F442588
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 432 | 252 | 431 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10875888|Ga0105248_108758882 |
| Length | 165 |
| Sequence | MRREFRRPNAMREIEMAVMRDRPYPQFNFLVDLGTGSTDGPQAGFQEVSAISTEVTVVEYRNGNSKENGPIKITGLNKASDVTMKRGVIGALDLYSWLNDIRNGNQNALRTVTIQLQNEDHSQVVQTWKLLRARIVKHTSGPLNARGSDVAIEEMVLAYERLELE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 2 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 164 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 165 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 166 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 167 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 168 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 169 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 170 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 171 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 172 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 173 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 174 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 175 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 176 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 177 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 179 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 185 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 187 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 191 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 192 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 194 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 195 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 196 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 197 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 198 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 199 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 200 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 201 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 202 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 203 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 227 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 228 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 229 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 232 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 233 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 234 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 235 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 236 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 241 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 252 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.07 |
| Metatranscriptomes | 0.69 |
| Isolates | 0.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.62 |
| Nodule | 0 |
| Rhizoplane | 3.24 |
| Rhizosphere | 93.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10000283 | 3300003187 | Bacteria | 57989 |
| 2 | rootH1_10003087 | 3300003316 | Bacteria | 52943 |
| 3 | rootL2_10006881 | 3300003322 | Bacteria | 64959 |
| 4 | Ga0058862_11809141 | 3300004803 | Bacteria | 984 |
| 5 | Ga0058862_12768848 | 3300004803 | Bacteria | 716 |
| 6 | Ga0065715_10543378 | 3300005293 | Bacteria | 746 |
| 7 | Ga0065707_10407728 | 3300005295 | Bacteria | 845 |
| 8 | Ga0070658_10086437 | 3300005327 | Bacteria | 2580 |
| 9 | Ga0070658_10180575 | 3300005327 | Bacteria | 1776 |
| 10 | Ga0070658_10568366 | 3300005327 | Bacteria | 982 |
| 11 | Ga0070676_10248161 | 3300005328 | Bacteria | 1187 |
| 12 | Ga0070683_100016080 | 3300005329 | Bacteria | 6585 |
| 13 | Ga0070683_100050873 | 3300005329 | Bacteria | 3837 |
| 14 | Ga0070690_100010989 | 3300005330 | Bacteria | 5286 |
| 15 | Ga0070670_100001604 | 3300005331 | Bacteria | 18269 |
| 16 | Ga0070670_100065752 | 3300005331 | Bacteria | 3111 |
