F442690

General Info

Members Datasets Scaffolds Average Seq Length
432 230 864 124

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0032836|Ga0496100_0032836_1833_2261
Length 142
Sequence MDMKLELVAVPVTDVDRAKEFYVDRVGFNADHDHTVSDEIRFVQLTPPGSACSIAIGKGLTQIVPGGLDNLQLVIADADAVRAELVGRGVEVSEVEEQPWGRFVHFSDPDGNRWALQELPAWSSGAGGTGTADGASDESAPA

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
123 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
124 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
134 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
135 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
138 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
139 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
140 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
141 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
142 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
162 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
207 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
208 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
211 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
226 2547132424 Nocardia nova SH22a Isolate Unclassified
227 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
228 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
229 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
230 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.84
Metatranscriptomes 0
Isolates 1.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.17
Nodule 0
Rhizoplane 16.67
Rhizosphere 77.31
Stem 0
Stem Tuber 0
Unclassified 1.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0032836 3300048903 Bacteria 3242
2 JGI24738J21930_10050959 3300002075 Bacteria 844
3 JGI25407J50210_10009333 3300003373 Bacteria 2484
4 JGI25405J52794_10004703 3300003911 Bacteria 2445
5 JGI25405J52794_10084350 3300003911 Bacteria 700
6 Ga0070683_100003296 3300005329 Bacteria 13048
7 Ga0070683_100965506 3300005329 Bacteria 818
8 Ga0070677_10000003 3300005333 Bacteria 81204
9 Ga0070677_10363290 3300005333 Bacteria 753
10 Ga0068869_101242412 3300005334 Bacteria 656
11 Ga0070680_100097203 3300005336 Bacteria 2442
12 Ga0070680_100368221 3300005336 Bacteria 1223
13 Ga0070682_100111463 3300005337 Bacteria 1824
14 Ga0070660_100338978 3300005339 Bacteria 1237
15 Ga0070689_101889764 3300005340 Bacteria 545
16 Ga0070661_100266643 3300005344 Bacteria 1325
17 Ga0070674_100085941 3300005356 Bacteria 2258
18 Ga0070674_100660410 3300005356 Bacteria 890
19 Ga0070673_101267440 3300005364 Bacteria 692
20 Ga0070667_100923204 3300005367 Bacteria 813
21 Ga0070714_100003431 3300005435 Bacteria 11807
22 Ga0070713_100051047 3300005436 Bacteria 3420
23 Ga0070713_100232847 3300005436 Bacteria 1675
24 Ga0070711_101471553 3300005439 Bacteria 594
25 Ga0070700_100530583 3300005441 Bacteria 911
26 Ga0070678_100021863 3300005456 Bacteria 4228
27 Ga0070678_100213281 3300005456 Bacteria 1601
28 Ga0070681_10012715 3300005458 Bacteria 8355
29 Ga0068867_101600348 3300005459 Bacteria 609
30 Ga0070707_100030997 3300005468 Bacteria 5093
31 Ga0070698_100045824 3300005471 Bacteria 4474
32 Ga0070699_100017938 3300005518 Bacteria 6079
33 Ga0070699_100129268 3300005518 Bacteria 2226
34 Ga0070679_100002538 3300005530 Bacteria 16533
35 Ga0070686_100372302 3300005544 Bacteria 1079
36 Ga0070686_101097866 3300005544 Bacteria 657
37 Ga0070695_100697094 3300005545 Bacteria 806
38 Ga0070696_100077725 3300005546 Bacteria 2345
39 Ga0070696_100592457 3300005546 Bacteria 893
40 Ga0070665_101290826 3300005548 Bacteria 740
41 Ga0070665_101498879 3300005548 Bacteria 683
42 Ga0070664_100058542 3300005564 Bacteria 3277
43 Ga0068857_100287890 3300005577 Bacteria 1512
44 Ga0068854_100240324 3300005578 Bacteria 1442
45 Ga0068854_101478750 3300005578 Unclassified 616
46 Ga0068856_100267397 3300005614 Bacteria 1726
47 Ga0068856_101035936 3300005614 Bacteria 839
48 Ga0070702_101016844 3300005615 Bacteria 657
49 Ga0068870_11373325 3300005840 Bacteria 517
50 Ga0068862_102494673 3300005844 Bacteria 529
51 Ga0081455_10000030 3300005937 Bacteria 148346
52 Ga0081455_10000938 3300005937 Bacteria 37262
53 Ga0081455_10025001 3300005937 Bacteria 5519
