F442718

General Info

Members Datasets Scaffolds Average Seq Length
432 210 864 166

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_5842_c1|nmdc:mga06r32_5842_c1_6574_7068
Length 164
Sequence MFELKPLSREAIPAALEKAERYRLLNEPAEAESICLDVLRTEPDNQKALVLLLLALTDRFGKGYAVGVTQAQDLLPRLRADYERLYYAGVISERRGKAALQQGTPGFVAAEWLREAMELYEKAAALRPPGNDDALLRWNTCVRLITRNHLPESPEDERPEMGLE

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
149 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
161 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
162 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
163 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
164 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
165 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
166 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.32
Rhizosphere 93.75
Stem 0
Stem Tuber 0
Unclassified 18.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_5842_c1 3300050510 Bacteria 11076
2 MBSR1b_contig_1477776 2162886012 Bacteria 864
3 CNXas_1001199 3300000545 Bacteria 1714
4 JGI24035J26624_1006990 3300002126 Unclassified 1093
5 Ga0065704_10005494 3300005289 Bacteria 5333
6 Ga0065712_10091874 3300005290 Bacteria 2354
7 Ga0065707_10100975 3300005295 Bacteria 2892
8 Ga0070676_10001944 3300005328 Bacteria 10510
9 Ga0070676_10464097 3300005328 Unclassified 893
10 Ga0070690_100138276 3300005330 Bacteria 1651
11 Ga0070690_100394017 3300005330 Unclassified 1015
12 Ga0070690_101131236 3300005330 Bacteria 622
13 Ga0070670_100011894 3300005331 Bacteria 7442
14 Ga0070670_100221893 3300005331 Bacteria 1644
15 Ga0070677_10126532 3300005333 Bacteria 1161
16 Ga0068869_100088127 3300005334 Bacteria 2329
17 Ga0070666_10000943 3300005335 Bacteria 17694
18 Ga0070666_10022204 3300005335 Bacteria 4119
19 Ga0070666_11078760 3300005335 Bacteria 597
20 Ga0068868_100024220 3300005338 Bacteria 4603
21 Ga0068868_100179056 3300005338 Bacteria 1758
22 Ga0070660_100245121 3300005339 Unclassified 1460
23 Ga0070689_100010393 3300005340 Bacteria 6634
24 Ga0070689_100023918 3300005340 Bacteria 4580
25 Ga0070689_100284178 3300005340 Bacteria 1373
26 Ga0070689_100330516 3300005340 Bacteria 1275
27 Ga0070687_100050903 3300005343 Bacteria 2142
28 Ga0070687_100134398 3300005343 Bacteria 1432
29 Ga0070668_100026701 3300005347 Bacteria 4382
30 Ga0070669_100007483 3300005353 Bacteria 7822
31 Ga0070669_100016713 3300005353 Bacteria 5237
32 Ga0070669_100091778 3300005353 Bacteria 2278
33 Ga0070669_100662846 3300005353 Bacteria 879
34 Ga0070675_100007768 3300005354 Bacteria 8304
35 Ga0070675_100020653 3300005354 Bacteria 5256
36 Ga0070675_100095472 3300005354 Bacteria 2496
37 Ga0070671_100001854 3300005355 Bacteria 16120
38 Ga0070671_100047457 3300005355 Bacteria 3571
39 Ga0070671_100093085 3300005355 Bacteria 2526
40 Ga0070671_101058970 3300005355 Unclassified 712
41 Ga0070674_100004866 3300005356 Bacteria 7698
42 Ga0070674_100009771 3300005356 Bacteria 5766
43 Ga0070673_100045057 3300005364 Bacteria 3418
44 Ga0070673_100118287 3300005364 Unclassified 2206
45 Ga0070673_100177962 3300005364 Bacteria 1819
46 Ga0070688_100011706 3300005365 Bacteria 4887
47 Ga0070688_100073608 3300005365 Bacteria 2191
48 Ga0070688_100183522 3300005365 Bacteria 1453
49 Ga0070688_100351893 3300005365 Bacteria 1079
50 Ga0070667_100000546 3300005367 Bacteria 37542
51 Ga0070667_100040185 3300005367 Bacteria 3922
52 Ga0070667_100084103 3300005367 Bacteria 2727
53 Ga0070703_10285498 3300005406 Unclassified 682
54 Ga0070709_10000056 3300005434 Bacteria 88178
55 Ga0070709_11337883 3300005434 Unclassified 578
56 Ga0070714_100069116 3300005435 Bacteria 3049
57 Ga0070714_100180996 3300005435 Bacteria 1918
58 Ga0070713_101148724 3300005436 Bacteria 751
59 Ga0070710_10145000 3300005437 Bacteria 1459
60 Ga0070701_10220378 3300005438 Bacteria 1131
61 Ga0070711_100052076 3300005439 Bacteria 2816
62 Ga0070711_100966559 3300005439 Unclassified 729
63 Ga0070705_100019411 3300005440 Bacteria 3577
64 Ga0070705_100071924 3300005440 Bacteria 2093
65 Ga0070705_100468944 3300005440 Bacteria 949
66 Ga0070700_100676041 3300005441 Bacteria 818
67 Ga0070708_100009205 3300005445 Bacteria 7965