| 17 | Ga0070670_100362000 | 3300005331 | Bacteria | 1276 |
| 18 | Ga0070677_10022435 | 3300005333 | Bacteria | 2325 |
| 19 | Ga0070677_10085888 | 3300005333 | Bacteria | 1358 |
| 20 | Ga0070677_10108940 | 3300005333 | Bacteria | 1233 |
| 21 | Ga0068869_100008429 | 3300005334 | Bacteria | 6646 |
| 22 | Ga0068869_100525565 | 3300005334 | Bacteria | 991 |
| 23 | Ga0070666_10014337 | 3300005335 | Bacteria | 5046 |
| 24 | Ga0070682_100336064 | 3300005337 | Bacteria | 1121 |
| 25 | Ga0070682_100852599 | 3300005337 | Bacteria | 745 |
| 26 | Ga0068868_100031078 | 3300005338 | Bacteria | 4098 |
| 27 | Ga0068868_101736066 | 3300005338 | Unclassified | 589 |
| 28 | Ga0070660_100027971 | 3300005339 | Bacteria | 4214 |
| 29 | Ga0070660_100264577 | 3300005339 | Bacteria | 1405 |
| 30 | Ga0070687_100019887 | 3300005343 | Bacteria | 3131 |
| 31 | Ga0070687_100130126 | 3300005343 | Bacteria | 1452 |
| 32 | Ga0070661_100010873 | 3300005344 | Bacteria | 6339 |
| 33 | Ga0070661_100058505 | 3300005344 | Bacteria | 2825 |
| 34 | Ga0070661_100312617 | 3300005344 | Bacteria | 1225 |
| 35 | Ga0070668_100026477 | 3300005347 | Bacteria | 4401 |
| 36 | Ga0070669_100007169 | 3300005353 | Bacteria | 8010 |
| 37 | Ga0070669_100345945 | 3300005353 | Bacteria | 1206 |
| 38 | Ga0070675_100007056 | 3300005354 | Bacteria | 8642 |
| 39 | Ga0070675_100160886 | 3300005354 | Bacteria | 1931 |
| 40 | Ga0070675_100171072 | 3300005354 | Bacteria | 1873 |
| 41 | Ga0070675_100668740 | 3300005354 | Bacteria | 944 |
| 42 | Ga0070671_100000303 | 3300005355 | Bacteria | 33412 |
| 43 | Ga0070671_100109068 | 3300005355 | Bacteria | 2324 |
| 44 | Ga0070674_100269738 | 3300005356 | Bacteria | 1344 |
| 45 | Ga0070674_100315977 | 3300005356 | Bacteria | 1250 |
| 46 | Ga0070673_100016440 | 3300005364 | Bacteria | 5232 |
| 47 | Ga0070673_100161392 | 3300005364 | Bacteria | 1906 |
| 48 | Ga0070673_100570380 | 3300005364 | Bacteria | 1030 |
| 49 | Ga0070659_100016323 | 3300005366 | Bacteria | 5573 |
| 50 | Ga0070659_100199767 | 3300005366 | Bacteria | 1645 |
| 51 | Ga0070659_100894767 | 3300005366 | Bacteria | 776 |
| 52 | Ga0070667_100013229 | 3300005367 | Bacteria | 6818 |
| 53 | Ga0070667_100273917 | 3300005367 | Bacteria | 1514 |
| 54 | Ga0070714_100866774 | 3300005435 | Unclassified | 876 |
| 55 | Ga0070701_10089038 | 3300005438 | Bacteria | 1687 |
| 56 | Ga0070708_100538917 | 3300005445 | Unclassified | 1101 |
| 57 | Ga0070708_101774040 | 3300005445 | Unclassified | 573 |
| 58 | Ga0070663_100029223 | 3300005455 | Bacteria | 3763 |
| 59 | Ga0070678_100024572 | 3300005456 | Bacteria | 4037 |
| 60 | Ga0070678_100032738 | 3300005456 | Bacteria | 3601 |
| 61 | Ga0070678_100032979 | 3300005456 | Bacteria | 3590 |
| 62 | Ga0070678_100134829 | 3300005456 | Bacteria | 1968 |
| 63 | Ga0070678_100877952 | 3300005456 | Bacteria | 819 |
| 64 | Ga0070662_100033838 | 3300005457 | Bacteria | 3601 |
| 65 | Ga0070662_100184775 | 3300005457 | Bacteria | 1645 |
| 66 | Ga0070681_10255363 | 3300005458 | Bacteria | 1665 |
| 67 | Ga0070681_10301919 | 3300005458 | Bacteria | 1511 |
| 68 | Ga0068867_100006850 | 3300005459 | Bacteria | 8058 |
| 69 | Ga0068867_100239911 | 3300005459 | Bacteria | 1469 |
| 70 | Ga0068867_100913290 | 3300005459 | Bacteria | 791 |
| 71 | Ga0070685_10714675 | 3300005466 | Bacteria | 732 |
| 72 | Ga0070706_100003005 | 3300005467 | Bacteria | 16716 |
| 73 | Ga0070707_100031551 | 3300005468 | Bacteria | 5048 |
| 74 | Ga0070707_100597252 | 3300005468 | Bacteria | 1066 |
| 75 | Ga0070698_100097951 | 3300005471 | Bacteria | 2908 |
| 76 | Ga0070698_100907021 | 3300005471 | Unclassified | 827 |
| 77 | Ga0070679_100461207 | 3300005530 | Unclassified | 1215 |
| 78 | Ga0070679_101014411 | 3300005530 | Bacteria | 774 |
| 79 | Ga0070684_100009386 | 3300005535 | Bacteria | 7703 |
| 80 | Ga0070684_100229587 | 3300005535 | Bacteria | 1694 |
