F442629

General Info

Members Datasets Scaffolds Average Seq Length
432 273 864 134

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10059638|Ga0265338_100596382
Length 152
Sequence VVIAPNVVEQPGSRLGETRAVLGHLGINVADLTAAKAYYREIMPLVDFETFIDADDEIAFMPAGGKPGTYLFIYPAAEPGDFSRHRAGLQHLAFMVRSRSAVHAVHDRAVELGSEVLYPPREFPQYPPPYFATFWLDPFGFMLEAVCHHDRD

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
181 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
182 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
183 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
184 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
185 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
186 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
187 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
188 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
189 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
190 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
201 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
222 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
223 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
224 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
225 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
226 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
227 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
241 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
242 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
243 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
244 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
245 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
252 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
253 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
254 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
257 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
258 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
259 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
260 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
261 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
262 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
263 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
264 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
265 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
266 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
267 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
268 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
269 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
270 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
271 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
272 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
273 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.38
Metatranscriptomes 0
Isolates 1.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.97
Nodule 0
Rhizoplane 9.26
Rhizosphere 68.06
Stem 0
Stem Tuber 0
Unclassified 3.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10059638 3300028800 Bacteria 3361
2 JGI24749J21850_1008636 3300002076 Bacteria 1421
3 JGI24744J21845_10004030 3300002077 Bacteria 3032
4 JGI25406J46586_10026821 3300003203 Bacteria 2216
5 rootH2_10102316 3300003320 Bacteria 3278
6 Ga0055540_1000029 3300003792 Bacteria 179894
7 Ga0070676_10154900 3300005328 Bacteria 1470
8 Ga0070670_100517962 3300005331 Bacteria 1062
9 Ga0070677_10308719 3300005333 Bacteria 806
10 Ga0068869_100030655 3300005334 Bacteria 3778
11 Ga0070666_10254353 3300005335 Bacteria 1244
12 Ga0070666_10385055 3300005335 Bacteria 1007
13 Ga0070682_100011688 3300005337 Bacteria 5019
14 Ga0070682_100925165 3300005337 Bacteria 718
15 Ga0068868_100000475 3300005338 Bacteria 26635
16 Ga0068868_101734718 3300005338 Bacteria 589
17 Ga0070660_100122145 3300005339 Bacteria 2079
18 Ga0070689_100017811 3300005340 Bacteria 5223
19 Ga0070691_10029439 3300005341 Bacteria 2568
20 Ga0070692_10175384 3300005345 Bacteria 1239
21 Ga0070668_100000708 3300005347 Bacteria 22819
22 Ga0070668_100128189 3300005347 Bacteria 2034
23 Ga0070668_100923930 3300005347 Bacteria 781
24 Ga0070669_100027201 3300005353 Bacteria 4117
25 Ga0070675_100109748 3300005354 Bacteria 2332
26 Ga0070671_100003661 3300005355 Bacteria 12042
27 Ga0070671_100319528 3300005355 Bacteria 1323
28 Ga0070674_100002208 3300005356 Bacteria 10706