68 Ga0070708_100030543 3300005445 Bacteria 4658
69 Ga0070708_100062645 3300005445 Bacteria 3327
70 Ga0070708_100161682 3300005445 Bacteria 2087
71 Ga0070708_100268787 3300005445 Bacteria 1603
72 Ga0070708_100486013 3300005445 Bacteria 1165
73 Ga0070708_100502256 3300005445 Unclassified 1144
74 Ga0070708_100698806 3300005445 Unclassified 955
75 Ga0070678_100472374 3300005456 Bacteria 1102
76 Ga0070662_100003770 3300005457 Bacteria 9482
77 Ga0070662_100069518 3300005457 Bacteria 2592
78 Ga0070662_100784681 3300005457 Bacteria 809
79 Ga0068867_100298500 3300005459 Bacteria 1327
80 Ga0068867_100432845 3300005459 Unclassified 1117
81 Ga0070685_10002842 3300005466 Bacteria 8844
82 Ga0070685_10375914 3300005466 Bacteria 978
83 Ga0070685_10515950 3300005466 Bacteria 848
84 Ga0070706_100001850 3300005467 Bacteria 21899
85 Ga0070706_100059516 3300005467 Bacteria 3526
86 Ga0070706_100068351 3300005467 Bacteria 3285
87 Ga0070706_100082818 3300005467 Bacteria 2972
88 Ga0070706_100087672 3300005467 Bacteria 2885
89 Ga0070706_100088481 3300005467 Unclassified 2871
90 Ga0070706_100144767 3300005467 Unclassified 2219
91 Ga0070706_100191385 3300005467 Bacteria 1911
92 Ga0070706_100238649 3300005467 Unclassified 1697
93 Ga0070706_100259296 3300005467 Bacteria 1623
94 Ga0070706_100365734 3300005467 Bacteria 1344
95 Ga0070706_100428819 3300005467 Bacteria 1230
96 Ga0070706_100471361 3300005467 Bacteria 1168
97 Ga0070706_100726279 3300005467 Unclassified 921
98 Ga0070707_100052698 3300005468 Unclassified 3901
99 Ga0070707_100068818 3300005468 Bacteria 3408
100 Ga0070707_100070774 3300005468 Bacteria 3360
101 Ga0070707_100112084 3300005468 Bacteria 2646
102 Ga0070707_100168344 3300005468 Bacteria 2135
103 Ga0070707_100333643 3300005468 Bacteria 1473
104 Ga0070707_100473478 3300005468 Unclassified 1214
105 Ga0070707_100667783 3300005468 Unclassified 1002
106 Ga0070707_100716476 3300005468 Bacteria 963
107 Ga0070707_100884586 3300005468 Unclassified 857
108 Ga0070707_100988170 3300005468 Bacteria 807
109 Ga0070698_100006278 3300005471 Bacteria 12916
110 Ga0070698_100021408 3300005471 Bacteria 6772
111 Ga0070699_100073617 3300005518 Unclassified 2972
112 Ga0070699_100108936 3300005518 Bacteria 2431
113 Ga0070699_100110697 3300005518 Bacteria 2411
114 Ga0070699_100379734 3300005518 Bacteria 1276
115 Ga0070684_100290130 3300005535 Unclassified 1500
116 Ga0070697_100017676 3300005536 Bacteria 5617
117 Ga0070697_100032427 3300005536 Bacteria 4204
118 Ga0070697_100039294 3300005536 Bacteria 3825
119 Ga0070697_100043096 3300005536 Bacteria 3653
120 Ga0070697_100052834 3300005536 Unclassified 3302
121 Ga0070697_100066742 3300005536 Bacteria 2942
122 Ga0070697_100179851 3300005536 Bacteria 1793
123 Ga0070697_100221679 3300005536 Bacteria 1612
124 Ga0070697_100226872 3300005536 Bacteria 1592
125 Ga0070697_100302953 3300005536 Bacteria 1374
126 Ga0070697_100772334 3300005536 Unclassified 849
127 Ga0070672_100061164 3300005543 Bacteria 2968
128 Ga0070695_100439633 3300005545 Bacteria 997
129 Ga0070696_100025114 3300005546 Bacteria 4049
130 Ga0070696_100503033 3300005546 Bacteria 964
131 Ga0070693_100029750 3300005547 Bacteria 2981
132 Ga0070665_100000235 3300005548 Bacteria 91903
133 Ga0070665_100066250 3300005548 Bacteria 3623
134 Ga0070665_100243324 3300005548 Unclassified 1799
135 Ga0070665_100925102 3300005548 Unclassified 884
136 Ga0070665_101095701 3300005548 Unclassified 808
137 Ga0070704_100156810 3300005549 Bacteria 1796
138 Ga0070704_100942433 3300005549 Bacteria 778
139 Ga0068855_100559872 3300005563 Unclassified 1237
140 Ga0068856_100163299 3300005614 Bacteria 2238
141 Ga0068859_100016834 3300005617 Bacteria 7339
142 Ga0068859_100801133 3300005617 Unclassified 1030
143 Ga0068864_100303119 3300005618 Bacteria 1496
144 Ga0068866_10167124 3300005718 Bacteria 1288
145 Ga0068861_100058132 3300005719 Bacteria 2956
146 Ga0068863_100046061 3300005841 Bacteria 4139
147 Ga0068863_100907822 3300005841 Unclassified 881
148 Ga0068858_100596617 3300005842 Bacteria 1071
149 Ga0068860_100283354 3300005843 Bacteria 1620
150 Ga0068860_100361319 3300005843 Bacteria 1430
151 Ga0068860_100765623 3300005843 Unclassified 978
152 Ga0068862_100586122 3300005844 Bacteria 1069
