Ga0265330_10064905
695 Ga0265325_10015319
696 Ga0265325_10039657
697 Ga0265329_10214975
698 Ga0265339_10009571
699 Ga0265339_10110585
700 Ga0265331_10042860
701 Ga0265331_10151937
702 Ga0265327_10024813
703 Ga0265327_10039260
704 Ga0265327_10107500
705 Ga0265316_10011663
706 Ga0265316_10090809
707 Ga0265316_10579375
708 Ga0265313_10003489
709 Ga0265314_10002807
710 Ga0265314_10003773
711 Ga0265314_10020235
712 Ga0373954_0522776
713 Ga0373956_0280527
714 Ga0373957_0100516
715 Ga0373955_0041767
716 Ga0373955_0158764
717 Ga0373924_0105190
718 Ga0373924_0213507
719 Ga0373931_0214222
720 Ga0373933_0053333
721 Ga0373933_0191916
722 Ga0373937_0060672
723 Ga0395899_0024440
724 Ga0395900_0556118
725 Ga0395900_0612617
726 Ga0395898_0401179
727 Ga0395898_0505053
728 Ga0395898_1407542
729 Ga0395905_0047556
730 Ga0436364_1479632
731 Ga0395901_0300968
732 Ga0436365_1366736
733 Ga0436360_1185694
734 Ga0436363_1005099
735 Ga0439448_0090425
736 Ga0466966_0029227
737 Ga0466966_0189614
738 Ga0466961_0011643
739 Ga0466963_0010128
740 Ga0466963_0040399
741 Ga0466963_0167907
742 Ga0466963_0468251
743 Ga0466964_0076460
744 Ga0466968_0181558
745 Ga0466970_0039114
746 Ga0466957_0073244
747 Ga0466957_0437002
748 Ga0466959_0049876
749 Ga0466959_0221905
750 Ga0466959_0234259
751 Ga0466958_0067010
752 Ga0466958_0125214
753 Ga0466967_0037245
754 Ga0466967_0038820
755 Ga0466967_0106610
756 Ga0466967_0306344
757 Ga0466967_0419868
758 Ga0466967_0429149
759 Ga0466967_0894496
760 Ga0495603_0042970
761 Ga0495629_0452759
762 Ga0495651_0010120
763 Ga0495651_0034048
764 Ga0495653_0014814
765 Ga0495653_0256414
766 Ga0495582_0281470
767 Ga0495594_0118758
768 Ga0495594_0335524
769 Ga0495608_0006860
770 Ga0495618_0160217
771 Ga0495628_0324965
772 Ga0495628_0738494
773 Ga0495628_0827850
774 Ga0495652_0096776
775 Ga0495652_0130468
776 Ga0495652_0255416
777 Ga0495652_0604809
778 Ga0495587_0006343
779 Ga0495667_0004616
780 Ga0495635_0084827
781 Ga0495635_0235061
782 Ga0495657_0109521
783 Ga0495657_0127228
784 Ga0495657_0775282
785 Ga0495599_0011081
786 Ga0495599_0230567
787 Ga0495623_0006923
788 Ga0495623_0392374
789 Ga0495646_0076708
790 Ga0495613_0240770
791 Ga0495600_0008688
792 Ga0495604_0011071
793 Ga0495680_0043364
794 Ga0495680_0233917
795 Ga0495675_0005423
796 Ga0495675_0101580
797 Ga0495684_0013735
798 Ga0495684_0897356
799 Ga0495602_0279970
800 Ga0495602_0571127
801 Ga0495602_0862479
802 Ga0496100_0004702
803 Ga0496101_0001173
804 Ga0496101_0066511
805 Ga0496102_0012168
806 Ga0496102_0873721
807 Ga0496103_0412023
808 Ga0496104_0029106
809 Ga0496105_0004217
810 Ga0496106_0032792
811 Ga0496106_0613990
812 Ga0496107_0005064
813 Ga0496107_0008786
814 Ga0496107_0082360
815 Ga0496108_0020827
816 Ga0496109_0002119
817 Ga0496109_0515002
818 Ga0496110_0024522
819 Ga0496111_0040335
820 Ga0496111_1020085
821 Ga0496112_0053330
822 Ga0496112_0119547
823 Ga0496112_0135129
824 Ga0496112_0222081
825 Ga0496114_0080289
826 Ga0496115_0002222
827 Ga0496115_0013771
828 Ga0496115_1062396
829 Ga0501034_0044011
830 Ga0501047_0088150
831 Ga0501047_0196056
832 Ga0501067_0000957
833 Ga0501067_0056928
834 Ga0501069_0047306
835 Ga0501069_0110701
836 Ga0501069_0270495
837 Ga0501070_0009651
838 Ga0501070_0013386
839 Ga0501070_0123498
840 Ga0501072_0005959
841 Ga0501073_0055654
842 Ga0501074_0017470
843 Ga0501074_0074904
844 Ga0501074_0171072
845 Ga0501079_0033119
846 Ga0501080_0056398
847 Ga0501080_0961247
848 Ga0501080_1065625
849 Ga0501083_0018041
850 Ga0501035_0665521
851 Ga0501044_0736199
852 nmdc:mga05p37_1014312_c1
853 nmdc:mga0n895_3002_c1
854 nmdc:mga0rr50_23906_c1
855 nmdc:mga08x19_196229_c1
856 nmdc:mga08x19_765799_c1
857 nmdc:mga0a205_317659_c1
858 Ga0495601_0020948
859 Ga0495612_0389170
860 Ga0495595_0030983
861 Ga0495595_0712311
862 Ga0495619_0024543
863 Ga0495619_0138597
864 Ga0501084_0119118
865 Ga0466962_0195912
866 Ga0530510_0166083

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map