54 Ga0081455_10114886 3300005937 Bacteria 2132
55 Ga0081455_10129088 3300005937 Bacteria 1979
56 Ga0081455_10217162 3300005937 Bacteria 1420
57 Ga0081538_10000591 3300005981 Bacteria 40239
58 Ga0081538_10016820 3300005981 Bacteria 5584
59 Ga0081538_10053877 3300005981 Bacteria 2386
60 Ga0081539_10131459 3300005985 Bacteria 1229
61 Ga0070717_10107551 3300006028 Bacteria 2375
62 Ga0075365_10184250 3300006038 Bacteria 1460
63 Ga0075365_10682804 3300006038 Bacteria 725
64 Ga0075363_100013097 3300006048 Bacteria 4010
65 Ga0070712_100357577 3300006175 Bacteria 1197
66 Ga0070712_100616119 3300006175 Bacteria 920
67 Ga0075367_10523102 3300006178 Bacteria 753
68 Ga0075369_10097652 3300006186 Bacteria 1316
69 Ga0097621_100857413 3300006237 Bacteria 844
70 Ga0075370_10552499 3300006353 Bacteria 696
71 Ga0068871_102431219 3300006358 Bacteria 500
72 Ga0075428_100005979 3300006844 Bacteria 13519
73 Ga0075428_100107952 3300006844 Bacteria 3033
74 Ga0075428_100543380 3300006844 Bacteria 1242
75 Ga0075428_101463139 3300006844 Bacteria 716
76 Ga0075430_100047065 3300006846 Bacteria 3641
77 Ga0075430_100153265 3300006846 Bacteria 1919
78 Ga0075430_100215590 3300006846 Bacteria 1593
79 Ga0075431_100002333 3300006847 Bacteria 18236
80 Ga0075431_100012691 3300006847 Bacteria 8509
81 Ga0075431_100292176 3300006847 Bacteria 1648
82 Ga0075433_10134440 3300006852 Bacteria 2198
83 Ga0075434_101191559 3300006871 Bacteria 774
84 Ga0075434_101547296 3300006871 Bacteria 672
85 Ga0075429_100007915 3300006880 Bacteria 9233
86 Ga0068865_100326534 3300006881 Bacteria 1236
87 Ga0099794_10130907 3300007265 Bacteria 1267
88 Ga0099794_10153051 3300007265 Bacteria 1171
89 Ga0111539_10006276 3300009094 Bacteria 15347
90 Ga0111539_10166595 3300009094 Bacteria 2576
91 Ga0105245_10003599 3300009098 Bacteria 13830
92 Ga0105245_11644219 3300009098 Unclassified 694
93 Ga0114129_10017779 3300009147 Bacteria 10124
94 Ga0114129_10149216 3300009147 Bacteria 3200
95 Ga0114129_10210152 3300009147 Bacteria 2631
96 Ga0114129_10287100 3300009147 Bacteria 2197
97 Ga0114129_10383147 3300009147 Bacteria 1857
98 Ga0114129_10503331 3300009147 Bacteria 1582
99 Ga0114129_11459069 3300009147 Bacteria 842
100 Ga0105243_10111145 3300009148 Bacteria 2293
101 Ga0105243_11516529 3300009148 Bacteria 694
102 Ga0105241_10039611 3300009174 Bacteria 3555
103 Ga0105241_11954486 3300009174 Bacteria 576
104 Ga0105242_10378435 3300009176 Bacteria 1315
105 Ga0105242_10527120 3300009176 Bacteria 1128
106 Ga0105242_11803212 3300009176 Bacteria 650
107 Ga0105238_10307514 3300009551 Unclassified 1570
108 Ga0105239_10737353 3300010375 Bacteria 1127
109 Ga0157369_10769736 3300013105 Bacteria 990
110 Ga0163162_11850336 3300013306 Bacteria 691
111 Ga0157375_10044869 3300013308 Bacteria 4299
112 Ga0157375_12732293 3300013308 Bacteria 590
113 Ga0163163_11695584 3300014325 Bacteria 693
114 Ga0157380_10988797 3300014326 Bacteria 874
115 Ga0157380_11832840 3300014326 Bacteria 666
116 Ga0157377_10135230 3300014745 Bacteria 1510
117 Ga0157377_11138821 3300014745 Bacteria 600
118 Ga0157376_10460911 3300014969 Bacteria 1242
119 Ga0207653_10025751 3300025885 Bacteria 1882
120 Ga0207682_10000191 3300025893 Bacteria 27897
121 Ga0207688_10210772 3300025901 Bacteria 1167
122 Ga0207684_10020711 3300025910 Bacteria 5619
123 Ga0207684_10326749 3300025910 Bacteria 1322
124 Ga0207684_10476950 3300025910 Bacteria 1070
125 Ga0207684_11215569 3300025910 Bacteria 623
126 Ga0207654_10029946 3300025911 Bacteria 2984
127 Ga0207707_10006781 3300025912 Bacteria 9994
128 Ga0207693_10684318 3300025915 Bacteria 795
129 Ga0207663_10448447 3300025916 Bacteria 995
130 Ga0207660_10086392 3300025917 Bacteria 2316
131 Ga0207660_10900396 3300025917 Bacteria 722
132 Ga0207657_10185599 3300025919 Bacteria 1680
133 Ga0207649_10221820 3300025920 Bacteria 1347
134 Ga0207652_10024687 3300025921 Bacteria 4988
135 Ga0207646_10014399 3300025922 Bacteria 7510
136 Ga0207646_10079583 3300025922 Bacteria 2930
137 Ga0207687_10062183 3300025927 Bacteria 2639
138 Ga0207687_10431524 3300025927 Bacteria 1089
139 Ga0207700_10003517 3300025928 Bacteria 9127
140 Ga0207664_10008713 3300025929 Bacteria 7092
141 Ga0207664_10392213 3300025929 Bacteria 1234