153 Ga0081455_10225606 3300005937 Bacteria 1386
154 Ga0070717_10009976 3300006028 Bacteria 7146
155 Ga0070717_10046411 3300006028 Bacteria 3554
156 Ga0070717_10047842 3300006028 Bacteria 3506
157 Ga0070717_10516770 3300006028 Bacteria 1080
158 Ga0070715_10031333 3300006163 Bacteria 2157
159 Ga0070715_10164117 3300006163 Bacteria 1100
160 Ga0070716_100019135 3300006173 Bacteria 3576
161 Ga0070716_100156142 3300006173 Bacteria 1473
162 Ga0070716_100177811 3300006173 Bacteria 1394
163 Ga0070716_100716126 3300006173 Unclassified 766
164 Ga0070712_100045939 3300006175 Bacteria 3017
165 Ga0097621_100078011 3300006237 Bacteria 2751
166 Ga0097621_100926861 3300006237 Unclassified 812
167 Ga0068871_100002161 3300006358 Bacteria 13345
168 Ga0068871_100019204 3300006358 Bacteria 5216
169 Ga0068871_100898697 3300006358 Unclassified 821
170 Ga0075430_100049695 3300006846 Bacteria 3539
171 Ga0075431_100033684 3300006847 Bacteria 5278
172 Ga0075431_100152713 3300006847 Bacteria 2377
173 Ga0075431_100229639 3300006847 Bacteria 1891
174 Ga0075434_100185652 3300006871 Bacteria 2100
175 Ga0068865_100007154 3300006881 Bacteria 6853
176 Ga0068865_100116760 3300006881 Bacteria 1977
177 Ga0068865_100123528 3300006881 Bacteria 1929
178 Ga0068865_101095675 3300006881 Unclassified 701
179 Ga0075436_100788248 3300006914 Unclassified 707
180 Ga0097620_100016834 3300006931 Bacteria 7339
181 Ga0097620_100801076 3300006931 Unclassified 1030
182 Ga0099794_10218172 3300007265 Bacteria 979
183 Ga0099795_10169070 3300007788 Bacteria 907
184 Ga0111539_10425287 3300009094 Bacteria 1547
185 Ga0111539_10462590 3300009094 Bacteria 1477
186 Ga0105245_10337447 3300009098 Bacteria 1489
187 Ga0105245_10526378 3300009098 Bacteria 1201
188 Ga0105247_10618796 3300009101 Unclassified 805
189 Ga0114129_11724749 3300009147 Unclassified 764
190 Ga0105243_10287399 3300009148 Unclassified 1484
191 Ga0105242_10044578 3300009176 Bacteria 3592
192 Ga0105242_10260321 3300009176 Bacteria 1567
193 Ga0105242_10714349 3300009176 Bacteria 982
194 Ga0105248_10768901 3300009177 Bacteria 1087
195 Ga0105248_11123579 3300009177 Bacteria 888
196 Ga0105248_11307131 3300009177 Bacteria 820
197 Ga0105237_10393989 3300009545 Bacteria 1390
198 Ga0105249_10009392 3300009553 Bacteria 8557
199 Ga0105249_12311163 3300009553 Unclassified 610
200 Ga0105239_10068695 3300010375 Bacteria 3894
201 Ga0105239_10550143 3300010375 Bacteria 1314
202 Ga0105239_11524533 3300010375 Unclassified 772
203 Ga0105246_10572397 3300011119 Unclassified 971
204 Ga0157373_10467728 3300013100 Bacteria 909
205 Ga0157371_10327536 3300013102 Bacteria 1112
206 Ga0157369_10541391 3300013105 Bacteria 1204
207 Ga0157374_10000821 3300013296 Bacteria 27224
208 Ga0157374_10067647 3300013296 Bacteria 3359
209 Ga0157374_10073597 3300013296 Bacteria 3225
210 Ga0157374_10300389 3300013296 Bacteria 1588
211 Ga0157374_10499531 3300013296 Bacteria 1221
212 Ga0157374_11174568 3300013296 Bacteria 789
213 Ga0157374_11651853 3300013296 Unclassified 665
214 Ga0157378_10050642 3300013297 Bacteria 3696
215 Ga0157378_10058586 3300013297 Bacteria 3435
216 Ga0157378_10114285 3300013297 Bacteria 2479
217 Ga0157378_10185896 3300013297 Bacteria 1957
218 Ga0157378_10281444 3300013297 Bacteria 1603
219 Ga0157378_10434378 3300013297 Bacteria 1300
220 Ga0157378_10435610 3300013297 Unclassified 1298
221 Ga0163162_10009700 3300013306 Bacteria 9368
222 Ga0163162_10016139 3300013306 Bacteria 7301
223 Ga0163162_10097196 3300013306 Bacteria 3033
224 Ga0163162_10278648 3300013306 Bacteria 1804
225 Ga0163162_11446089 3300013306 Unclassified 782
226 Ga0163162_12549090 3300013306 Unclassified 588
227 Ga0157372_10041829 3300013307 Bacteria 5067
228 Ga0157372_10082972 3300013307 Bacteria 3630
229 Ga0157372_11115382 3300013307 Unclassified 912
230 Ga0157372_11816483 3300013307 Unclassified 701
231 Ga0157375_10012054 3300013308 Bacteria 7657
232 Ga0157375_10033465 3300013308 Bacteria 4884
233 Ga0157375_10053903 3300013308 Bacteria 3960
234 Ga0157375_10120420 3300013308 Bacteria 2733
235 Ga0157375_11066282 3300013308 Bacteria 945
236 Ga0163163_10169051 3300014325 Unclassified 2233
237 Ga0157380_11308772 3300014326 Unclassified 772