| 81 | Ga0070697_100800013 | 3300005536 | Bacteria | 834 |
| 82 | Ga0068853_100250513 | 3300005539 | Bacteria | 1625 |
| 83 | Ga0068853_100795209 | 3300005539 | Bacteria | 906 |
| 84 | Ga0070672_100029456 | 3300005543 | Bacteria | 4117 |
| 85 | Ga0070672_100029588 | 3300005543 | Bacteria | 4109 |
| 86 | Ga0070672_100031101 | 3300005543 | Bacteria | 4015 |
| 87 | Ga0070672_100119338 | 3300005543 | Bacteria | 2157 |
| 88 | Ga0070672_100480758 | 3300005543 | Bacteria | 1072 |
| 89 | Ga0070672_100867008 | 3300005543 | Bacteria | 796 |
| 90 | Ga0070693_100101092 | 3300005547 | Bacteria | 1756 |
| 91 | Ga0068855_100121114 | 3300005563 | Bacteria | 2994 |
| 92 | Ga0070664_100043299 | 3300005564 | Bacteria | 3798 |
| 93 | Ga0070664_100045988 | 3300005564 | Bacteria | 3686 |
| 94 | Ga0070664_100074919 | 3300005564 | Bacteria | 2905 |
| 95 | Ga0070664_100357046 | 3300005564 | Bacteria | 1330 |
| 96 | Ga0070664_100887716 | 3300005564 | Bacteria | 836 |
| 97 | Ga0070664_101149786 | 3300005564 | Bacteria | 732 |
| 98 | Ga0068854_100008463 | 3300005578 | Bacteria | 6615 |
| 99 | Ga0068854_100125241 | 3300005578 | Bacteria | 1956 |
| 100 | Ga0068854_101137350 | 3300005578 | Unclassified | 697 |
| 101 | Ga0068856_100099193 | 3300005614 | Bacteria | 2903 |
| 102 | Ga0070702_100195418 | 3300005615 | Bacteria | 1335 |
| 103 | Ga0068852_100001595 | 3300005616 | Bacteria | 15432 |
| 104 | Ga0068852_100002061 | 3300005616 | Bacteria | 13712 |
| 105 | Ga0068859_100066917 | 3300005617 | Bacteria | 3628 |
| 106 | Ga0068864_100003573 | 3300005618 | Bacteria | 12853 |
| 107 | Ga0068864_100481166 | 3300005618 | Bacteria | 1192 |
| 108 | Ga0068864_100566659 | 3300005618 | Bacteria | 1099 |
| 109 | Ga0068864_100686250 | 3300005618 | Bacteria | 999 |
| 110 | Ga0068864_102266214 | 3300005618 | Bacteria | 550 |
| 111 | Ga0068866_10004983 | 3300005718 | Bacteria | 5466 |
| 112 | Ga0068861_100005957 | 3300005719 | Bacteria | 8281 |
| 113 | Ga0068851_10241428 | 3300005834 | Bacteria | 1022 |
| 114 | Ga0068870_10443074 | 3300005840 | Bacteria | 855 |
| 115 | Ga0068863_100045605 | 3300005841 | Bacteria | 4160 |
| 116 | Ga0068863_100065796 | 3300005841 | Bacteria | 3430 |
| 117 | Ga0068863_100226129 | 3300005841 | Bacteria | 1804 |
| 118 | Ga0068863_100258391 | 3300005841 | Bacteria | 1683 |
| 119 | Ga0068858_100003921 | 3300005842 | Bacteria | 14698 |
| 120 | Ga0068858_100007342 | 3300005842 | Bacteria | 10666 |
| 121 | Ga0068858_100365358 | 3300005842 | Bacteria | 1383 |
| 122 | Ga0068860_100022335 | 3300005843 | Bacteria | 6121 |
| 123 | Ga0068860_100199310 | 3300005843 | Bacteria | 1939 |
| 124 | Ga0070717_10002211 | 3300006028 | Bacteria | 13677 |
| 125 | Ga0070717_10157018 | 3300006028 | Bacteria | 1971 |
| 126 | Ga0070717_11014055 | 3300006028 | Unclassified | 756 |
| 127 | Ga0070715_10150521 | 3300006163 | Bacteria | 1140 |
| 128 | Ga0070716_100574399 | 3300006173 | Unclassified | 844 |
| 129 | Ga0075366_10337421 | 3300006195 | Bacteria | 924 |
| 130 | Ga0097621_100169063 | 3300006237 | Bacteria | 1883 |
| 131 | Ga0097621_100367554 | 3300006237 | Bacteria | 1283 |
| 132 | Ga0097621_100736842 | 3300006237 | Bacteria | 909 |
| 133 | Ga0068871_100124707 | 3300006358 | Bacteria | 2178 |
| 134 | Ga0068871_100138066 | 3300006358 | Bacteria | 2071 |
| 135 | Ga0075428_100099763 | 3300006844 | Bacteria | 3166 |
| 136 | Ga0075434_100436664 | 3300006871 | Unclassified | 1330 |
| 137 | Ga0068865_100001266 | 3300006881 | Bacteria | 14725 |
| 138 | Ga0075436_100003792 | 3300006914 | Bacteria | 10366 |
| 139 | Ga0097620_100066920 | 3300006931 | Bacteria | 3628 |
| 140 | Ga0099794_10073234 | 3300007265 | Unclassified | 1681 |
| 141 | Ga0105240_10211117 | 3300009093 | Bacteria | 2269 |
| 142 | Ga0111539_10197671 | 3300009094 | Unclassified | 2345 |
| 143 | Ga0111539_12327172 | 3300009094 | Bacteria | 622 |