29 Ga0070688_100014391 3300005365 Bacteria 4481
30 Ga0070659_100114532 3300005366 Bacteria 2179
31 Ga0070667_100009379 3300005367 Bacteria 8116
32 Ga0070667_100141614 3300005367 Bacteria 2106
33 Ga0070709_10310276 3300005434 Bacteria 1154
34 Ga0070709_10552902 3300005434 Bacteria 881
35 Ga0070714_100040836 3300005435 Bacteria 3911
36 Ga0070714_100791465 3300005435 Bacteria 918
37 Ga0070713_100988318 3300005436 Bacteria 812
38 Ga0070710_10008652 3300005437 Bacteria 4958
39 Ga0070710_10158002 3300005437 Bacteria 1403
40 Ga0070701_10012137 3300005438 Bacteria 3876
41 Ga0070711_100001775 3300005439 Bacteria 11999
42 Ga0070705_100004674 3300005440 Bacteria 6667
43 Ga0070705_101234951 3300005440 Unclassified 617
44 Ga0070700_100001939 3300005441 Bacteria 10477
45 Ga0070694_100012613 3300005444 Bacteria 5260
46 Ga0070663_101496171 3300005455 Bacteria 600
47 Ga0070678_100003506 3300005456 Bacteria 8747
48 Ga0070662_100274746 3300005457 Bacteria 1362
49 Ga0068867_100014399 3300005459 Bacteria 5604
50 Ga0070685_10128992 3300005466 Bacteria 1579
51 Ga0070706_101059665 3300005467 Bacteria 747
52 Ga0068853_100076529 3300005539 Bacteria 2922
53 Ga0070672_100258370 3300005543 Bacteria 1468
54 Ga0070686_100348025 3300005544 Bacteria 1113
55 Ga0070695_100027858 3300005545 Bacteria 3503
56 Ga0070696_100011722 3300005546 Bacteria 5875
57 Ga0070665_100014158 3300005548 Bacteria 8014
58 Ga0070665_100077595 3300005548 Bacteria 3328
59 Ga0070704_100000400 3300005549 Bacteria 19972
60 Ga0068855_100059207 3300005563 Bacteria 4482
61 Ga0068854_100005697 3300005578 Bacteria 7872
62 Ga0068854_100415074 3300005578 Bacteria 1117
63 Ga0070702_100023761 3300005615 Bacteria 3261
64 Ga0068852_100095456 3300005616 Bacteria 2670
65 Ga0068852_101308783 3300005616 Bacteria 746
66 Ga0068859_100011397 3300005617 Bacteria 8939
67 Ga0068859_100452799 3300005617 Bacteria 1380
68 Ga0068864_100336257 3300005618 Bacteria 1422
69 Ga0068866_10002234 3300005718 Bacteria 8031
70 Ga0068866_10394582 3300005718 Bacteria 891
71 Ga0068861_100016026 3300005719 Bacteria 5293
72 Ga0068861_101074559 3300005719 Bacteria 772
73 Ga0068863_100016400 3300005841 Bacteria 7106
74 Ga0068858_100021885 3300005842 Bacteria 5971
75 Ga0068858_100088621 3300005842 Bacteria 2879
76 Ga0068858_101043086 3300005842 Bacteria 802
77 Ga0068860_100000645 3300005843 Bacteria 40756
78 Ga0068860_100317158 3300005843 Bacteria 1529
79 Ga0068860_100994838 3300005843 Bacteria 856
80 Ga0068862_100010570 3300005844 Bacteria 7628
81 Ga0068862_100340579 3300005844 Bacteria 1389
82 Ga0081455_10047215 3300005937 Bacteria 3731
83 Ga0081538_10319527 3300005981 Unclassified 566
84 Ga0081540_1079580 3300005983 Unclassified 1481
85 Ga0081539_10000027 3300005985 Bacteria 328691
86 Ga0075365_10021942 3300006038 Bacteria 3992
87 Ga0075363_100007921 3300006048 Bacteria 4920
88 Ga0075363_100071887 3300006048 Bacteria 1881
89 Ga0075363_100073401 3300006048 Bacteria 1861
90 Ga0075363_100101647 3300006048 Bacteria 1591
91 Ga0075364_10004036 3300006051 Bacteria 8426
92 Ga0075364_10049079 3300006051 Bacteria 2752
93 Ga0075364_10110397 3300006051 Bacteria 1835
94 Ga0075364_10119582 3300006051 Bacteria 1763
95 Ga0075364_10360220 3300006051 Bacteria 992
96 Ga0070715_10006362 3300006163 Bacteria 4012
97 Ga0070716_100071147 3300006173 Bacteria 2044
98 Ga0070712_100036625 3300006175 Bacteria 3340
99 Ga0070712_100745807 3300006175 Bacteria 837
100 Ga0075362_10032823 3300006177 Bacteria 2256
101 Ga0075362_10047076 3300006177 Bacteria 1920
102 Ga0075362_10054997 3300006177 Bacteria 1790
103 Ga0075367_10064336 3300006178 Bacteria 2194
104 Ga0075367_10451774 3300006178 Bacteria 814
105 Ga0075369_10004775 3300006186 Bacteria 5036
106 Ga0075369_10010066 3300006186 Bacteria 3693
107 Ga0075369_10036587 3300006186 Bacteria 2089
108 Ga0075369_10049896 3300006186 Bacteria 1808
109 Ga0097621_100064653 3300006237 Bacteria 3009
110 Ga0075370_10025450 3300006353 Bacteria 3274
111 Ga0075370_10030842 3300006353 Bacteria 2992
112 Ga0075370_10171083 3300006353 Bacteria 1277
113 Ga0075370_10227313 3300006353 Bacteria 1104
114 Ga0075370_10276283 3300006353 Bacteria 998
115 Ga0068871_100386926 3300006358 Bacteria 1243
116 Ga0075428_100126792 3300006844 Bacteria 2777
117 Ga0075428_100141368 3300006844 Bacteria 2617
118 Ga0075428_100596773 3300006844 Bacteria 1180
119 Ga0075430_100285047 3300006846 Unclassified 1367
120 Ga0075431_100076849 3300006847 Bacteria 3446