142 Ga0207644_11245464 3300025931 Bacteria 625
143 Ga0207706_11169600 3300025933 Bacteria 640
144 Ga0207686_10103170 3300025934 Bacteria 1908
145 Ga0207686_10221076 3300025934 Bacteria 1368
146 Ga0207686_10370935 3300025934 Bacteria 1083
147 Ga0207709_10041631 3300025935 Bacteria 2758
148 Ga0207709_10849663 3300025935 Bacteria 739
149 Ga0207669_10686304 3300025937 Bacteria 840
150 Ga0207704_11155586 3300025938 Bacteria 659
151 Ga0207691_10975347 3300025940 Bacteria 708
152 Ga0207689_10627886 3300025942 Bacteria 905
153 Ga0207661_10038383 3300025944 Bacteria 3753
154 Ga0207661_10204722 3300025944 Bacteria 1737
155 Ga0207661_11056438 3300025944 Bacteria 748
156 Ga0207679_10118904 3300025945 Bacteria 2100
157 Ga0207640_10174005 3300025981 Bacteria 1607
158 Ga0207658_11076054 3300025986 Bacteria 734
159 Ga0207677_10067118 3300026023 Bacteria 2511
160 Ga0207703_11072155 3300026035 Bacteria 774
161 Ga0207702_10024624 3300026078 Bacteria 4995
162 Ga0207702_10078442 3300026078 Bacteria 2859
163 Ga0207641_11441432 3300026088 Bacteria 690
164 Ga0207648_10268276 3300026089 Bacteria 1524
165 Ga0207674_10148548 3300026116 Bacteria 2301
166 Ga0207674_10185506 3300026116 Bacteria 2031
167 Ga0207675_100048407 3300026118 Bacteria 3968
168 Ga0207683_10013251 3300026121 Bacteria 7030
169 Ga0207683_10567006 3300026121 Bacteria 1050
170 Ga0207683_10713430 3300026121 Bacteria 930
171 Ga0207683_11805529 3300026121 Bacteria 560
172 Ga0207428_10003898 3300027907 Bacteria 14307
173 Ga0207428_10951576 3300027907 Bacteria 605
174 Ga0307511_10089825 3300030521 Bacteria 2091
175 Ga0307408_100023516 3300031548 Bacteria 4199
176 Ga0307408_100253902 3300031548 Bacteria 1452
177 Ga0307408_100262789 3300031548 Bacteria 1429
178 Ga0307408_101043156 3300031548 Bacteria 756
179 Ga0307405_11223942 3300031731 Bacteria 650
180 Ga0307413_10071441 3300031824 Bacteria 2187
181 Ga0307413_11096840 3300031824 Bacteria 687
182 Ga0307413_11299495 3300031824 Bacteria 636
183 Ga0307410_10012585 3300031852 Bacteria 4900
184 Ga0307410_10054268 3300031852 Bacteria 2716
185 Ga0307410_10258840 3300031852 Bacteria 1356
186 Ga0307410_10408349 3300031852 Bacteria 1099
187 Ga0307410_11883914 3300031852 Bacteria 532
188 Ga0307406_10164344 3300031901 Bacteria 1599
189 Ga0307407_10034267 3300031903 Bacteria 2778
190 Ga0307407_10167955 3300031903 Bacteria 1442
191 Ga0307407_10227768 3300031903 Bacteria 1264
192 Ga0307407_10399806 3300031903 Bacteria 985
193 Ga0307407_10874096 3300031903 Bacteria 688
194 Ga0307409_100015217 3300031995 Bacteria 5039
195 Ga0307409_100019906 3300031995 Bacteria 4558
196 Ga0307409_100264063 3300031995 Bacteria 1582
197 Ga0307409_100482834 3300031995 Bacteria 1203
198 Ga0307409_101542242 3300031995 Bacteria 692
199 Ga0307416_100052424 3300032002 Bacteria 3266
200 Ga0307416_100063081 3300032002 Bacteria 3033
201 Ga0307416_100292046 3300032002 Bacteria 1614
202 Ga0307416_100364323 3300032002 Bacteria 1469
203 Ga0307414_10118175 3300032004 Bacteria 2033
204 Ga0307414_10373067 3300032004 Bacteria 1231
205 Ga0307414_10523147 3300032004 Bacteria 1053
206 Ga0307411_10103849 3300032005 Bacteria 2017
207 Ga0307415_100021285 3300032126 Bacteria 3982
208 Ga0307415_100118247 3300032126 Bacteria 1981
209 Ga0307415_100971922 3300032126 Bacteria 787
210 Ga0307415_101582605 3300032126 Bacteria 629
211 Ga0373948_0183052 3300034817 Bacteria 539
212 Ga0373959_0125621 3300034820 Bacteria 631
213 Ga0373945_0078708 3300035116 Bacteria 1260
214 Ga0373943_0157992 3300035170 Bacteria 1232
215 Ga0373927_0106813 3300035695 Bacteria 1823
216 Ga0373947_0033269 3300035725 Bacteria 3042
217 Ga0373937_0143829 3300036401 Bacteria 2232
218 Ga0373925_0018496 3300037068 Bacteria 5065
219 Ga0395900_0866562 3300037418 Bacteria 828
220 Ga0436364_1368880 3300037853 Bacteria 607
221 Ga0436365_0984841 3300039437 Bacteria 2079
222 Ga0451793_1659169 3300041452 Bacteria 548
223 Ga0451800_0729196 3300041459 Bacteria 518
224 Ga0451839_1237536 3300041496 Bacteria 1543
225 Ga0451853_2145756 3300041512 Bacteria 533
226 Ga0439448_0088098 3300042005 Bacteria 1047
227 Ga0439450_000386 3300042008 Bacteria 5613
228 Ga0439463_003691 3300042016 Bacteria 3859
229 Ga0450920_118571 3300042122 Bacteria 555