| 144 | Ga0105245_10096821 | 3300009098 | Bacteria | 2724 |
| 145 | Ga0105245_10838295 | 3300009098 | Bacteria | 959 |
| 146 | Ga0105245_12392356 | 3300009098 | Bacteria | 582 |
| 147 | Ga0105247_10728450 | 3300009101 | Bacteria | 749 |
| 148 | Ga0114129_10096069 | 3300009147 | Bacteria | 4103 |
| 149 | Ga0105243_10128680 | 3300009148 | Bacteria | 2145 |
| 150 | Ga0105241_10505874 | 3300009174 | Bacteria | 1078 |
| 151 | Ga0105241_11518489 | 3300009174 | Bacteria | 645 |
| 152 | Ga0105242_10039374 | 3300009176 | Bacteria | 3804 |
| 153 | Ga0105242_10127443 | 3300009176 | Bacteria | 2193 |
| 154 | Ga0105248_10017145 | 3300009177 | Bacteria | 7979 |
| 155 | Ga0105248_10825000 | 3300009177 | Bacteria | 1047 |
| 156 | Ga0105248_10875888 | 3300009177 | Bacteria | 1014 |
| 157 | Ga0105248_10891398 | 3300009177 | Bacteria | 1004 |
| 158 | Ga0105237_10237887 | 3300009545 | Bacteria | 1822 |
| 159 | Ga0105238_10007534 | 3300009551 | Bacteria | 10902 |
| 160 | Ga0105238_10210176 | 3300009551 | Bacteria | 1922 |
| 161 | Ga0105238_10631796 | 3300009551 | Bacteria | 1080 |
| 162 | Ga0105249_10008679 | 3300009553 | Bacteria | 8855 |
| 163 | Ga0105239_10454890 | 3300010375 | Bacteria | 1453 |
| 164 | Ga0105246_10475771 | 3300011119 | Bacteria | 1055 |
| 165 | Ga0157324_1003865 | 3300012506 | Bacteria | 1006 |
| 166 | Ga0157373_10091052 | 3300013100 | Bacteria | 2148 |
| 167 | Ga0157369_10011093 | 3300013105 | Bacteria | 10252 |
| 168 | Ga0157374_10045628 | 3300013296 | Bacteria | 4056 |
| 169 | Ga0157374_10069437 | 3300013296 | Bacteria | 3317 |
| 170 | Ga0157374_10284897 | 3300013296 | Bacteria | 1632 |
| 171 | Ga0157374_11270463 | 3300013296 | Bacteria | 758 |
| 172 | Ga0157378_10168418 | 3300013297 | Bacteria | 2053 |
| 173 | Ga0157378_11181476 | 3300013297 | Bacteria | 804 |
| 174 | Ga0163162_10012386 | 3300013306 | Bacteria | 8328 |
| 175 | Ga0163162_10160033 | 3300013306 | Bacteria | 2373 |
| 176 | Ga0157372_10023908 | 3300013307 | Bacteria | 6630 |
| 177 | Ga0157372_10294656 | 3300013307 | Bacteria | 1887 |
| 178 | Ga0157372_11201027 | 3300013307 | Bacteria | 876 |
| 179 | Ga0157372_11361537 | 3300013307 | Bacteria | 818 |
| 180 | Ga0157372_11601261 | 3300013307 | Bacteria | 750 |
| 181 | Ga0157375_10008819 | 3300013308 | Bacteria | 8831 |
| 182 | Ga0157375_10026773 | 3300013308 | Bacteria | 5380 |
| 183 | Ga0157375_10033677 | 3300013308 | Bacteria | 4872 |
| 184 | Ga0157375_10391278 | 3300013308 | Bacteria | 1557 |
| 185 | Ga0157375_10544884 | 3300013308 | Bacteria | 1322 |
| 186 | Ga0157375_10553388 | 3300013308 | Bacteria | 1312 |
| 187 | Ga0157375_11832882 | 3300013308 | Bacteria | 719 |
| 188 | Ga0163163_10131339 | 3300014325 | Bacteria | 2545 |
| 189 | Ga0163163_11220187 | 3300014325 | Bacteria | 815 |
| 190 | Ga0157380_10089533 | 3300014326 | Bacteria | 2535 |
| 191 | Ga0157380_10095688 | 3300014326 | Bacteria | 2461 |
| 192 | Ga0157380_11476105 | 3300014326 | Bacteria | 732 |
| 193 | Ga0182008_10158909 | 3300014497 | Bacteria | 1136 |
| 194 | Ga0182008_10412183 | 3300014497 | Bacteria | 728 |
| 195 | Ga0157377_10509001 | 3300014745 | Bacteria | 843 |
| 196 | Ga0157379_10055705 | 3300014968 | Bacteria | 3533 |
| 197 | Ga0157379_10057874 | 3300014968 | Bacteria | 3464 |
| 198 | Ga0157379_10093887 | 3300014968 | Bacteria | 2692 |
| 199 | Ga0157379_12150681 | 3300014968 | Bacteria | 554 |
| 200 | Ga0157376_10053876 | 3300014969 | Bacteria | 3352 |
| 201 | Ga0157376_10119850 | 3300014969 | Bacteria | 2330 |
| 202 | Ga0182007_10024492 | 3300015262 | Bacteria | 2111 |
| 203 | Ga0163161_10016938 | 3300017792 | Bacteria | 5095 |
| 204 | Ga0163161_10489699 | 3300017792 | Unclassified | 1000 |
| 205 | Ga0207425_1001940 | 3300025245 | Bacteria | 7785 |
| 206 | Ga0209025_1000005 | 3300025294 | Bacteria | 1272149 |
| 207 | Ga0209758_1011515 | 3300025297 | Bacteria | 5108 |
| 208 | Ga0207697_10042308 | 3300025315 | Bacteria | 1872 |