121 Ga0075431_100235623 3300006847 Bacteria 1864
122 Ga0075431_101142655 3300006847 Unclassified 743
123 Ga0075429_100246989 3300006880 Bacteria 1563
124 Ga0068865_100004304 3300006881 Bacteria 8595
125 Ga0097620_100011396 3300006931 Bacteria 8939
126 Ga0097620_100452773 3300006931 Bacteria 1380
127 Ga0105250_10093671 3300009092 Bacteria 1223
128 Ga0111539_10002142 3300009094 Bacteria 26411
129 Ga0111539_10703641 3300009094 Bacteria 1176
130 Ga0105245_10005217 3300009098 Bacteria 11413
131 Ga0105245_10179677 3300009098 Bacteria 2021
132 Ga0105247_10000092 3300009101 Bacteria 97046
133 Ga0105243_10001368 3300009148 Bacteria 21590
134 Ga0105241_10040302 3300009174 Bacteria 3526
135 Ga0105241_12313876 3300009174 Bacteria 535
136 Ga0105242_10005767 3300009176 Bacteria 9545
137 Ga0105248_10057426 3300009177 Bacteria 4368
138 Ga0105248_10295178 3300009177 Bacteria 1825
139 Ga0105237_10217595 3300009545 Bacteria 1910
140 Ga0105238_10199632 3300009551 Bacteria 1975
141 Ga0105249_10016637 3300009553 Bacteria 6528
142 Ga0105249_10239284 3300009553 Bacteria 1794
143 Ga0105249_10505271 3300009553 Bacteria 1254
144 Ga0099796_10144101 3300010159 Bacteria 933
145 Ga0105239_10045899 3300010375 Bacteria 4788
146 Ga0105239_10070362 3300010375 Bacteria 3843
147 Ga0105239_10146068 3300010375 Bacteria 2638
148 Ga0105239_10502609 3300010375 Bacteria 1378
149 Ga0105246_12278878 3300011119 Bacteria 529
150 Ga0157369_11196850 3300013105 Bacteria 776
151 Ga0157374_10085852 3300013296 Bacteria 2993
152 Ga0157374_10638537 3300013296 Bacteria 1076
153 Ga0157378_10002221 3300013297 Bacteria 17211
154 Ga0163162_10025877 3300013306 Bacteria 5799
155 Ga0163162_10173867 3300013306 Bacteria 2278
156 Ga0163162_10408451 3300013306 Bacteria 1490
157 Ga0163162_10523230 3300013306 Bacteria 1315
158 Ga0157372_10010129 3300013307 Bacteria 10014
159 Ga0157375_10009848 3300013308 Bacteria 8404
160 Ga0163163_10170463 3300014325 Bacteria 2223
161 Ga0163163_11594963 3300014325 Bacteria 714
162 Ga0157380_10000210 3300014326 Bacteria 34429
163 Ga0157377_10099173 3300014745 Bacteria 1732
164 Ga0157379_10145792 3300014968 Bacteria 2135
165 Ga0157379_10332189 3300014968 Bacteria 1389
166 Ga0157376_10221410 3300014969 Bacteria 1753
167 Ga0163161_10000918 3300017792 Bacteria 22741
168 Ga0163161_10651895 3300017792 Bacteria 872
169 Ga0213876_10000676 3300021384 Bacteria 24257
170 Ga0209673_1049307 3300025273 Bacteria 1127
171 Ga0209051_1000042 3300025303 Bacteria 308486
172 Ga0207682_10302199 3300025893 Bacteria 750
173 Ga0207692_10001048 3300025898 Bacteria 10100
174 Ga0207642_10000334 3300025899 Bacteria 14102
175 Ga0207710_10006295 3300025900 Bacteria 5077
176 Ga0207688_10014156 3300025901 Bacteria 4338
177 Ga0207680_10011114 3300025903 Bacteria 4535
178 Ga0207680_10062532 3300025903 Bacteria 2275
179 Ga0207680_10335038 3300025903 Bacteria 1060
180 Ga0207685_10001232 3300025905 Bacteria 5206
181 Ga0207699_10244481 3300025906 Bacteria 1234
182 Ga0207645_10152239 3300025907 Bacteria 1510
183 Ga0207684_10640607 3300025910 Bacteria 906
184 Ga0207654_10026827 3300025911 Bacteria 3124
185 Ga0207671_10801406 3300025914 Bacteria 747
186 Ga0207693_10012578 3300025915 Bacteria 6837
187 Ga0207693_10463216 3300025915 Bacteria 990
188 Ga0207662_10079139 3300025918 Bacteria 2002
189 Ga0207657_10046311 3300025919 Bacteria 3810
190 Ga0207646_10033984 3300025922 Bacteria 4609
191 Ga0207681_10009751 3300025923 Bacteria 5875
192 Ga0207694_10355218 3300025924 Bacteria 1214
193 Ga0207650_10168974 3300025925 Bacteria 1737
194 Ga0207687_10000656 3300025927 Bacteria 23279
195 Ga0207687_10112082 3300025927 Bacteria 2026
196 Ga0207700_10772551 3300025928 Bacteria 859
197 Ga0207700_11268665 3300025928 Bacteria 657
198 Ga0207664_10015437 3300025929 Bacteria 5545
199 Ga0207664_10689397 3300025929 Bacteria 919
200 Ga0207664_11172914 3300025929 Bacteria 685
201 Ga0207644_10009530 3300025931 Bacteria 6378
202 Ga0207644_10146487 3300025931 Bacteria 1823
203 Ga0207644_10903075 3300025931 Bacteria 740
204 Ga0207690_10050913 3300025932 Bacteria 2767
205 Ga0207706_10003241 3300025933 Bacteria 15596
206 Ga0207686_10001101 3300025934 Bacteria 15808
207 Ga0207709_10002483 3300025935 Bacteria 11557
208 Ga0207670_10028929 3300025936 Bacteria 3524
209 Ga0207669_10000872 3300025937 Bacteria 12802
210 Ga0207704_10003153 3300025938 Bacteria 7455
211 Ga0207665_10001495 3300025939 Bacteria 15707