230 Ga0450893_0133188 3300042532 Bacteria 526
231 Ga0439440_0004106 3300042993 Bacteria 2847
232 Ga0466969_0006734 3300044656 Bacteria 6111
233 Ga0466961_0229041 3300044693 Bacteria 1144
234 Ga0466964_0921702 3300044706 Bacteria 501
235 Ga0466957_0643783 3300044842 Bacteria 745
236 Ga0466958_0441986 3300045836 Bacteria 842
237 Ga0466967_0393838 3300045976 Bacteria 1347
238 Ga0466967_0622369 3300045976 Bacteria 1066
239 Ga0466967_2057159 3300045976 Bacteria 567
240 Ga0495603_0015735 3300046455 Bacteria 4575
241 Ga0495603_0553348 3300046455 Bacteria 659
242 Ga0495639_0197448 3300046475 Bacteria 984
243 Ga0495585_0183756 3300046492 Bacteria 1074
244 Ga0495607_0088875 3300046501 Bacteria 1678
245 Ga0495630_0232422 3300046517 Bacteria 1409
246 Ga0495630_0945582 3300046517 Bacteria 656
247 Ga0495621_0049243 3300046539 Bacteria 1503
248 Ga0495667_0410871 3300046559 Bacteria 852
249 Ga0495656_0193027 3300046615 Bacteria 1007
250 Ga0495613_0281892 3300046689 Bacteria 1154
251 Ga0495672_0288280 3300047320 Bacteria 782
252 Ga0495676_0021650 3300047321 Bacteria 5609
253 Ga0495680_0493930 3300047322 Bacteria 832
254 Ga0495683_0004816 3300047323 Bacteria 7573
255 Ga0495685_054848 3300047447 Bacteria 1348
256 Ga0495684_0134886 3300047471 Bacteria 1853
257 Ga0496100_0083330 3300048903 Bacteria 2165
258 Ga0496100_0209351 3300048903 Bacteria 1425
259 Ga0496100_0318425 3300048903 Unclassified 1168
260 Ga0496100_1317305 3300048903 Bacteria 570
261 Ga0496101_0049173 3300048904 Bacteria 3032
262 Ga0496101_0264182 3300048904 Bacteria 1343
263 Ga0496101_0634785 3300048904 Unclassified 844
264 Ga0496102_0002009 3300048905 Bacteria 17567
265 Ga0496102_0029439 3300048905 Bacteria 4913
266 Ga0496102_0080973 3300048905 Bacteria 2993
267 Ga0496102_0320064 3300048905 Unclassified 1461
268 Ga0496102_0548337 3300048905 Bacteria 1079
269 Ga0496102_0610021 3300048905 Bacteria 1014
270 Ga0496103_0043021 3300048906 Bacteria 2780
271 Ga0496103_0057478 3300048906 Bacteria 2415
272 Ga0496103_0936702 3300048906 Bacteria 542
273 Ga0496104_0039691 3300048907 Bacteria 4408
274 Ga0496104_0124363 3300048907 Bacteria 2476
275 Ga0496104_0273281 3300048907 Bacteria 1603
276 Ga0496104_0574304 3300048907 Bacteria 1038
277 Ga0496104_0668072 3300048907 Bacteria 947
278 Ga0496104_0784155 3300048907 Bacteria 859
279 Ga0496104_0923225 3300048907 Bacteria 778
280 Ga0496105_0030206 3300048908 Bacteria 4440
281 Ga0496105_0061213 3300048908 Bacteria 3106
282 Ga0496105_0079212 3300048908 Bacteria 2713
283 Ga0496105_0084855 3300048908 Bacteria 2616
284 Ga0496105_0091960 3300048908 Bacteria 2505
285 Ga0496105_0129758 3300048908 Bacteria 2078
286 Ga0496106_0019491 3300048909 Bacteria 5032
287 Ga0496106_0019912 3300048909 Bacteria 4976
288 Ga0496107_0020659 3300048910 Bacteria 4653
289 Ga0496107_0443026 3300048910 Bacteria 965
290 Ga0496107_0967955 3300048910 Bacteria 618
291 Ga0496108_0001266 3300048911 Bacteria 19766
292 Ga0496108_0004307 3300048911 Bacteria 11445
293 Ga0496108_0365786 3300048911 Bacteria 1259
294 Ga0496109_0001418 3300048912 Bacteria 19886
295 Ga0496109_0012706 3300048912 Bacteria 7275
296 Ga0496109_0156620 3300048912 Bacteria 2134
297 Ga0496109_0185289 3300048912 Bacteria 1956
298 Ga0496110_0024136 3300048913 Bacteria 5179
299 Ga0496110_0040610 3300048913 Bacteria 4055
300 Ga0496110_0099408 3300048913 Bacteria 2608
301 Ga0496110_0186186 3300048913 Bacteria 1885
302 Ga0496110_0909844 3300048913 Bacteria 786
303 Ga0496110_0982635 3300048913 Bacteria 751
304 Ga0496110_1071660 3300048913 Bacteria 714
305 Ga0496110_1088508 3300048913 Bacteria 707
306 Ga0496110_1313299 3300048913 Bacteria 633
307 Ga0496111_0036923 3300048914 Bacteria 3494
308 Ga0496111_0084125 3300048914 Bacteria 2325
309 Ga0496111_0145573 3300048914 Bacteria 1756
310 Ga0496112_0013473 3300048915 Bacteria 7549
311 Ga0496112_0153322 3300048915 Bacteria 2271
312 Ga0496112_0297779 3300048915 Bacteria 1559
313 Ga0496112_0410785 3300048915 Bacteria 1293
314 Ga0496112_0914934 3300048915 Bacteria 799
315 Ga0496113_0122059 3300048916 Bacteria 2038
316 Ga0496113_0160586 3300048916 Bacteria 1777
317 Ga0496113_0228826 3300048916 Bacteria 1482
318 Ga0496114_0000566 3300048917 Bacteria 27443