| 209 | Ga0207656_10030875 | 3300025321 | Bacteria | 2216 |
| 210 | Ga0207656_10113334 | 3300025321 | Bacteria | 1255 |
| 211 | Ga0207682_10026443 | 3300025893 | Bacteria | 2307 |
| 212 | Ga0207642_10012121 | 3300025899 | Bacteria | 3101 |
| 213 | Ga0207642_10014314 | 3300025899 | Bacteria | 2924 |
| 214 | Ga0207688_10576759 | 3300025901 | Bacteria | 708 |
| 215 | Ga0207680_10048068 | 3300025903 | Bacteria | 2532 |
| 216 | Ga0207680_10473062 | 3300025903 | Bacteria | 891 |
| 217 | Ga0207645_10022814 | 3300025907 | Bacteria | 4069 |
| 218 | Ga0207643_10100473 | 3300025908 | Bacteria | 1696 |
| 219 | Ga0207705_10018341 | 3300025909 | Bacteria | 5004 |
| 220 | Ga0207705_10251704 | 3300025909 | Bacteria | 1347 |
| 221 | Ga0207684_10008096 | 3300025910 | Bacteria | 9371 |
| 222 | Ga0207654_10308537 | 3300025911 | Bacteria | 1078 |
| 223 | Ga0207707_10216456 | 3300025912 | Bacteria | 1668 |
| 224 | Ga0207707_10284780 | 3300025912 | Bacteria | 1431 |
| 225 | Ga0207695_10289337 | 3300025913 | Bacteria | 1531 |
| 226 | Ga0207662_10021819 | 3300025918 | Bacteria | 3664 |
| 227 | Ga0207662_10093750 | 3300025918 | Bacteria | 1850 |
| 228 | Ga0207657_10026399 | 3300025919 | Bacteria | 5339 |
| 229 | Ga0207657_10301007 | 3300025919 | Bacteria | 1270 |
| 230 | Ga0207649_10021107 | 3300025920 | Bacteria | 3743 |
| 231 | Ga0207649_10177605 | 3300025920 | Bacteria | 1488 |
| 232 | Ga0207652_10238255 | 3300025921 | Bacteria | 1640 |
| 233 | Ga0207681_10003606 | 3300025923 | Bacteria | 9635 |
| 234 | Ga0207650_10004217 | 3300025925 | Bacteria | 9818 |
| 235 | Ga0207650_10104552 | 3300025925 | Bacteria | 2185 |
| 236 | Ga0207650_10217943 | 3300025925 | Bacteria | 1535 |
| 237 | Ga0207650_10924390 | 3300025925 | Bacteria | 741 |
| 238 | Ga0207650_11178209 | 3300025925 | Bacteria | 652 |
| 239 | Ga0207659_10053270 | 3300025926 | Bacteria | 2885 |
| 240 | Ga0207659_10202111 | 3300025926 | Bacteria | 1588 |
| 241 | Ga0207659_10269012 | 3300025926 | Bacteria | 1389 |
| 242 | Ga0207659_10950147 | 3300025926 | Bacteria | 739 |
| 243 | Ga0207687_10321354 | 3300025927 | Bacteria | 1253 |
| 244 | Ga0207700_10171241 | 3300025928 | Unclassified | 1812 |
| 245 | Ga0207644_10000068 | 3300025931 | Bacteria | 76090 |
| 246 | Ga0207644_10054726 | 3300025931 | Bacteria | 2875 |
| 247 | Ga0207690_10052875 | 3300025932 | Bacteria | 2722 |
| 248 | Ga0207690_10165843 | 3300025932 | Bacteria | 1651 |
| 249 | Ga0207690_10387673 | 3300025932 | Bacteria | 1112 |
| 250 | Ga0207706_10007964 | 3300025933 | Bacteria | 9783 |
| 251 | Ga0207706_10016165 | 3300025933 | Bacteria | 6741 |
| 252 | Ga0207686_10053035 | 3300025934 | Bacteria | 2534 |
| 253 | Ga0207686_10505763 | 3300025934 | Bacteria | 938 |
| 254 | Ga0207686_10556552 | 3300025934 | Bacteria | 897 |
| 255 | Ga0207709_10318535 | 3300025935 | Bacteria | 1163 |
| 256 | Ga0207709_10400998 | 3300025935 | Bacteria | 1049 |
| 257 | Ga0207669_10019603 | 3300025937 | Bacteria | 3526 |
| 258 | Ga0207704_10043559 | 3300025938 | Bacteria | 2652 |
| 259 | Ga0207665_10533299 | 3300025939 | Bacteria | 910 |
| 260 | Ga0207691_10002959 | 3300025940 | Bacteria | 16591 |
| 261 | Ga0207691_10027638 | 3300025940 | Bacteria | 5318 |
| 262 | Ga0207691_10032454 | 3300025940 | Bacteria | 4867 |
| 263 | Ga0207691_10042492 | 3300025940 | Bacteria | 4190 |
| 264 | Ga0207691_10045783 | 3300025940 | Bacteria | 4021 |
| 265 | Ga0207691_10134897 | 3300025940 | Bacteria | 2178 |
| 266 | Ga0207711_10007769 | 3300025941 | Bacteria | 8961 |
| 267 | Ga0207711_10058055 | 3300025941 | Bacteria | 3328 |
| 268 | Ga0207711_11103642 | 3300025941 | Bacteria | 734 |
| 269 | Ga0207689_10008531 | 3300025942 | Bacteria | 8933 |
| 270 | Ga0207661_10316560 | 3300025944 | Bacteria | 1402 |
| 271 | Ga0207661_10667602 | 3300025944 | Bacteria | 955 |
| 272 | Ga0207679_10041448 | 3300025945 | Bacteria | 3301 |