238 Ga0157379_10415766 3300014968 Bacteria 1238
239 Ga0157376_10034698 3300014969 Bacteria 4075
240 Ga0157376_10089536 3300014969 Bacteria 2661
241 Ga0157376_10091521 3300014969 Bacteria 2635
242 Ga0163161_10006602 3300017792 Bacteria 8033
243 Ga0207697_10000196 3300025315 Bacteria 32121
244 Ga0207697_10002213 3300025315 Bacteria 10160
245 Ga0207682_10026665 3300025893 Bacteria 2298
246 Ga0207692_10368390 3300025898 Unclassified 889
247 Ga0207642_10006092 3300025899 Bacteria 3986
248 Ga0207688_10013187 3300025901 Bacteria 4492
249 Ga0207688_10269725 3300025901 Bacteria 1035
250 Ga0207680_10005155 3300025903 Bacteria 6234
251 Ga0207680_10017213 3300025903 Bacteria 3814
252 Ga0207685_10006780 3300025905 Bacteria 3147
253 Ga0207685_10143138 3300025905 Bacteria 1074
254 Ga0207699_10000062 3300025906 Bacteria 88201
255 Ga0207645_10002242 3300025907 Bacteria 15390
256 Ga0207645_10006090 3300025907 Bacteria 8672
257 Ga0207645_10035998 3300025907 Unclassified 3178
258 Ga0207684_10005670 3300025910 Bacteria 11469
259 Ga0207684_10006943 3300025910 Bacteria 10244
260 Ga0207684_10016726 3300025910 Bacteria 6297
261 Ga0207684_10020785 3300025910 Bacteria 5609
262 Ga0207684_10035367 3300025910 Bacteria 4242
263 Ga0207684_10095896 3300025910 Unclassified 2531
264 Ga0207684_10168729 3300025910 Bacteria 1886
265 Ga0207684_10276703 3300025910 Bacteria 1448
266 Ga0207684_10284011 3300025910 Bacteria 1427
267 Ga0207693_10062007 3300025915 Bacteria 2929
268 Ga0207693_10910431 3300025915 Bacteria 674
269 Ga0207663_10004989 3300025916 Bacteria 6653
270 Ga0207663_10301507 3300025916 Bacteria 1197
271 Ga0207662_10068287 3300025918 Bacteria 2146
272 Ga0207662_10231493 3300025918 Bacteria 1207
273 Ga0207657_10191780 3300025919 Bacteria 1648
274 Ga0207646_10000130 3300025922 Bacteria 101961
275 Ga0207646_10006445 3300025922 Bacteria 12117
276 Ga0207646_10031021 3300025922 Bacteria 4841
277 Ga0207646_10071571 3300025922 Bacteria 3097
278 Ga0207646_10095915 3300025922 Bacteria 2657
279 Ga0207646_10182091 3300025922 Bacteria 1898
280 Ga0207646_10201016 3300025922 Unclassified 1800
281 Ga0207646_11252827 3300025922 Bacteria 649
282 Ga0207681_10017930 3300025923 Bacteria 4452
283 Ga0207681_10086908 3300025923 Bacteria 2223
284 Ga0207650_10173840 3300025925 Bacteria 1713
285 Ga0207650_10724150 3300025925 Unclassified 841
286 Ga0207659_10038885 3300025926 Bacteria 3312
287 Ga0207659_10042134 3300025926 Bacteria 3199
288 Ga0207687_10193198 3300025927 Bacteria 1586
289 Ga0207700_10400626 3300025928 Bacteria 1203
290 Ga0207664_10490337 3300025929 Bacteria 1100
291 Ga0207644_10074509 3300025931 Bacteria 2491
292 Ga0207644_10227557 3300025931 Bacteria 1481
293 Ga0207706_10002257 3300025933 Bacteria 18819
294 Ga0207706_10022629 3300025933 Bacteria 5641
295 Ga0207706_10511339 3300025933 Bacteria 1036
296 Ga0207706_10840294 3300025933 Bacteria 778
297 Ga0207686_10162397 3300025934 Bacteria 1567
298 Ga0207686_10530055 3300025934 Bacteria 918
299 Ga0207670_10006743 3300025936 Bacteria 6381
300 Ga0207669_10014273 3300025937 Bacteria 3976
301 Ga0207669_10053308 3300025937 Bacteria 2435
302 Ga0207704_10202031 3300025938 Bacteria 1455
303 Ga0207704_10769060 3300025938 Unclassified 802
304 Ga0207704_11460601 3300025938 Unclassified 586
305 Ga0207665_10004151 3300025939 Bacteria 9646
306 Ga0207665_10130027 3300025939 Bacteria 1786
307 Ga0207665_10270856 3300025939 Bacteria 1261
308 Ga0207665_10277917 3300025939 Bacteria 1245
309 Ga0207691_10000393 3300025940 Bacteria 43744
310 Ga0207691_10004881 3300025940 Bacteria 12965
311 Ga0207691_10080039 3300025940 Bacteria 2940
312 Ga0207689_10233661 3300025942 Bacteria 1520
313 Ga0207679_10030639 3300025945 Bacteria 3758
314 Ga0207679_10845025 3300025945 Bacteria 836
315 Ga0207651_10028537 3300025960 Bacteria 3522
316 Ga0207651_10071533 3300025960 Bacteria 2459
317 Ga0207651_10322611 3300025960 Bacteria 1291
318 Ga0207712_10012280 3300025961 Bacteria 5472
319 Ga0207668_10006693 3300025972 Bacteria 6817
320 Ga0207668_10163931 3300025972 Bacteria 1735
321 Ga0207668_10267064 3300025972 Bacteria 1397
322 Ga0207668_10335114 3300025972 Bacteria 1260
323 Ga0207668_11033710 3300025972 Bacteria 735