319 Ga0496114_0046016 3300048917 Bacteria 3625
320 Ga0496114_0085766 3300048917 Bacteria 2667
321 Ga0496114_0200888 3300048917 Bacteria 1746
322 Ga0496114_0389923 3300048917 Bacteria 1233
323 Ga0496115_0098572 3300048918 Bacteria 2394
324 Ga0496115_0460771 3300048918 Bacteria 1026
325 Ga0496115_0879427 3300048918 Bacteria 692
326 Ga0496119_0297084 3300048922 Bacteria 798
327 Ga0501031_0012377 3300049568 Bacteria 5563
328 Ga0501031_0331506 3300049568 Bacteria 985
329 Ga0501033_0288325 3300049570 Bacteria 1158
330 Ga0501033_0636928 3300049570 Bacteria 729
331 Ga0501036_0054026 3300049572 Bacteria 3401
332 Ga0501036_0104013 3300049572 Bacteria 2401
333 Ga0501036_0137014 3300049572 Bacteria 2066
334 Ga0501038_0005203 3300049574 Bacteria 12105
335 Ga0501038_0121733 3300049574 Bacteria 2151
336 Ga0501038_0342779 3300049574 Bacteria 1165
337 Ga0501039_0065253 3300049575 Bacteria 2824
338 Ga0501039_0101688 3300049575 Bacteria 2243
339 Ga0501040_0079502 3300049576 Bacteria 2270
340 Ga0501040_0095754 3300049576 Bacteria 2066
341 Ga0501040_0227537 3300049576 Bacteria 1328
342 Ga0501040_0593778 3300049576 Bacteria 800
343 Ga0501041_0072021 3300049577 Bacteria 2122
344 Ga0501041_0474697 3300049577 Bacteria 795
345 Ga0501042_0067288 3300049578 Bacteria 2561
346 Ga0501042_0101907 3300049578 Bacteria 2065
347 Ga0501042_0943682 3300049578 Bacteria 628
348 Ga0501048_0057081 3300049582 Bacteria 2769
349 Ga0501048_0986910 3300049582 Bacteria 606
350 Ga0501069_0780647 3300049585 Bacteria 578
351 Ga0501070_1496785 3300049586 Bacteria 511
352 Ga0501071_0010726 3300049587 Bacteria 6146
353 Ga0501071_0163629 3300049587 Bacteria 1664
354 Ga0501071_0237356 3300049587 Bacteria 1374
355 Ga0501071_0514405 3300049587 Bacteria 918
356 Ga0501071_0983490 3300049587 Bacteria 652
357 Ga0501072_0094836 3300049588 Bacteria 2371
358 Ga0501072_0512913 3300049588 Bacteria 948
359 Ga0501073_1269332 3300049589 Bacteria 505
360 Ga0501074_0006112 3300049590 Bacteria 8695
361 Ga0501075_0062946 3300049591 Bacteria 2797
362 Ga0501075_0141165 3300049591 Bacteria 1836
363 Ga0501075_0315529 3300049591 Bacteria 1191
364 Ga0501075_0400007 3300049591 Bacteria 1047
365 Ga0501076_0057135 3300049592 Bacteria 3098
366 Ga0501076_0175619 3300049592 Bacteria 1746
367 Ga0501076_0218412 3300049592 Bacteria 1558
368 Ga0501077_0151236 3300049593 Bacteria 1473
369 Ga0501253_178554 3300049683 Bacteria 551
370 Ga0501079_0094657 3300049741 Bacteria 2314
371 Ga0501079_0344843 3300049741 Bacteria 1167
372 Ga0501079_1350859 3300049741 Bacteria 561
373 Ga0501080_0688552 3300049742 Bacteria 902
374 Ga0501081_0007233 3300049743 Bacteria 7214
375 Ga0501081_0049844 3300049743 Bacteria 2884
376 Ga0501081_0237669 3300049743 Bacteria 1328
377 Ga0501083_0339794 3300049744 Bacteria 976
378 Ga0501035_0219643 3300049822 Bacteria 1623
379 Ga0501035_0420100 3300049822 Bacteria 1110
380 Ga0501035_0575688 3300049822 Bacteria 920
381 Ga0501044_0943731 3300049823 Bacteria 736
382 Ga0501044_1629626 3300049823 Bacteria 510
383 Ga0501045_0008148 3300049824 Bacteria 7299
384 Ga0501045_0306821 3300049824 Bacteria 1181
385 Ga0501045_0453525 3300049824 Bacteria 953
386 nmdc:mga03683_65281_c1 3300050489 Bacteria 1545
387 nmdc:mga03n38_19529_c1 3300050490 Bacteria 2695
388 nmdc:mga03n38_223131_c1 3300050490 Bacteria 985
389 nmdc:mga00v17_121246_c1 3300050491 Bacteria 1665
390 nmdc:mga00v17_46282_c1 3300050491 Bacteria 2632
391 nmdc:mga00v17_476105_c1 3300050491 Bacteria 810
392 nmdc:mga0yw44_1159028_c1 3300050492 Bacteria 522
393 nmdc:mga0yw44_208932_c1 3300050492 Bacteria 1291
394 nmdc:mga0yw44_721597_c1 3300050492 Bacteria 677
395 nmdc:mga06z11_272093_c1 3300050494 Bacteria 1002
396 nmdc:mga07m45_25810_c1 3300050496 Bacteria 3225
397 nmdc:mga05p37_111667_c1 3300050507 Bacteria 3361
398 nmdc:mga05p37_34380_c1 3300050507 Bacteria 6209
399 nmdc:mga05p37_771109_c1 3300050507 Bacteria 1057
400 nmdc:mga05p37_983367_c1 3300050507 Unclassified 899
401 nmdc:mga09592_161422_c1 3300050508 Bacteria 1936
402 nmdc:mga09592_459_c1 3300050508 Bacteria 30394
403 nmdc:mga0qj67_163421_c1 3300050509 Bacteria 1807
404 nmdc:mga0qj67_170819_c1 3300050509 Bacteria 1765
405 nmdc:mga0qj67_7711_c1 3300050509 Bacteria 7955