| 273 | Ga0207679_10145016 | 3300025945 | Bacteria | 1924 |
| 274 | Ga0207679_10504530 | 3300025945 | Bacteria | 1080 |
| 275 | Ga0207679_11093591 | 3300025945 | Bacteria | 731 |
| 276 | Ga0207651_10011189 | 3300025960 | Bacteria | 5010 |
| 277 | Ga0207651_10053036 | 3300025960 | Bacteria | 2769 |
| 278 | Ga0207651_10759512 | 3300025960 | Bacteria | 857 |
| 279 | Ga0207712_10008238 | 3300025961 | Bacteria | 6587 |
| 280 | Ga0207668_10066118 | 3300025972 | Bacteria | 2561 |
| 281 | Ga0207640_10021427 | 3300025981 | Bacteria | 3851 |
| 282 | Ga0207640_10122033 | 3300025981 | Bacteria | 1869 |
| 283 | Ga0207640_10636007 | 3300025981 | Bacteria | 907 |
| 284 | Ga0207658_10030079 | 3300025986 | Bacteria | 3841 |
| 285 | Ga0207658_10073696 | 3300025986 | Bacteria | 2592 |
| 286 | Ga0207677_10008027 | 3300026023 | Bacteria | 5875 |
| 287 | Ga0207677_10023524 | 3300026023 | Bacteria | 3809 |
| 288 | Ga0207677_10237757 | 3300026023 | Bacteria | 1471 |
| 289 | Ga0207677_11239385 | 3300026023 | Bacteria | 684 |
| 290 | Ga0207703_10044598 | 3300026035 | Bacteria | 3565 |
| 291 | Ga0207703_10260863 | 3300026035 | Bacteria | 1566 |
| 292 | Ga0207703_10654563 | 3300026035 | Bacteria | 997 |
| 293 | Ga0207639_10030361 | 3300026041 | Bacteria | 3963 |
| 294 | Ga0207639_10216292 | 3300026041 | Bacteria | 1652 |
| 295 | Ga0207639_11470044 | 3300026041 | Bacteria | 640 |
| 296 | Ga0207678_10091779 | 3300026067 | Bacteria | 2596 |
| 297 | Ga0207678_10832454 | 3300026067 | Bacteria | 815 |
| 298 | Ga0207708_10086908 | 3300026075 | Bacteria | 2407 |
| 299 | Ga0207702_10060306 | 3300026078 | Bacteria | 3234 |
| 300 | Ga0207641_10019792 | 3300026088 | Bacteria | 5525 |
| 301 | Ga0207641_10235276 | 3300026088 | Bacteria | 1704 |
| 302 | Ga0207648_10050360 | 3300026089 | Bacteria | 3642 |
| 303 | Ga0207648_10533340 | 3300026089 | Bacteria | 1076 |
| 304 | Ga0207648_10917210 | 3300026089 | Unclassified | 819 |
| 305 | Ga0207648_11349767 | 3300026089 | Bacteria | 670 |
| 306 | Ga0207676_10009361 | 3300026095 | Bacteria | 6972 |
| 307 | Ga0207676_10148260 | 3300026095 | Bacteria | 2017 |
| 308 | Ga0207676_10228284 | 3300026095 | Bacteria | 1662 |
| 309 | Ga0207676_10749518 | 3300026095 | Bacteria | 949 |
| 310 | Ga0207674_10015468 | 3300026116 | Bacteria | 8381 |
| 311 | Ga0207674_10025298 | 3300026116 | Bacteria | 6334 |
| 312 | Ga0207675_100217928 | 3300026118 | Bacteria | 1838 |
| 313 | Ga0207675_100269669 | 3300026118 | Bacteria | 1651 |
| 314 | Ga0207683_10018583 | 3300026121 | Bacteria | 5932 |
| 315 | Ga0207683_10103801 | 3300026121 | Bacteria | 2540 |
| 316 | Ga0207683_10148015 | 3300026121 | Bacteria | 2119 |
| 317 | Ga0207683_10298148 | 3300026121 | Bacteria | 1475 |
| 318 | Ga0207683_10365742 | 3300026121 | Bacteria | 1325 |
| 319 | Ga0207698_10079361 | 3300026142 | Bacteria | 2640 |
| 320 | Ga0207698_10097318 | 3300026142 | Bacteria | 2428 |
| 321 | Ga0207698_10126076 | 3300026142 | Bacteria | 2178 |
| 322 | Ga0207698_10423514 | 3300026142 | Bacteria | 1278 |
| 323 | Ga0207698_11162798 | 3300026142 | Bacteria | 785 |
| 324 | Ga0209588_1039741 | 3300027671 | Unclassified | 1517 |
| 325 | Ga0268265_10019957 | 3300028380 | Bacteria | 4669 |
| 326 | Ga0268264_10012058 | 3300028381 | Bacteria | 7116 |
| 327 | Ga0307515_10000178 | 3300028794 | Bacteria | 157107 |
| 328 | Ga0265327_10007663 | 3300031251 | Bacteria | 8268 |
| 329 | Ga0307408_100000010 | 3300031548 | Bacteria | 420048 |
| 330 | Ga0307408_100308649 | 3300031548 | Bacteria | 1328 |
| 331 | Ga0316579_10146649 | 3300031691 | Bacteria | 1138 |
| 332 | Ga0316579_10359411 | 3300031691 | Bacteria | 704 |
| 333 | Ga0316576_10511106 | 3300031727 | Bacteria | 883 |
| 334 | Ga0316578_10091000 | 3300031728 | Bacteria | 1822 |
| 335 | Ga0307405_10171238 | 3300031731 | Bacteria | 1549 |
| 336 | Ga0316577_10005803 | 3300031733 | Bacteria | 6495 |