324 Ga0207658_10014071 3300025986 Bacteria 5477
325 Ga0207658_10030360 3300025986 Bacteria 3825
326 Ga0207658_10036403 3300025986 Bacteria 3528
327 Ga0207677_10010358 3300026023 Bacteria 5272
328 Ga0207677_10775206 3300026023 Bacteria 857
329 Ga0207703_10567911 3300026035 Bacteria 1071
330 Ga0207708_10388036 3300026075 Bacteria 1152
331 Ga0207641_10198940 3300026088 Bacteria 1846
332 Ga0207641_11524332 3300026088 Unclassified 670
333 Ga0207648_10536900 3300026089 Bacteria 1073
334 Ga0207676_10206155 3300026095 Bacteria 1741
335 Ga0207675_100072408 3300026118 Bacteria 3223
336 Ga0207683_10009557 3300026121 Bacteria 8267
337 Ga0207683_10015612 3300026121 Bacteria 6464
338 Ga0207683_10121717 3300026121 Bacteria 2343
339 Ga0268266_10000147 3300028379 Bacteria 135216
340 Ga0268266_10016899 3300028379 Bacteria 6233
341 Ga0268266_10057891 3300028379 Bacteria 3336
342 Ga0268266_10061791 3300028379 Bacteria 3231
343 Ga0268265_10722387 3300028380 Bacteria 964
344 Ga0268264_10274840 3300028381 Bacteria 1575
345 Ga0268264_10462505 3300028381 Bacteria 1231
346 Ga0268264_10531964 3300028381 Bacteria 1151
347 Ga0307513_10033550 3300031456 Bacteria 5769
348 Ga0373949_0077483 3300035090 Unclassified 881
349 Ga0373939_0153921 3300035114 Bacteria 839
350 Ga0373931_0009659 3300035691 Bacteria 4620
351 Ga0373935_0899771 3300035692 Unclassified 656
352 Ga0373927_0743150 3300035695 Unclassified 648
353 Ga0373947_0007120 3300035725 Bacteria 6486
354 Ga0373947_0175822 3300035725 Bacteria 1391
355 Ga0373947_0316948 3300035725 Unclassified 1042
356 Ga0373947_0445187 3300035725 Bacteria 877
357 Ga0373947_0594234 3300035725 Unclassified 754
358 Ga0373937_0336825 3300036401 Bacteria 1428
359 Ga0373925_0494234 3300037068 Bacteria 1004
360 Ga0395900_1206366 3300037418 Unclassified 672
361 Ga0395898_0590349 3300037466 Unclassified 1053
362 Ga0395905_0465357 3300037471 Unclassified 1163
363 Ga0395901_0100303 3300038443 Bacteria 3037
364 Ga0436363_0175890 3300039450 Unclassified 735
365 Ga0436363_0213237 3300039450 Bacteria 1010
366 Ga0451845_0863643 3300041501 Unclassified 754
367 Ga0439448_0059369 3300042005 Unclassified 1262
368 Ga0439454_024117 3300042011 Bacteria 917
369 Ga0439455_0011718 3300042012 Bacteria 1954
370 Ga0439458_0014661 3300042157 Bacteria 1770
371 Ga0439460_0106511 3300042461 Unclassified 906
372 Ga0451576_0092992 3300045051 Bacteria 3136
373 Ga0451576_0146598 3300045051 Bacteria 2461
374 Ga0451576_0401756 3300045051 Bacteria 1437
375 Ga0495592_0044471 3300046454 Bacteria 3318
376 Ga0495629_0394695 3300046459 Bacteria 941
377 Ga0495629_0787301 3300046459 Bacteria 628
378 Ga0495651_0043380 3300046462 Bacteria 3490
379 Ga0495628_0219008 3300046516 Bacteria 1430
380 Ga0495630_0158420 3300046517 Bacteria 1723
381 Ga0495652_0122767 3300046529 Bacteria 2068
382 Ga0495587_0143700 3300046536 Bacteria 1361
383 Ga0495645_0123368 3300046543 Bacteria 1822
384 Ga0495634_0185844 3300046642 Bacteria 1299
385 Ga0495635_0152462 3300046663 Bacteria 1573
386 Ga0495657_0104003 3300046675 Bacteria 1806
387 Ga0495599_0213684 3300046678 Bacteria 1182
388 Ga0495623_0244452 3300046679 Bacteria 1012
389 Ga0495658_0052818 3300046683 Bacteria 2306
390 Ga0495613_0164101 3300046689 Bacteria 1579
391 Ga0495604_0148504 3300047317 Bacteria 1668
392 Ga0495680_0268006 3300047322 Bacteria 1206
393 Ga0495675_0052572 3300047444 Bacteria 2586
394 Ga0495684_0039546 3300047471 Bacteria 3616
395 Ga0495602_0298536 3300048088 Bacteria 1180
396 Ga0496100_0056189 3300048903 Bacteria 2574
397 Ga0496101_0003690 3300048904 Bacteria 9556
398 Ga0496101_0181500 3300048904 Bacteria 1621
399 Ga0496102_0008715 3300048905 Bacteria 8705
400 Ga0496102_0067310 3300048905 Unclassified 3285
401 Ga0496104_0053270 3300048907 Bacteria 3822
402 Ga0496104_0068480 3300048907 Bacteria 3373
403 Ga0496105_0023349 3300048908 Bacteria 5014
404 Ga0496105_0094308 3300048908 Bacteria 2472
405 Ga0496106_0007872 3300048909 Bacteria 7879
406 Ga0496107_0689146 3300048910 Unclassified 752
407 Ga0496108_0151576 3300048911 Bacteria 2001
408 Ga0496108_0389567 3300048911 Unclassified 1217
409 Ga0496108_1211581 3300048911 Unclassified 638
410 Ga0496109_0364725 3300048912 Bacteria 1365