406 nmdc:mga06r32_1120_c1 3300050510 Bacteria 24028
407 nmdc:mga06r32_152_c1 3300050510 Bacteria 52842
408 nmdc:mga06r32_324519_c1 3300050510 Bacteria 1525
409 nmdc:mga06r32_377903_c1 3300050510 Bacteria 1400
410 nmdc:mga08y16_130202_c1 3300050511 Bacteria 2617
411 nmdc:mga08y16_823_c1 3300050511 Bacteria 29766
412 nmdc:mga0n895_1072588_c1 3300050512 Bacteria 784
413 nmdc:mga0n895_1168167_c1 3300050512 Bacteria 745
414 nmdc:mga0a205_235065_c1 3300050515 Bacteria 1715
415 nmdc:mga0a205_721442_c1 3300050515 Bacteria 846
416 Ga0495655_0007909 3300053083 Bacteria 1999
417 Ga0495619_0694366 3300053085 Bacteria 692
418 Ga0500616_0000491 3300053153 Bacteria 51066
419 Ga0501084_0030127 3300054114 Bacteria 4538
420 Ga0501084_0871580 3300054114 Bacteria 757
421 Ga0590071_034114 3300059421 Bacteria 1217
422 Ga0501082_0044270 3300060353 Bacteria 3839
423 Ga0501082_0054996 3300060353 Bacteria 3430
424 Ga0501082_0317468 3300060353 Bacteria 1357
425 Ga0530510_0009070 3300061734 Bacteria 6972
426 Ga0530510_0489163 3300061734 Bacteria 932
427 Ga0530510_0878506 3300061734 Bacteria 685
428 2548699164 2547132424 Bacteria 8348532
429 2739366304 2738543034 Bacteria 6084756
430 2819667721 2818991458 Bacteria 4794049
431 2819690994 2818991462 Bacteria 4320267
432 2919717119 2919713450 Bacteria 7431245
433 Ga0496100_0032836
434 JGI24738J21930_10050959
435 JGI25407J50210_10009333
436 JGI25405J52794_10004703
437 JGI25405J52794_10084350
438 Ga0070683_100003296
439 Ga0070683_100965506
440 Ga0070677_10000003
441 Ga0070677_10363290
442 Ga0068869_101242412
443 Ga0070680_100097203
444 Ga0070680_100368221
445 Ga0070682_100111463
446 Ga0070660_100338978
447 Ga0070689_101889764
448 Ga0070661_100266643
449 Ga0070674_100085941
450 Ga0070674_100660410
451 Ga0070673_101267440
452 Ga0070667_100923204
453 Ga0070714_100003431
454 Ga0070713_100051047
455 Ga0070713_100232847
456 Ga0070711_101471553
457 Ga0070700_100530583
458 Ga0070678_100021863
459 Ga0070678_100213281
460 Ga0070681_10012715
461 Ga0068867_101600348
462 Ga0070707_100030997
463 Ga0070698_100045824
464 Ga0070699_100017938
465 Ga0070699_100129268
466 Ga0070679_100002538
467 Ga0070686_100372302
468 Ga0070686_101097866
469 Ga0070695_100697094
470 Ga0070696_100077725
471 Ga0070696_100592457
472 Ga0070665_101290826
473 Ga0070665_101498879
474 Ga0070664_100058542
475 Ga0068857_100287890
476 Ga0068854_100240324
477 Ga0068854_101478750
478 Ga0068856_100267397
479 Ga0068856_101035936
480 Ga0070702_101016844
481 Ga0068870_11373325
482 Ga0068862_102494673
483 Ga0081455_10000030
484 Ga0081455_10000938
485 Ga0081455_10025001
486 Ga0081455_10114886
487 Ga0081455_10129088
488 Ga0081455_10217162
489 Ga0081538_10000591
490 Ga0081538_10016820
491 Ga0081538_10053877
492 Ga0081539_10131459
493 Ga0070717_10107551
494 Ga0075365_10184250
495 Ga0075365_10682804
496 Ga0075363_100013097
497 Ga0070712_100357577
498 Ga0070712_100616119
499 Ga0075367_10523102
500 Ga0075369_10097652
501 Ga0097621_100857413
502 Ga0075370_10552499
503 Ga0068871_102431219
504 Ga0075428_100005979
505 Ga0075428_100107952
506 Ga0075428_100543380
507 Ga0075428_101463139
508 Ga0075430_100047065
509 Ga0075430_100153265
510 Ga0075430_100215590
511 Ga0075431_100002333
512 Ga0075431_100012691
513 Ga0075431_100292176
514 Ga0075433_10134440
515 Ga0075434_101191559
516 Ga0075434_101547296
517 Ga0075429_100007915
518 Ga0068865_100326534
519 Ga0099794_10130907
520 Ga0099794_10153051
521 Ga0111539_10006276
522 Ga0111539_10166595
523 Ga0105245_10003599
524 Ga0105245_11644219
525 Ga0114129_10017779
526 Ga0114129_10149216
527 Ga0114129_10210152
528 Ga0114129_10287100
529 Ga0114129_10383147
530 Ga0114129_10503331
531 Ga0114129_11459069
532 Ga0105243_10111145
533 Ga0105243_11516529
534 Ga0105241_10039611
535 Ga0105241_11954486
536 Ga0105242_10378435
537 Ga0105242_10527120
538 Ga0105242_11803212
539 Ga0105238_10307514
540 Ga0105239_10737353
541 Ga0157369_10769736
542 Ga0163162_11850336
543 Ga0157375_10044869
544 Ga0157375_12732293
545 Ga0163163_11695584
546 Ga0157380_10988797
547 Ga0157380_11832840
548 Ga0157377_10135230
549 Ga0157377_11138821
550 Ga0157376_10460911
551 Ga0207653_10025751
552 Ga0207682_10000191
553 Ga0207688_10210772