| 337 | Ga0307406_10019744 | 3300031901 | Bacteria | 3959 |
| 338 | Ga0307406_10038198 | 3300031901 | Bacteria | 2970 |
| 339 | Ga0307407_10613608 | 3300031903 | Bacteria | 811 |
| 340 | Ga0307412_10018714 | 3300031911 | Bacteria | 4176 |
| 341 | Ga0307409_100000931 | 3300031995 | Bacteria | 13613 |
| 342 | Ga0307416_100002618 | 3300032002 | Bacteria | 10401 |
| 343 | Ga0307415_100881450 | 3300032126 | Bacteria | 823 |
| 344 | Ga0316593_10005845 | 3300032168 | Bacteria | 3281 |
| 345 | Ga0373928_0094962 | 3300035084 | Bacteria | 770 |
| 346 | Ga0373945_0044854 | 3300035116 | Bacteria | 1609 |
| 347 | Ga0373945_0088479 | 3300035116 | Bacteria | 1196 |
| 348 | Ga0373953_0267782 | 3300035117 | Bacteria | 744 |
| 349 | Ga0373954_0361430 | 3300035118 | Bacteria | 717 |
| 350 | Ga0373943_0110249 | 3300035170 | Bacteria | 1451 |
| 351 | Ga0373946_0117217 | 3300035171 | Bacteria | 1212 |
| 352 | Ga0373924_0022601 | 3300035410 | Bacteria | 2459 |
| 353 | Ga0373931_0061205 | 3300035691 | Bacteria | 2029 |
| 354 | Ga0373927_0323425 | 3300035695 | Bacteria | 1016 |
| 355 | Ga0373933_0298389 | 3300035724 | Bacteria | 1043 |
| 356 | Ga0373947_0357676 | 3300035725 | Bacteria | 980 |
| 357 | Ga0373937_0040920 | 3300036401 | Bacteria | 4226 |
| 358 | Ga0373937_0235793 | 3300036401 | Bacteria | 1723 |
| 359 | Ga0316582_0038962 | 3300036647 | Bacteria | 2957 |
| 360 | Ga0316584_0091722 | 3300036712 | Bacteria | 2274 |
| 361 | Ga0373925_0083408 | 3300037068 | Bacteria | 2434 |
| 362 | Ga0373925_0537334 | 3300037068 | Bacteria | 961 |
| 363 | Ga0395900_0289222 | 3300037418 | Bacteria | 1628 |
| 364 | Ga0395898_0770477 | 3300037466 | Bacteria | 903 |
| 365 | Ga0316581_0154004 | 3300037588 | Unclassified | 708 |
| 366 | Ga0400490_44662 | 3300038726 | Bacteria | 23632 |
| 367 | Ga0439436_0013864 | 3300041404 | Bacteria | 2436 |
| 368 | Ga0439455_0075449 | 3300042012 | Bacteria | 911 |
| 369 | Ga0466963_0155916 | 3300044694 | Bacteria | 1587 |
| 370 | Ga0453684_0091441 | 3300044712 | Bacteria | 3756 |
| 371 | Ga0453684_0704745 | 3300044712 | Bacteria | 1097 |
| 372 | Ga0466957_0208784 | 3300044842 | Unclassified | 1285 |
| 373 | Ga0451576_0207179 | 3300045051 | Bacteria | 2047 |
| 374 | Ga0451576_0340483 | 3300045051 | Unclassified | 1570 |
| 375 | Ga0495592_0157403 | 3300046454 | Bacteria | 1566 |
| 376 | Ga0495592_0598494 | 3300046454 | Bacteria | 673 |
| 377 | Ga0495591_136298 | 3300046458 | Bacteria | 594 |
| 378 | Ga0495580_0316581 | 3300046472 | Bacteria | 1061 |
| 379 | Ga0495580_0584450 | 3300046472 | Unclassified | 739 |
| 380 | Ga0495582_0217120 | 3300046473 | Bacteria | 1094 |
| 381 | Ga0495594_0377614 | 3300046499 | Bacteria | 807 |
| 382 | Ga0495596_0020954 | 3300046500 | Bacteria | 2672 |
| 383 | Ga0495606_0019524 | 3300046507 | Bacteria | 5037 |
| 384 | Ga0495663_0102643 | 3300046525 | Bacteria | 943 |
| 385 | Ga0495642_0153962 | 3300046528 | Bacteria | 995 |
| 386 | Ga0495586_0166740 | 3300046535 | Bacteria | 1244 |
| 387 | Ga0495621_0069998 | 3300046539 | Bacteria | 1291 |
| 388 | Ga0495621_0124371 | 3300046539 | Bacteria | 999 |
| 389 | Ga0495597_0110476 | 3300046542 | Bacteria | 1153 |
| 390 | Ga0495645_0112835 | 3300046543 | Bacteria | 1922 |
| 391 | Ga0495645_0230398 | 3300046543 | Bacteria | 1241 |
| 392 | Ga0495667_0353487 | 3300046559 | Bacteria | 928 |
| 393 | Ga0495668_0000022 | 3300046616 | Bacteria | 363999 |
| 394 | Ga0495658_0203578 | 3300046683 | Bacteria | 1234 |
| 395 | Ga0495670_0260973 | 3300046691 | Bacteria | 925 |
| 396 | Ga0495649_0322881 | 3300046694 | Bacteria | 783 |
| 397 | Ga0495636_0001837 | 3300047318 | Bacteria | 8118 |
| 398 | Ga0495680_0156248 | 3300047322 | Bacteria | 1659 |
| 399 | Ga0495683_0009835 | 3300047323 | Bacteria | 5083 |
| 400 | Ga0495685_020797 | 3300047447 | Bacteria | 2256 |
| 401 | Ga0496101_0509356 | 3300048904 | Bacteria | 951 |