411 Ga0496110_0085359 3300048913 Bacteria 2818
412 Ga0496112_0617325 3300048915 Unclassified 1015
413 Ga0496113_0230186 3300048916 Bacteria 1478
414 Ga0496114_0007951 3300048917 Bacteria 8391
415 Ga0496114_0235596 3300048917 Unclassified 1609
416 Ga0496114_0428958 3300048917 Bacteria 1171
417 Ga0496115_0002861 3300048918 Bacteria 12427
418 Ga0496115_0013912 3300048918 Bacteria 6089
419 Ga0501075_0639719 3300049591 Unclassified 811
420 nmdc:mga0qj67_196506_c1 3300050509 Bacteria 1639
421 nmdc:mga06r32_154370_c1 3300050510 Bacteria 2276
422 nmdc:mga06r32_209457_c1 3300050510 Bacteria 1937
423 nmdc:mga08y16_343096_c1 3300050511 Bacteria 1535
424 nmdc:mga08y16_50788_c1 3300050511 Bacteria 4339
425 nmdc:mga0n895_331668_c1 3300050512 Bacteria 1541
426 nmdc:mga0rr50_1043020_c1 3300050513 Bacteria 696
427 nmdc:mga08x19_108151_c1 3300050514 Bacteria 1852
428 Ga0495601_0055807 3300053077 Bacteria 2501
429 Ga0495601_0184470 3300053077 Bacteria 1364
430 Ga0495619_0047055 3300053085 Bacteria 2839
431 Ga0495619_0888345 3300053085 Unclassified 600
432 Ga0501082_0077364 3300060353 Bacteria 2869
433 nmdc:mga06r32_5842_c1
434 MBSR1b_contig_1477776
435 CNXas_1001199
436 JGI24035J26624_1006990
437 Ga0065704_10005494
438 Ga0065712_10091874
439 Ga0065707_10100975
440 Ga0070676_10001944
441 Ga0070676_10464097
442 Ga0070690_100138276
443 Ga0070690_100394017
444 Ga0070690_101131236
445 Ga0070670_100011894
446 Ga0070670_100221893
447 Ga0070677_10126532
448 Ga0068869_100088127
449 Ga0070666_10000943
450 Ga0070666_10022204
451 Ga0070666_11078760
452 Ga0068868_100024220
453 Ga0068868_100179056
454 Ga0070660_100245121
455 Ga0070689_100010393
456 Ga0070689_100023918
457 Ga0070689_100284178
458 Ga0070689_100330516
459 Ga0070687_100050903
460 Ga0070687_100134398
461 Ga0070668_100026701
462 Ga0070669_100007483
463 Ga0070669_100016713
464 Ga0070669_100091778
465 Ga0070669_100662846
466 Ga0070675_100007768
467 Ga0070675_100020653
468 Ga0070675_100095472
469 Ga0070671_100001854
470 Ga0070671_100047457
471 Ga0070671_100093085
472 Ga0070671_101058970
473 Ga0070674_100004866
474 Ga0070674_100009771
475 Ga0070673_100045057
476 Ga0070673_100118287
477 Ga0070673_100177962
478 Ga0070688_100011706
479 Ga0070688_100073608
480 Ga0070688_100183522
481 Ga0070688_100351893
482 Ga0070667_100000546
483 Ga0070667_100040185
484 Ga0070667_100084103
485 Ga0070703_10285498
486 Ga0070709_10000056
487 Ga0070709_11337883
488 Ga0070714_100069116
489 Ga0070714_100180996
490 Ga0070713_101148724
491 Ga0070710_10145000
492 Ga0070701_10220378
493 Ga0070711_100052076
494 Ga0070711_100966559
495 Ga0070705_100019411
496 Ga0070705_100071924
497 Ga0070705_100468944
498 Ga0070700_100676041
499 Ga0070708_100009205
500 Ga0070708_100030543
501 Ga0070708_100062645
502 Ga0070708_100161682
503 Ga0070708_100268787
504 Ga0070708_100486013
505 Ga0070708_100502256
506 Ga0070708_100698806
507 Ga0070678_100472374
508 Ga0070662_100003770
509 Ga0070662_100069518
510 Ga0070662_100784681
511 Ga0068867_100298500
512 Ga0068867_100432845
513 Ga0070685_10002842
514 Ga0070685_10375914
515 Ga0070685_10515950
516 Ga0070706_100001850
517 Ga0070706_100059516
518 Ga0070706_100068351
519 Ga0070706_100082818
520 Ga0070706_100087672
521 Ga0070706_100088481
522 Ga0070706_100144767
523 Ga0070706_100191385
524 Ga0070706_100238649
525 Ga0070706_100259296
526 Ga0070706_100365734
527 Ga0070706_100428819
528 Ga0070706_100471361
529 Ga0070706_100726279
530 Ga0070707_100052698
531 Ga0070707_100068818
532 Ga0070707_100070774
533 Ga0070707_100112084
534 Ga0070707_100168344
535 Ga0070707_100333643
536 Ga0070707_100473478
537 Ga0070707_100667783
538 Ga0070707_100716476
539 Ga0070707_100884586
540 Ga0070707_100988170
541 Ga0070698_100006278
542 Ga0070698_100021408
543 Ga0070699_100073617
544 Ga0070699_100108936
545 Ga0070699_100110697
546 Ga0070699_100379734
547 Ga0070684_100290130
548 Ga0070697_100017676
549 Ga0070697_100032427
550 Ga0070697_100039294
551 Ga0070697_100043096
552 Ga0070697_100052834
553 Ga0070697_100066742
554 Ga0070697_100179851
555 Ga0070697_100221679
556 Ga0070697_100226872
557 Ga0070697_100302953
558 Ga0070697_100772334
559 Ga0070672_100061164
560 Ga0070695_100439633
561 Ga0070696_100025114