554 Ga0207684_10020711
555 Ga0207684_10326749
556 Ga0207684_10476950
557 Ga0207684_11215569
558 Ga0207654_10029946
559 Ga0207707_10006781
560 Ga0207693_10684318
561 Ga0207663_10448447
562 Ga0207660_10086392
563 Ga0207660_10900396
564 Ga0207657_10185599
565 Ga0207649_10221820
566 Ga0207652_10024687
567 Ga0207646_10014399
568 Ga0207646_10079583
569 Ga0207687_10062183
570 Ga0207687_10431524
571 Ga0207700_10003517
572 Ga0207664_10008713
573 Ga0207664_10392213
574 Ga0207644_11245464
575 Ga0207706_11169600
576 Ga0207686_10103170
577 Ga0207686_10221076
578 Ga0207686_10370935
579 Ga0207709_10041631
580 Ga0207709_10849663
581 Ga0207669_10686304
582 Ga0207704_11155586
583 Ga0207691_10975347
584 Ga0207689_10627886
585 Ga0207661_10038383
586 Ga0207661_10204722
587 Ga0207661_11056438
588 Ga0207679_10118904
589 Ga0207640_10174005
590 Ga0207658_11076054
591 Ga0207677_10067118
592 Ga0207703_11072155
593 Ga0207702_10024624
594 Ga0207702_10078442
595 Ga0207641_11441432
596 Ga0207648_10268276
597 Ga0207674_10148548
598 Ga0207674_10185506
599 Ga0207675_100048407
600 Ga0207683_10013251
601 Ga0207683_10567006
602 Ga0207683_10713430
603 Ga0207683_11805529
604 Ga0207428_10003898
605 Ga0207428_10951576
606 Ga0307511_10089825
607 Ga0307408_100023516
608 Ga0307408_100253902
609 Ga0307408_100262789
610 Ga0307408_101043156
611 Ga0307405_11223942
612 Ga0307413_10071441
613 Ga0307413_11096840
614 Ga0307413_11299495
615 Ga0307410_10012585
616 Ga0307410_10054268
617 Ga0307410_10258840
618 Ga0307410_10408349
619 Ga0307410_11883914
620 Ga0307406_10164344
621 Ga0307407_10034267
622 Ga0307407_10167955
623 Ga0307407_10227768
624 Ga0307407_10399806
625 Ga0307407_10874096
626 Ga0307409_100015217
627 Ga0307409_100019906
628 Ga0307409_100264063
629 Ga0307409_100482834
630 Ga0307409_101542242
631 Ga0307416_100052424
632 Ga0307416_100063081
633 Ga0307416_100292046
634 Ga0307416_100364323
635 Ga0307414_10118175
636 Ga0307414_10373067
637 Ga0307414_10523147
638 Ga0307411_10103849
639 Ga0307415_100021285
640 Ga0307415_100118247
641 Ga0307415_100971922
642 Ga0307415_101582605
643 Ga0373948_0183052
644 Ga0373959_0125621
645 Ga0373945_0078708
646 Ga0373943_0157992
647 Ga0373927_0106813
648 Ga0373947_0033269
649 Ga0373937_0143829
650 Ga0373925_0018496
651 Ga0395900_0866562
652 Ga0436364_1368880
653 Ga0436365_0984841
654 Ga0451793_1659169
655 Ga0451800_0729196
656 Ga0451839_1237536
657 Ga0451853_2145756
658 Ga0439448_0088098
659 Ga0439450_000386
660 Ga0439463_003691
661 Ga0450920_118571
662 Ga0450893_0133188
663 Ga0439440_0004106
664 Ga0466969_0006734
665 Ga0466961_0229041
666 Ga0466964_0921702
667 Ga0466957_0643783
668 Ga0466958_0441986
669 Ga0466967_0393838
670 Ga0466967_0622369
671 Ga0466967_2057159
672 Ga0495603_0015735
673 Ga0495603_0553348
674 Ga0495639_0197448
675 Ga0495585_0183756
676 Ga0495607_0088875
677 Ga0495630_0232422
678 Ga0495630_0945582
679 Ga0495621_0049243
680 Ga0495667_0410871
681 Ga0495656_0193027
682 Ga0495613_0281892
683 Ga0495672_0288280
684 Ga0495676_0021650
685 Ga0495680_0493930
686 Ga0495683_0004816
687 Ga0495685_054848
688 Ga0495684_0134886
689 Ga0496100_0083330
690 Ga0496100_0209351
691 Ga0496100_0318425
692 Ga0496100_1317305
693 Ga0496101_0049173
694 Ga0496101_0264182
695 Ga0496101_0634785
696 Ga0496102_0002009
697 Ga0496102_0029439
698 Ga0496102_0080973
699 Ga0496102_0320064
700 Ga0496102_0548337
701 Ga0496102_0610021
702 Ga0496103_0043021
703 Ga0496103_0057478
704 Ga0496103_0936702
705 Ga0496104_0039691
706 Ga0496104_0124363
707 Ga0496104_0273281
708 Ga0496104_0574304
709 Ga0496104_0668072
710 Ga0496104_0784155
711 Ga0496104_0923225
712 Ga0496105_0030206
713 Ga0496105_0061213
714 Ga0496105_0079212
715 Ga0496105_0084855
716 Ga0496105_0091960
717 Ga0496105_0129758
718 Ga0496106_0019491
719 Ga0496106_0019912
720 Ga0496107_0020659
721 Ga0496107_0443026
722 Ga0496107_0967955
723 Ga0496108_0001266
724 Ga0496108_0004307
725 Ga0496108_0365786
726 Ga0496109_0001418
727 Ga0496109_0012706
728 Ga0496109_0156620
729 Ga0496109_0185289
730 Ga0496110_0024136
731 Ga0496110_0040610
732 Ga0496110_0099408
733 Ga0496110_0186186
734 Ga0496110_0909844
735 Ga0496110_0982635
736 Ga0496110_1071660
737 Ga0496110_1088508
738 Ga0496110_1313299
739 Ga0496111_0036923