212 Ga0207691_10028534 3300025940 Bacteria 5224
213 Ga0207711_10675538 3300025941 Bacteria 963
214 Ga0207689_10031150 3300025942 Bacteria 4443
215 Ga0207667_10268074 3300025949 Bacteria 1746
216 Ga0207712_10003694 3300025961 Bacteria 9654
217 Ga0207712_10488850 3300025961 Bacteria 1050
218 Ga0207668_10000999 3300025972 Bacteria 16935
219 Ga0207668_10002069 3300025972 Bacteria 11692
220 Ga0207668_11418139 3300025972 Bacteria 626
221 Ga0207640_10006987 3300025981 Bacteria 6211
222 Ga0207658_10030408 3300025986 Bacteria 3822
223 Ga0207658_10112813 3300025986 Bacteria 2152
224 Ga0207658_10969052 3300025986 Bacteria 775
225 Ga0207677_10003834 3300026023 Bacteria 7999
226 Ga0207677_11418277 3300026023 Bacteria 640
227 Ga0207703_10330191 3300026035 Bacteria 1399
228 Ga0207639_10002677 3300026041 Bacteria 11961
229 Ga0207678_10877398 3300026067 Unclassified 793
230 Ga0207708_10018564 3300026075 Bacteria 5238
231 Ga0207708_10260390 3300026075 Bacteria 1400
232 Ga0207702_10139474 3300026078 Bacteria 2192
233 Ga0207641_10011872 3300026088 Bacteria 7146
234 Ga0207641_10115469 3300026088 Bacteria 2387
235 Ga0207648_10034614 3300026089 Bacteria 4452
236 Ga0207675_100001486 3300026118 Bacteria 23523
237 Ga0207675_100699114 3300026118 Bacteria 1023
238 Ga0207683_10018568 3300026121 Bacteria 5935
239 Ga0207698_10218815 3300026142 Bacteria 1719
240 Ga0207428_10125676 3300027907 Bacteria 1964
241 Ga0268266_10009018 3300028379 Bacteria 8818
242 Ga0268266_10095860 3300028379 Bacteria 2606
243 Ga0268265_10015226 3300028380 Bacteria 5258
244 Ga0268265_12721248 3300028380 Bacteria 500
245 Ga0268264_10002434 3300028381 Bacteria 16367
246 Ga0268264_10278423 3300028381 Bacteria 1566
247 Ga0268264_12227042 3300028381 Bacteria 556
248 Ga0307512_10048501 3300030522 Bacteria 3438
249 Ga0265327_10001572 3300031251 Bacteria 27891
250 Ga0265327_10091190 3300031251 Bacteria 1486
251 Ga0307509_10127034 3300031507 Bacteria 2514
252 Ga0307413_10093876 3300031824 Bacteria 1962
253 Ga0307410_10116950 3300031852 Bacteria 1938
254 Ga0307410_10305947 3300031852 Bacteria 1256
255 Ga0307410_10345545 3300031852 Bacteria 1187
256 Ga0307406_11047824 3300031901 Bacteria 702
257 Ga0307407_10347716 3300031903 Bacteria 1049
258 Ga0307412_10484184 3300031911 Bacteria 1027
259 Ga0307409_100260073 3300031995 Bacteria 1592
260 Ga0307409_101854235 3300031995 Bacteria 632
261 Ga0307416_100084926 3300032002 Bacteria 2692
262 Ga0307416_100841667 3300032002 Bacteria 1015
263 Ga0307416_102345635 3300032002 Unclassified 634
264 Ga0307414_10222320 3300032004 Bacteria 1551
265 Ga0307411_10166242 3300032005 Bacteria 1659
266 Ga0307415_100011624 3300032126 Bacteria 5049
267 Ga0307415_100404085 3300032126 Bacteria 1167
268 Ga0307415_100447601 3300032126 Bacteria 1116
269 Ga0307415_101338557 3300032126 Bacteria 680
270 Ga0395901_0248026 3300038443 Bacteria 1856
271 Ga0436365_1257400 3300039437 Bacteria 59519
272 Ga0439461_0000575 3300041410 Bacteria 5327
273 Ga0439461_0110781 3300041410 Bacteria 677
274 Ga0439466_0029333 3300041411 Bacteria 1893
275 Ga0439465_0003099 3300041413 Bacteria 5438
276 Ga0439465_0005192 3300041413 Bacteria 4176
277 Ga0451791_1016878 3300041451 Bacteria 573
278 Ga0451791_1075183 3300041451 Bacteria 596
279 Ga0439442_007547 3300042002 Bacteria 2188
280 Ga0466969_0125508 3300044656 Bacteria 1192
281 Ga0466972_0175493 3300044658 Bacteria 1005
282 Ga0466972_0308561 3300044658 Bacteria 739
283 Ga0466965_0418827 3300044683 Bacteria 742
284 Ga0466961_0043246 3300044693 Bacteria 2886
285 Ga0466968_0046900 3300044735 Bacteria 1836
286 Ga0466970_0175601 3300044765 Bacteria 1188
287 Ga0466957_0086146 3300044842 Bacteria 1963
288 Ga0466957_0363518 3300044842 Bacteria 984
289 Ga0466960_0028964 3300044901 Bacteria 2538
290 Ga0466960_0669488 3300044901 Bacteria 621
291 Ga0466960_0672585 3300044901 Bacteria 619
292 Ga0466959_0088476 3300045049 Bacteria 2226
293 Ga0466967_0016512 3300045976 Bacteria 5826
294 Ga0466967_0647495 3300045976 Bacteria 1045
295 Ga0495638_0031418 3300046460 Bacteria 3413
296 Ga0495638_0079476 3300046460 Bacteria 1994
297 Ga0495583_0249467 3300046506 Bacteria 712
298 Ga0495667_0220588 3300046559 Bacteria 1210
299 Ga0495668_0117148 3300046616 Bacteria 1457
300 Ga0495625_0262255 3300046660 Bacteria 1118
301 Ga0495657_0313361 3300046675 Unclassified 934
302 Ga0495672_0020772 3300047320 Bacteria 4296
303 Ga0495672_0204366 3300047320 Bacteria 986