562 Ga0070696_100503033
563 Ga0070693_100029750
564 Ga0070665_100000235
565 Ga0070665_100066250
566 Ga0070665_100243324
567 Ga0070665_100925102
568 Ga0070665_101095701
569 Ga0070704_100156810
570 Ga0070704_100942433
571 Ga0068855_100559872
572 Ga0068856_100163299
573 Ga0068859_100016834
574 Ga0068859_100801133
575 Ga0068864_100303119
576 Ga0068866_10167124
577 Ga0068861_100058132
578 Ga0068863_100046061
579 Ga0068863_100907822
580 Ga0068858_100596617
581 Ga0068860_100283354
582 Ga0068860_100361319
583 Ga0068860_100765623
584 Ga0068862_100586122
585 Ga0081455_10225606
586 Ga0070717_10009976
587 Ga0070717_10046411
588 Ga0070717_10047842
589 Ga0070717_10516770
590 Ga0070715_10031333
591 Ga0070715_10164117
592 Ga0070716_100019135
593 Ga0070716_100156142
594 Ga0070716_100177811
595 Ga0070716_100716126
596 Ga0070712_100045939
597 Ga0097621_100078011
598 Ga0097621_100926861
599 Ga0068871_100002161
600 Ga0068871_100019204
601 Ga0068871_100898697
602 Ga0075430_100049695
603 Ga0075431_100033684
604 Ga0075431_100152713
605 Ga0075431_100229639
606 Ga0075434_100185652
607 Ga0068865_100007154
608 Ga0068865_100116760
609 Ga0068865_100123528
610 Ga0068865_101095675
611 Ga0075436_100788248
612 Ga0097620_100016834
613 Ga0097620_100801076
614 Ga0099794_10218172
615 Ga0099795_10169070
616 Ga0111539_10425287
617 Ga0111539_10462590
618 Ga0105245_10337447
619 Ga0105245_10526378
620 Ga0105247_10618796
621 Ga0114129_11724749
622 Ga0105243_10287399
623 Ga0105242_10044578
624 Ga0105242_10260321
625 Ga0105242_10714349
626 Ga0105248_10768901
627 Ga0105248_11123579
628 Ga0105248_11307131
629 Ga0105237_10393989
630 Ga0105249_10009392
631 Ga0105249_12311163
632 Ga0105239_10068695
633 Ga0105239_10550143
634 Ga0105239_11524533
635 Ga0105246_10572397
636 Ga0157373_10467728
637 Ga0157371_10327536
638 Ga0157369_10541391
639 Ga0157374_10000821
640 Ga0157374_10067647
641 Ga0157374_10073597
642 Ga0157374_10300389
643 Ga0157374_10499531
644 Ga0157374_11174568
645 Ga0157374_11651853
646 Ga0157378_10050642
647 Ga0157378_10058586
648 Ga0157378_10114285
649 Ga0157378_10185896
650 Ga0157378_10281444
651 Ga0157378_10434378
652 Ga0157378_10435610
653 Ga0163162_10009700
654 Ga0163162_10016139
655 Ga0163162_10097196
656 Ga0163162_10278648
657 Ga0163162_11446089
658 Ga0163162_12549090
659 Ga0157372_10041829
660 Ga0157372_10082972
661 Ga0157372_11115382
662 Ga0157372_11816483
663 Ga0157375_10012054
664 Ga0157375_10033465
665 Ga0157375_10053903
666 Ga0157375_10120420
667 Ga0157375_11066282
668 Ga0163163_10169051
669 Ga0157380_11308772
670 Ga0157379_10415766
671 Ga0157376_10034698
672 Ga0157376_10089536
673 Ga0157376_10091521
674 Ga0163161_10006602
675 Ga0207697_10000196
676 Ga0207697_10002213
677 Ga0207682_10026665
678 Ga0207692_10368390
679 Ga0207642_10006092
680 Ga0207688_10013187
681 Ga0207688_10269725
682 Ga0207680_10005155
683 Ga0207680_10017213
684 Ga0207685_10006780
685 Ga0207685_10143138
686 Ga0207699_10000062
687 Ga0207645_10002242
688 Ga0207645_10006090
689 Ga0207645_10035998
690 Ga0207684_10005670
691 Ga0207684_10006943
692 Ga0207684_10016726
693 Ga0207684_10020785
694 Ga0207684_10035367
695 Ga0207684_10095896
696 Ga0207684_10168729
697 Ga0207684_10276703
698 Ga0207684_10284011
699 Ga0207693_10062007
700 Ga0207693_10910431
701 Ga0207663_10004989
702 Ga0207663_10301507
703 Ga0207662_10068287
704 Ga0207662_10231493
705 Ga0207657_10191780
706 Ga0207646_10000130
707 Ga0207646_10006445
708 Ga0207646_10031021
709 Ga0207646_10071571
710 Ga0207646_10095915
711 Ga0207646_10182091
712 Ga0207646_10201016
713 Ga0207646_11252827
714 Ga0207681_10017930
715 Ga0207681_10086908
716 Ga0207650_10173840
717 Ga0207650_10724150
718 Ga0207659_10038885
719 Ga0207659_10042134
720 Ga0207687_10193198
721 Ga0207700_10400626
722 Ga0207664_10490337
723 Ga0207644_10074509
724 Ga0207644_10227557
725 Ga0207706_10002257
726 Ga0207706_10022629
727 Ga0207706_10511339
728 Ga0207706_10840294
729 Ga0207686_10162397
730 Ga0207686_10530055
731 Ga0207670_10006743
732 Ga0207669_10014273
733 Ga0207669_10053308
734 Ga0207704_10202031
735 Ga0207704_10769060
736 Ga0207704_11460601
737 Ga0207665_10004151
738 Ga0207665_10130027
739 Ga0207665_10270856
740 Ga0207665_10277917