740 Ga0496111_0084125
741 Ga0496111_0145573
742 Ga0496112_0013473
743 Ga0496112_0153322
744 Ga0496112_0297779
745 Ga0496112_0410785
746 Ga0496112_0914934
747 Ga0496113_0122059
748 Ga0496113_0160586
749 Ga0496113_0228826
750 Ga0496114_0000566
751 Ga0496114_0046016
752 Ga0496114_0085766
753 Ga0496114_0200888
754 Ga0496114_0389923
755 Ga0496115_0098572
756 Ga0496115_0460771
757 Ga0496115_0879427
758 Ga0496119_0297084
759 Ga0501031_0012377
760 Ga0501031_0331506
761 Ga0501033_0288325
762 Ga0501033_0636928
763 Ga0501036_0054026
764 Ga0501036_0104013
765 Ga0501036_0137014
766 Ga0501038_0005203
767 Ga0501038_0121733
768 Ga0501038_0342779
769 Ga0501039_0065253
770 Ga0501039_0101688
771 Ga0501040_0079502
772 Ga0501040_0095754
773 Ga0501040_0227537
774 Ga0501040_0593778
775 Ga0501041_0072021
776 Ga0501041_0474697
777 Ga0501042_0067288
778 Ga0501042_0101907
779 Ga0501042_0943682
780 Ga0501048_0057081
781 Ga0501048_0986910
782 Ga0501069_0780647
783 Ga0501070_1496785
784 Ga0501071_0010726
785 Ga0501071_0163629
786 Ga0501071_0237356
787 Ga0501071_0514405
788 Ga0501071_0983490
789 Ga0501072_0094836
790 Ga0501072_0512913
791 Ga0501073_1269332
792 Ga0501074_0006112
793 Ga0501075_0062946
794 Ga0501075_0141165
795 Ga0501075_0315529
796 Ga0501075_0400007
797 Ga0501076_0057135
798 Ga0501076_0175619
799 Ga0501076_0218412
800 Ga0501077_0151236
801 Ga0501253_178554
802 Ga0501079_0094657
803 Ga0501079_0344843
804 Ga0501079_1350859
805 Ga0501080_0688552
806 Ga0501081_0007233
807 Ga0501081_0049844
808 Ga0501081_0237669
809 Ga0501083_0339794
810 Ga0501035_0219643
811 Ga0501035_0420100
812 Ga0501035_0575688
813 Ga0501044_0943731
814 Ga0501044_1629626
815 Ga0501045_0008148
816 Ga0501045_0306821
817 Ga0501045_0453525
818 nmdc:mga03683_65281_c1
819 nmdc:mga03n38_19529_c1
820 nmdc:mga03n38_223131_c1
821 nmdc:mga00v17_121246_c1
822 nmdc:mga00v17_46282_c1
823 nmdc:mga00v17_476105_c1
824 nmdc:mga0yw44_1159028_c1
825 nmdc:mga0yw44_208932_c1
826 nmdc:mga0yw44_721597_c1
827 nmdc:mga06z11_272093_c1
828 nmdc:mga07m45_25810_c1
829 nmdc:mga05p37_111667_c1
830 nmdc:mga05p37_34380_c1
831 nmdc:mga05p37_771109_c1
832 nmdc:mga05p37_983367_c1
833 nmdc:mga09592_161422_c1
834 nmdc:mga09592_459_c1
835 nmdc:mga0qj67_163421_c1
836 nmdc:mga0qj67_170819_c1
837 nmdc:mga0qj67_7711_c1
838 nmdc:mga06r32_1120_c1
839 nmdc:mga06r32_152_c1
840 nmdc:mga06r32_324519_c1
841 nmdc:mga06r32_377903_c1
842 nmdc:mga08y16_130202_c1
843 nmdc:mga08y16_823_c1
844 nmdc:mga0n895_1072588_c1
845 nmdc:mga0n895_1168167_c1
846 nmdc:mga0a205_235065_c1
847 nmdc:mga0a205_721442_c1
848 Ga0495655_0007909
849 Ga0495619_0694366
850 Ga0500616_0000491
851 Ga0501084_0030127
852 Ga0501084_0871580
853 Ga0590071_034114
854 Ga0501082_0044270
855 Ga0501082_0054996
856 Ga0501082_0317468
857 Ga0530510_0009070
858 Ga0530510_0489163
859 Ga0530510_0878506
860 2548699164
861 2739366304
862 2819667721
863 2819690994
864 2919717119

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19581

Glyoxalase_7

Glyoxalase superfamily protein

3

121

0.84

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

4

116

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8885 2 112
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.8765 4 112
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8597 2 112
5umq-assembly1.cif.gz_A crystal structure of tnms1, an antibiotic binding protein from streptomyces sp. cb03234 0.859 1 112
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8474 2 112
ID Description Score Start End Superfamily
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8751 4 113 3.10.180.10
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8324 4 113 3.10.180.10
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8153 4 112 3.10.180.10
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8088 1 112 3.10.180.10
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7965 1 112 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A0Q9UH98-F1-model_v4 Glyoxalase 0.9928 1 112
AF-A0A4P7GJC6-F1-model_v4 Glyoxalase 0.99 1 112
AF-A0A222VX54-F1-model_v4 Uncharacterized protein 0.9884 1 112
AF-A0A7V9DV65-F1-model_v4 VOC family protein 0.9877 1 111
AF-A0A3A5MHH8-F1-model_v4 Glyoxalase 0.987 1 112

Map