304 Ga0495672_0369229 3300047320 Unclassified 662
305 Ga0495680_0168412 3300047322 Bacteria 1587
306 Ga0495687_240945 3300047443 Bacteria 546
307 Ga0495602_0550571 3300048088 Bacteria 800
308 Ga0496100_0000025 3300048903 Bacteria 115919
309 Ga0496100_0001830 3300048903 Bacteria 10629
310 Ga0496100_0019256 3300048903 Bacteria 4068
311 Ga0496100_0582253 3300048903 Bacteria 868
312 Ga0496101_0000021 3300048904 Bacteria 217090
313 Ga0496101_0000068 3300048904 Bacteria 120985
314 Ga0496101_0076692 3300048904 Bacteria 2462
315 Ga0496101_0119621 3300048904 Bacteria 1990
316 Ga0496102_0001215 3300048905 Bacteria 23363
317 Ga0496102_0003564 3300048905 Bacteria 13190
318 Ga0496102_0010116 3300048905 Bacteria 8113
319 Ga0496102_0019976 3300048905 Bacteria 5910
320 Ga0496102_0759421 3300048905 Bacteria 892
321 Ga0496103_0000193 3300048906 Bacteria 60690
322 Ga0496103_0001243 3300048906 Bacteria 17397
323 Ga0496103_0047227 3300048906 Bacteria 2660
324 Ga0496104_0034729 3300048907 Bacteria 4703
325 Ga0496105_0022097 3300048908 Bacteria 5152
326 Ga0496106_0002879 3300048909 Bacteria 12787
327 Ga0496106_0730104 3300048909 Bacteria 788
328 Ga0496106_1003835 3300048909 Bacteria 656
329 Ga0496107_0000251 3300048910 Bacteria 28328
330 Ga0496107_0000326 3300048910 Bacteria 25726
331 Ga0496108_0090431 3300048911 Bacteria 2602
332 Ga0496108_0127245 3300048911 Bacteria 2188
333 Ga0496108_0145853 3300048911 Bacteria 2040
334 Ga0496109_0003398 3300048912 Bacteria 13319
335 Ga0496109_0115831 3300048912 Bacteria 2494
336 Ga0496110_0000237 3300048913 Bacteria 35702
337 Ga0496110_0003140 3300048913 Bacteria 12553
338 Ga0496111_0002140 3300048914 Bacteria 11810
339 Ga0496111_0056290 3300048914 Bacteria 2845
340 Ga0496112_0051271 3300048915 Bacteria 4047
341 Ga0496113_0569825 3300048916 Bacteria 908
342 Ga0496114_0005164 3300048917 Bacteria 10188
343 Ga0496114_0017757 3300048917 Bacteria 5749
344 Ga0496115_0025730 3300048918 Bacteria 4586
345 Ga0496115_0137712 3300048918 Bacteria 2013
346 Ga0496116_0001613 3300048919 Bacteria 24807
347 Ga0496118_0040900 3300048921 Bacteria 3677
348 Ga0496118_0199025 3300048921 Bacteria 1189
349 Ga0496118_0299862 3300048921 Bacteria 883
350 Ga0496119_0011805 3300048922 Bacteria 7176
351 Ga0496119_0288894 3300048922 Bacteria 812
352 Ga0496120_0095607 3300048923 Bacteria 1579
353 Ga0496120_0243798 3300048923 Bacteria 847
354 Ga0496121_0000023 3300048924 Bacteria 463448
355 Ga0496121_0000809 3300048924 Bacteria 56983
356 Ga0496121_0716023 3300048924 Bacteria 600
357 Ga0496122_0000038 3300048925 Bacteria 295624
358 Ga0496123_0006864 3300048926 Bacteria 10903
359 Ga0496124_0000014 3300048927 Bacteria 463448
360 Ga0496125_0000020 3300048928 Bacteria 463448
361 Ga0496126_0000023 3300048929 Bacteria 463448
362 Ga0496126_0014985 3300048929 Bacteria 7817
363 Ga0496126_0091558 3300048929 Bacteria 2673
364 Ga0501031_0812730 3300049568 Unclassified 599
365 Ga0501032_0065542 3300049569 Bacteria 2429
366 Ga0501033_0048430 3300049570 Bacteria 3157
367 Ga0501034_0014420 3300049571 Bacteria 8140
368 Ga0501036_0781017 3300049572 Unclassified 787
369 Ga0501046_1040000 3300049580 Unclassified 567
370 Ga0501047_0004151 3300049581 Bacteria 13629
371 Ga0501047_0825357 3300049581 Bacteria 741
372 Ga0501035_0001733 3300049822 Bacteria 22043
373 Ga0501044_0001124 3300049823 Bacteria 31772
374 nmdc:mga03683_120059_c1 3300050489 Bacteria 1168
375 nmdc:mga03683_13986_c1 3300050489 Bacteria 2961
376 nmdc:mga03n38_134599_c1 3300050490 Bacteria 1228
377 nmdc:mga03n38_14801_c1 3300050490 Bacteria 2999
378 nmdc:mga03n38_16871_c1 3300050490 Bacteria 2849
379 nmdc:mga03n38_331421_c1 3300050490 Bacteria 824
380 nmdc:mga03n38_7280_c1 3300050490 Bacteria 3909
381 nmdc:mga03n38_918329_c1 3300050490 Bacteria 515
382 nmdc:mga00v17_133787_c1 3300050491 Bacteria 1586
383 nmdc:mga00v17_16179_c1 3300050491 Bacteria 4203
384 nmdc:mga00v17_19239_c1 3300050491 Bacteria 3896
385 nmdc:mga00v17_197629_c1 3300050491 Bacteria 1299
386 nmdc:mga00v17_230587_c1 3300050491 Bacteria 1199
387 nmdc:mga00v17_235087_c1 3300050491 Bacteria 1188
388 nmdc:mga00v17_445627_c1 3300050491 Bacteria 841
389 nmdc:mga0yw44_289967_c1 3300050492 Bacteria 1095
390 nmdc:mga0yw44_34802_c1 3300050492 Bacteria 2954
391 nmdc:mga06z11_1019577_c1 3300050494 Bacteria 504
392 nmdc:mga06z11_174542_c1 3300050494 Bacteria 1236
393 nmdc:mga06z11_42269_c1 3300050494 Bacteria 2285