741 Ga0207691_10000393
742 Ga0207691_10004881
743 Ga0207691_10080039
744 Ga0207689_10233661
745 Ga0207679_10030639
746 Ga0207679_10845025
747 Ga0207651_10028537
748 Ga0207651_10071533
749 Ga0207651_10322611
750 Ga0207712_10012280
751 Ga0207668_10006693
752 Ga0207668_10163931
753 Ga0207668_10267064
754 Ga0207668_10335114
755 Ga0207668_11033710
756 Ga0207658_10014071
757 Ga0207658_10030360
758 Ga0207658_10036403
759 Ga0207677_10010358
760 Ga0207677_10775206
761 Ga0207703_10567911
762 Ga0207708_10388036
763 Ga0207641_10198940
764 Ga0207641_11524332
765 Ga0207648_10536900
766 Ga0207676_10206155
767 Ga0207675_100072408
768 Ga0207683_10009557
769 Ga0207683_10015612
770 Ga0207683_10121717
771 Ga0268266_10000147
772 Ga0268266_10016899
773 Ga0268266_10057891
774 Ga0268266_10061791
775 Ga0268265_10722387
776 Ga0268264_10274840
777 Ga0268264_10462505
778 Ga0268264_10531964
779 Ga0307513_10033550
780 Ga0373949_0077483
781 Ga0373939_0153921
782 Ga0373931_0009659
783 Ga0373935_0899771
784 Ga0373927_0743150
785 Ga0373947_0007120
786 Ga0373947_0175822
787 Ga0373947_0316948
788 Ga0373947_0445187
789 Ga0373947_0594234
790 Ga0373937_0336825
791 Ga0373925_0494234
792 Ga0395900_1206366
793 Ga0395898_0590349
794 Ga0395905_0465357
795 Ga0395901_0100303
796 Ga0436363_0175890
797 Ga0436363_0213237
798 Ga0451845_0863643
799 Ga0439448_0059369
800 Ga0439454_024117
801 Ga0439455_0011718
802 Ga0439458_0014661
803 Ga0439460_0106511
804 Ga0451576_0092992
805 Ga0451576_0146598
806 Ga0451576_0401756
807 Ga0495592_0044471
808 Ga0495629_0394695
809 Ga0495629_0787301
810 Ga0495651_0043380
811 Ga0495628_0219008
812 Ga0495630_0158420
813 Ga0495652_0122767
814 Ga0495587_0143700
815 Ga0495645_0123368
816 Ga0495634_0185844
817 Ga0495635_0152462
818 Ga0495657_0104003
819 Ga0495599_0213684
820 Ga0495623_0244452
821 Ga0495658_0052818
822 Ga0495613_0164101
823 Ga0495604_0148504
824 Ga0495680_0268006
825 Ga0495675_0052572
826 Ga0495684_0039546
827 Ga0495602_0298536
828 Ga0496100_0056189
829 Ga0496101_0003690
830 Ga0496101_0181500
831 Ga0496102_0008715
832 Ga0496102_0067310
833 Ga0496104_0053270
834 Ga0496104_0068480
835 Ga0496105_0023349
836 Ga0496105_0094308
837 Ga0496106_0007872
838 Ga0496107_0689146
839 Ga0496108_0151576
840 Ga0496108_0389567
841 Ga0496108_1211581
842 Ga0496109_0364725
843 Ga0496110_0085359
844 Ga0496112_0617325
845 Ga0496113_0230186
846 Ga0496114_0007951
847 Ga0496114_0235596
848 Ga0496114_0428958
849 Ga0496115_0002861
850 Ga0496115_0013912
851 Ga0501075_0639719
852 nmdc:mga0qj67_196506_c1
853 nmdc:mga06r32_154370_c1
854 nmdc:mga06r32_209457_c1
855 nmdc:mga08y16_343096_c1
856 nmdc:mga08y16_50788_c1
857 nmdc:mga0n895_331668_c1
858 nmdc:mga0rr50_1043020_c1
859 nmdc:mga08x19_108151_c1
860 Ga0495601_0055807
861 Ga0495601_0184470
862 Ga0495619_0047055
863 Ga0495619_0888345
864 Ga0501082_0077364

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2if4-assembly1.cif.gz_A crystal structure of a multi-domain immunophilin from arabidopsis thaliana 0.8586 12 77
4cgq-assembly1.cif.gz_A full length tah1 bound to hsp90 peptide srmeevd 0.8531 7 77
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.8445 13 77
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.7344 13 77
5gan-assembly1.cif.gz_J the overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom 0.6869 12 149
ID Description Score Start End Superfamily
af_A4I5Y0_716_784_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.911 13 77 1.25.40.10
4gyyC01 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8896 12 77 1.25.40.10
af_Q6AYE7_132_190_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8891 3 58 1.25.40.10
af_Q9FHD7_381_487_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8874 12 77 1.25.40.10
af_K7M9B5_29_102_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8872 12 77 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A3B9LV38-F1-model_v4 Tetratricopeptide repeat protein 0.9878 2 100
AF-A0A2V7YCG8-F1-model_v4 Tetratricopeptide repeat protein 0.9743 1 141
AF-A0A482YXY4-F1-model_v4 Uncharacterized protein 0.9667 3 161
AF-A0A7Y2GVW8-F1-model_v4 Uncharacterized protein 0.9644 1 161
AF-A0A2V8DD76-F1-model_v4 Tetratricopeptide repeat protein 0.9627 4 153

Map