394 nmdc:mga07m45_132580_c1 3300050496 Bacteria 1442
395 nmdc:mga07m45_195976_c1 3300050496 Bacteria 1175
396 nmdc:mga07m45_59077_c1 3300050496 Bacteria 2169
397 nmdc:mga07m45_75394_c1 3300050496 Bacteria 1922
398 nmdc:mga05p37_175886_c1 3300050507 Bacteria 2608
399 nmdc:mga05p37_182525_c1 3300050507 Bacteria 2552
400 nmdc:mga0qj67_923918_c1 3300050509 Unclassified 687
401 nmdc:mga06r32_203483_c1 3300050510 Bacteria 1967
402 nmdc:mga06r32_683005_c1 3300050510 Bacteria 993
403 nmdc:mga08y16_138031_c1 3300050511 Bacteria 2535
404 nmdc:mga0n895_781417_c1 3300050512 Unclassified 946
405 nmdc:mga0sz30_10188_c1 3300050516 Bacteria 3596
406 nmdc:mga0sz30_157311_c2 3300050516 Bacteria 669
407 nmdc:mga0sz30_52693_c1 3300050516 Bacteria 1728
408 nmdc:mga0sz30_709_c1 3300050516 Bacteria 12251
409 Ga0500610_0001482 3300053079 Bacteria 8024
410 Ga0500635_0001842 3300053080 Bacteria 5181
411 Ga0500635_0055245 3300053080 Bacteria 1371
412 Ga0495655_0064240 3300053083 Bacteria 1010
413 Ga0495619_0315388 3300053085 Bacteria 1083
414 Ga0500643_005687 3300053087 Bacteria 5324
415 Ga0500556_0003872 3300053104 Bacteria 4332
416 Ga0500562_003721 3300053108 Bacteria 3836
417 Ga0500608_366357 3300053122 Bacteria 504
418 Ga0500652_001059 3300053131 Bacteria 8932
419 Ga0500652_083959 3300053131 Bacteria 1328
420 Ga0500658_0240842 3300053134 Bacteria 831
421 Ga0500559_0494278 3300053136 Bacteria 562
422 Ga0500616_0044081 3300053153 Bacteria 2381
423 Ga0500627_0057585 3300053158 Bacteria 1705
424 Ga0500656_032045 3300053732 Bacteria 703
425 Ga0466962_0150286 3300061719 Bacteria 1130
426 2738666686 2738541264 Bacteria 5935393
427 2738702998 2738541274 Bacteria 6909446
428 2739145530 2738541356 Bacteria 5935017
429 2739333823 2738543028 Bacteria 6917070
430 2744955361 2744054611 Bacteria 5611514
431 2902810989 2902810491 Bacteria 6794147
432 3003003863 3002998708 Bacteria 11715108
433 Ga0265338_10059638
434 JGI24749J21850_1008636
435 JGI24744J21845_10004030
436 JGI25406J46586_10026821
437 rootH2_10102316
438 Ga0055540_1000029
439 Ga0070676_10154900
440 Ga0070670_100517962
441 Ga0070677_10308719
442 Ga0068869_100030655
443 Ga0070666_10254353
444 Ga0070666_10385055
445 Ga0070682_100011688
446 Ga0070682_100925165
447 Ga0068868_100000475
448 Ga0068868_101734718
449 Ga0070660_100122145
450 Ga0070689_100017811
451 Ga0070691_10029439
452 Ga0070692_10175384
453 Ga0070668_100000708
454 Ga0070668_100128189
455 Ga0070668_100923930
456 Ga0070669_100027201
457 Ga0070675_100109748
458 Ga0070671_100003661
459 Ga0070671_100319528
460 Ga0070674_100002208
461 Ga0070688_100014391
462 Ga0070659_100114532
463 Ga0070667_100009379
464 Ga0070667_100141614
465 Ga0070709_10310276
466 Ga0070709_10552902
467 Ga0070714_100040836
468 Ga0070714_100791465
469 Ga0070713_100988318
470 Ga0070710_10008652
471 Ga0070710_10158002
472 Ga0070701_10012137
473 Ga0070711_100001775
474 Ga0070705_100004674
475 Ga0070705_101234951
476 Ga0070700_100001939
477 Ga0070694_100012613
478 Ga0070663_101496171
479 Ga0070678_100003506
480 Ga0070662_100274746
481 Ga0068867_100014399
482 Ga0070685_10128992
483 Ga0070706_101059665
484 Ga0068853_100076529
485 Ga0070672_100258370
486 Ga0070686_100348025
487 Ga0070695_100027858
488 Ga0070696_100011722
489 Ga0070665_100014158
490 Ga0070665_100077595
491 Ga0070704_100000400
492 Ga0068855_100059207
493 Ga0068854_100005697
494 Ga0068854_100415074
495 Ga0070702_100023761
496 Ga0068852_100095456
497 Ga0068852_101308783
498 Ga0068859_100011397
499 Ga0068859_100452799
500 Ga0068864_100336257
501 Ga0068866_10002234
502 Ga0068866_10394582
503 Ga0068861_100016026
504 Ga0068861_101074559
505 Ga0068863_100016400
506 Ga0068858_100021885
507 Ga0068858_100088621
508 Ga0068858_101043086
509 Ga0068860_100000645
510 Ga0068860_100317158
511 Ga0068860_100994838
512 Ga0068862_100010570
513 Ga0068862_100340579
514 Ga0081455_10047215
515 Ga0081538_10319527
516 Ga0081540_1079580
517 Ga0081539_10000027
518 Ga0075365_10021942
519 Ga0075363_100007921
520 Ga0075363_100071887
521 Ga0075363_100073401
522 Ga0075363_100101647
523 Ga0075364_10004036
524 Ga0075364_10049079
525 Ga0075364_10110397
526 Ga0075364_10119582
527 Ga0075364_10360220
528 Ga0070715_10006362
529 Ga0070716_100071147
530 Ga0070712_100036625
531 Ga0070712_100745807
532 Ga0075362_10032823
533 Ga0075362_10047076
534 Ga0075362_10054997
535 Ga0075367_10064336
536 Ga0075367_10451774
537 Ga0075369_10004775
538 Ga0075369_10010066
539 Ga0075369_10036587
540 Ga0075369_10049896
541 Ga0097621_100064653
542 Ga0075370_10025450
543 Ga0075370_10030842
544 Ga0075370_10171083
545 Ga0075370_10227313
546 Ga0075370_10276283
547 Ga0068871_100386926
548 Ga0075428_100126792
549 Ga0075428_100141368
550 Ga0075428_100596773
551 Ga0075430_100285047
552 Ga0075431_100076849
553 Ga0075431_100235623
554 Ga0075431_101142655
555 Ga0075429_100246989
556 Ga0068865_100004304
557 Ga0097620_100011396
558 Ga0097620_100452773
559 Ga0105250_10093671
560 Ga0111539_10002142
561 Ga0111539_10703641
562 Ga0105245_10005217
563 Ga0105245_10179677
564 Ga0105247_10000092
565 Ga0105243_10001368
566 Ga0105241_10040302
567 Ga0105241_12313876
568 Ga0105242_10005767
569 Ga0105248_10057426
570 Ga0105248_10295178
571 Ga0105237_10217595
572 Ga0105238_10199632
573 Ga0105249_10016637
574 Ga0105249_10239284
575 Ga0105249_10505271
576 Ga0099796_10144101
577 Ga0105239_10045899
578 Ga0105239_10070362
579 Ga0105239_10146068
580 Ga0105239_10502609
581 Ga0105246_12278878
582 Ga0157369_11196850
583 Ga0157374_10085852
584 Ga0157374_10638537
585 Ga0157378_10002221
586 Ga0163162_10025877
587 Ga0163162_10173867
588 Ga0163162_10408451
589 Ga0163162_10523230
590 Ga0157372_10010129
591 Ga0157375_10009848
592 Ga0163163_10170463
593 Ga0163163_11594963
594 Ga0157380_10000210
595 Ga0157377_10099173
596 Ga0157379_10145792
597 Ga0157379_10332189
598 Ga0157376_10221410
599 Ga0163161_10000918
600 Ga0163161_10651895
601 Ga0213876_10000676
602 Ga0209673_1049307
603 Ga0209051_1000042
604 Ga0207682_10302199
605 Ga0207692_10001048
606 Ga0207642_10000334
607 Ga0207710_10006295
608 Ga0207688_10014156
609 Ga0207680_10011114
610 Ga0207680_10062532
611 Ga0207680_10335038
612 Ga0207685_10001232
613 Ga0207699_10244481
614 Ga0207645_10152239
615 Ga0207684_10640607
616 Ga0207654_10026827
617 Ga0207671_10801406
618 Ga0207693_10012578
619 Ga0207693_10463216
620 Ga0207662_10079139
621 Ga0207657_10046311
622 Ga0207646_10033984
623 Ga0207681_10009751
624 Ga0207694_10355218
625 Ga0207650_10168974
626 Ga0207687_10000656
627 Ga0207687_10112082
628 Ga0207700_10772551
629 Ga0207700_11268665
630 Ga0207664_10015437
631 Ga0207664_10689397
632 Ga0207664_11172914
633 Ga0207644_10009530
634 Ga0207644_10146487
635 Ga0207644_10903075
636 Ga0207690_10050913
637 Ga0207706_10003241
638 Ga0207686_10001101
639 Ga0207709_10002483
640 Ga0207670_10028929
641 Ga0207669_10000872
642 Ga0207704_10003153
643 Ga0207665_10001495
644 Ga0207691_10028534
645 Ga0207711_10675538
646 Ga0207689_10031150
647 Ga0207667_10268074
648 Ga0207712_10003694
649 Ga0207712_10488850
650 Ga0207668_10000999
651 Ga0207668_10002069
652 Ga0207668_11418139
653 Ga0207640_10006987
654 Ga0207658_10030408
655 Ga0207658_10112813
656 Ga0207658_10969052
657 Ga0207677_10003834
658 Ga0207677_11418277
659 Ga0207703_10330191
660 Ga0207639_10002677
661 Ga0207678_10877398
662 Ga0207708_10018564
663 Ga0207708_10260390
664 Ga0207702_10139474
665 Ga0207641_10011872
666 Ga0207641_10115469
667 Ga0207648_10034614
668 Ga0207675_100001486
669 Ga0207675_100699114
670 Ga0207683_10018568
671 Ga0207698_10218815
672 Ga0207428_10125676
673 Ga0268266_10009018
674 Ga0268266_10095860
675 Ga0268265_10015226
676 Ga0268265_12721248
677 Ga0268264_10002434
678 Ga0268264_10278423
679 Ga0268264_12227042
680 Ga0307512_10048501
681 Ga0265327_10001572
682 Ga0265327_10091190
683 Ga0307509_10127034
684 Ga0307413_10093876
685 Ga0307410_10116950
686 Ga0307410_10305947
687 Ga0307410_10345545
688 Ga0307406_11047824
689 Ga0307407_10347716
690 Ga0307412_10484184
691 Ga0307409_100260073
692 Ga0307409_101854235
693 Ga0307416_100084926
694 Ga0307416_100841667
695 Ga0307416_102345635
696 Ga0307414_10222320
697 Ga0307411_10166242
698 Ga0307415_100011624
699 Ga0307415_100404085
700 Ga0307415_100447601
701 Ga0307415_101338557
702 Ga0395901_0248026
703 Ga0436365_1257400
704 Ga0439461_0000575
705 Ga0439461_0110781
706 Ga0439466_0029333
707 Ga0439465_0003099
708 Ga0439465_0005192
709 Ga0451791_1016878
710 Ga0451791_1075183
711 Ga0439442_007547
712 Ga0466969_0125508
713 Ga0466972_0175493
714 Ga0466972_0308561
715 Ga0466965_0418827
716 Ga0466961_0043246
717 Ga0466968_0046900
718 Ga0466970_0175601
719 Ga0466957_0086146
720 Ga0466957_0363518
721 Ga0466960_0028964
722 Ga0466960_0669488
723 Ga0466960_0672585
724 Ga0466959_0088476
725 Ga0466967_0016512
726 Ga0466967_0647495
727 Ga0495638_0031418
728 Ga0495638_0079476
729 Ga0495583_0249467
730 Ga0495667_0220588
731 Ga0495668_0117148
732 Ga0495625_0262255
733 Ga0495657_0313361
734 Ga0495672_0020772
735 Ga0495672_0204366
736 Ga0495672_0369229
737 Ga0495680_0168412
738 Ga0495687_240945
739 Ga0495602_0550571
740 Ga0496100_0000025
741 Ga0496100_0001830
742 Ga0496100_0019256
743 Ga0496100_0582253
744 Ga0496101_0000021
745 Ga0496101_0000068
746 Ga0496101_0076692
747 Ga0496101_0119621
748 Ga0496102_0001215
749 Ga0496102_0003564
750 Ga0496102_0010116
751 Ga0496102_0019976
752 Ga0496102_0759421
753 Ga0496103_0000193
754 Ga0496103_0001243
755 Ga0496103_0047227
756 Ga0496104_0034729
757 Ga0496105_0022097
758 Ga0496106_0002879
759 Ga0496106_0730104
760 Ga0496106_1003835
761 Ga0496107_0000251
762 Ga0496107_0000326
763 Ga0496108_0090431
764 Ga0496108_0127245
765 Ga0496108_0145853
766 Ga0496109_0003398
767 Ga0496109_0115831
768 Ga0496110_0000237
769 Ga0496110_0003140
770 Ga0496111_0002140
771 Ga0496111_0056290
772 Ga0496112_0051271
773 Ga0496113_0569825
774 Ga0496114_0005164
775 Ga0496114_0017757
776 Ga0496115_0025730
777 Ga0496115_0137712
778 Ga0496116_0001613
779 Ga0496118_0040900
780 Ga0496118_0199025
781 Ga0496118_0299862
782 Ga0496119_0011805
783 Ga0496119_0288894
784 Ga0496120_0095607
785 Ga0496120_0243798
786 Ga0496121_0000023
787 Ga0496121_0000809
788 Ga0496121_0716023
789 Ga0496122_0000038
790 Ga0496123_0006864
791 Ga0496124_0000014
792 Ga0496125_0000020
793 Ga0496126_0000023
794 Ga0496126_0014985
795 Ga0496126_0091558
796 Ga0501031_0812730
797 Ga0501032_0065542
798 Ga0501033_0048430
799 Ga0501034_0014420
800 Ga0501036_0781017
801 Ga0501046_1040000
802 Ga0501047_0004151
803 Ga0501047_0825357
804 Ga0501035_0001733
805 Ga0501044_0001124
806 nmdc:mga03683_120059_c1
807 nmdc:mga03683_13986_c1
808 nmdc:mga03n38_134599_c1
809 nmdc:mga03n38_14801_c1
810 nmdc:mga03n38_16871_c1
811 nmdc:mga03n38_331421_c1
812 nmdc:mga03n38_7280_c1
813 nmdc:mga03n38_918329_c1
814 nmdc:mga00v17_133787_c1
815 nmdc:mga00v17_16179_c1
816 nmdc:mga00v17_19239_c1
817 nmdc:mga00v17_197629_c1
818 nmdc:mga00v17_230587_c1
819 nmdc:mga00v17_235087_c1
820 nmdc:mga00v17_445627_c1
821 nmdc:mga0yw44_289967_c1
822 nmdc:mga0yw44_34802_c1
823 nmdc:mga06z11_1019577_c1
824 nmdc:mga06z11_174542_c1
825 nmdc:mga06z11_42269_c1
826 nmdc:mga07m45_132580_c1
827 nmdc:mga07m45_195976_c1
828 nmdc:mga07m45_59077_c1
829 nmdc:mga07m45_75394_c1
830 nmdc:mga05p37_175886_c1
831 nmdc:mga05p37_182525_c1
832 nmdc:mga0qj67_923918_c1
833 nmdc:mga06r32_203483_c1
834 nmdc:mga06r32_683005_c1
835 nmdc:mga08y16_138031_c1
836 nmdc:mga0n895_781417_c1
837 nmdc:mga0sz30_10188_c1
838 nmdc:mga0sz30_157311_c2
839 nmdc:mga0sz30_52693_c1
840 nmdc:mga0sz30_709_c1
841 Ga0500610_0001482
842 Ga0500635_0001842
843 Ga0500635_0055245
844 Ga0495655_0064240
845 Ga0495619_0315388
846 Ga0500643_005687
847 Ga0500556_0003872
848 Ga0500562_003721
849 Ga0500608_366357
850 Ga0500652_001059
851 Ga0500652_083959
852 Ga0500658_0240842
853 Ga0500559_0494278
854 Ga0500616_0044081
855 Ga0500627_0057585
856 Ga0500656_032045
857 Ga0466962_0150286
858 2738666686
859 2738702998
860 2739145530
861 2739333823
862 2744955361
863 2902810989
864 3003003863

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

21

145

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.848 1 135
4qb5-assembly1.cif.gz_C crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8381 2 133
4qb5-assembly1.cif.gz_A crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8358 2 133
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.8356 1 135
4qb5-assembly1.cif.gz_C crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8196 2 133
ID Description Score Start End Superfamily
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.848 1 135 3.10.180.10
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8356 1 135 3.10.180.10
4qb5A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8324 1 133 3.10.180.10
4qb5A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8261 1 133 3.10.180.10
3ct8A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.813 1 131 3.10.180.10
ID Description Score Start End GO Terms
AF-G8RIN4-F1-model_v4 VOC domain-containing protein 0.9869 1 136
AF-G8RIN4-F1-model_v4 VOC domain-containing protein 0.9797 1 136
AF-A0A381TTU4-F1-model_v4 VOC domain-containing protein 0.9699 1 136
AF-A0A1M7RGQ1-F1-model_v4 VOC domain-containing protein 0.957 9 113
AF-A0A358CZG8-F1-model_v4 Extradiol dioxygenase 0.9558 2 133 GO:0051213

Map