| 402 | Ga0496104_0141413 | 3300048907 | Bacteria | 2312 |
| 403 | Ga0496104_0478638 | 3300048907 | Bacteria | 1156 |
| 404 | Ga0496106_0004171 | 3300048909 | Bacteria | 10771 |
| 405 | Ga0496107_1233534 | 3300048910 | Bacteria | 537 |
| 406 | Ga0496108_0205009 | 3300048911 | Bacteria | 1711 |
| 407 | Ga0496108_1077216 | 3300048911 | Bacteria | 684 |
| 408 | Ga0496109_0558379 | 3300048912 | Bacteria | 1080 |
| 409 | Ga0496110_0179768 | 3300048913 | Bacteria | 1921 |
| 410 | Ga0496110_0554823 | 3300048913 | Bacteria | 1044 |
| 411 | Ga0496112_0089634 | 3300048915 | Bacteria | 3044 |
| 412 | Ga0496113_0160729 | 3300048916 | Bacteria | 1776 |
| 413 | Ga0496114_0241221 | 3300048917 | Bacteria | 1589 |
| 414 | Ga0496115_0034359 | 3300048918 | Bacteria | 4007 |
| 415 | Ga0501036_1200806 | 3300049572 | Bacteria | 618 |
| 416 | Ga0501068_0373467 | 3300049584 | Bacteria | 918 |
| 417 | Ga0501076_0294906 | 3300049592 | Bacteria | 1329 |
| 418 | Ga0501081_0346848 | 3300049743 | Bacteria | 1094 |
| 419 | nmdc:mga0k408_542266_c1 | 3300050493 | Bacteria | 688 |
| 420 | nmdc:mga09592_874812_c1 | 3300050508 | Bacteria | 756 |
| 421 | nmdc:mga06r32_154893_c1 | 3300050510 | Bacteria | 2272 |
| 422 | nmdc:mga08y16_1628091_c1 | 3300050511 | Unclassified | 603 |
| 423 | nmdc:mga0n895_558887_c1 | 3300050512 | Unclassified | 1150 |
| 424 | nmdc:mga0rr50_212124_c1 | 3300050513 | Bacteria | 1596 |
| 425 | nmdc:mga0a205_356496_c1 | 3300050515 | Unclassified | 1330 |
| 426 | Ga0495601_0121624 | 3300053077 | Bacteria | 1695 |
| 427 | Ga0495655_0252971 | 3300053083 | Bacteria | 593 |
| 428 | Ga0495595_0117305 | 3300053084 | Bacteria | 1295 |
| 429 | Ga0495619_0417923 | 3300053085 | Bacteria | 925 |
| 430 | Ga0500588_0216690 | 3300053146 | Bacteria | 713 |
| 431 | Ga0501082_0750136 | 3300060353 | Bacteria | 854 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049584 | Ga0501068_0373467 | Ga0501068_0373467_529_903 | 115 |
| 2 | 3300009094 | Ga0111539_10197671 | Ga0111539_101976712 | 128 |
| 3 | 3300009094 | Ga0111539_12327172 | Ga0111539_123271721 | 128 |
| 4 | 3300050511 | nmdc:mga08y16_1628091_c1 | nmdc:mga08y16_1628091_c1_114_500 | 128 |
| 5 | 3300047322 | Ga0495680_0156248 | Ga0495680_0156248_452_856 | 134 |
| 6 | 3300049572 | Ga0501036_1200806 | Ga0501036_1200806_77_517 | 134 |
| 7 | 3300004803 | Ga0058862_11809141 | Ga0058862_118091412 | 135 |
| 8 | 3300005458 | Ga0070681_10301919 | Ga0070681_103019192 | 135 |
| 9 | 3300005530 | Ga0070679_101014411 | Ga0070679_1010144112 | 135 |
| 10 | 3300025912 | Ga0207707_10284780 | Ga0207707_102847802 | 135 |
| 11 | 3300025921 | Ga0207652_10238255 | Ga0207652_102382552 | 135 |
| 12 | 3300042012 | Ga0439455_0075449 | Ga0439455_0075449_287_739 | 135 |
| 13 | 3300049592 | Ga0501076_0294906 | Ga0501076_0294906_298_747 | 137 |
| 14 | 3300049743 | Ga0501081_0346848 | Ga0501081_0346848_512_961 | 137 |
| 15 | 3300060353 | Ga0501082_0750136 | Ga0501082_0750136_272_721 | 137 |
| 16 | iso_pu_bacteria | 2643221593 | 2643976897 | 146 |
| 17 | 3300005327 | Ga0070658_10180575 | Ga0070658_101805752 | 147 |
| 18 | 3300005367 | Ga0070667_100273917 | Ga0070667_1002739173 | 147 |
| 19 | 3300005471 | Ga0070698_100907021 | Ga0070698_1009070212 | 147 |
| 20 | 3300005841 | Ga0068863_100065796 | Ga0068863_1000657964 | 147 |
| 21 | 3300013296 | Ga0157374_10069437 | Ga0157374_100694372 | 147 |
| 22 | 3300013308 | Ga0157375_10033677 | Ga0157375_100336775 | 147 |
| 23 | 3300013308 | Ga0157375_11832882 | Ga0157375_118328821 | 147 |
| 24 | 3300014969 | Ga0157376_10053876 | Ga0157376_100538762 | 147 |
| 25 | 3300026089 | Ga0207648_11349767 | Ga0207648_113497672 | 147 |
| 26 | 3300026142 | Ga0207698_10423514 | Ga0207698_104235143 | 147 |
| 27 | 3300031548 | Ga0307408_100308649 | Ga0307408_1003086492 | 148 |
| 28 | 3300031731 | Ga0307405_10171238 | Ga0307405_101712382 | 148 |
| 29 | 3300031901 | Ga0307406_10019744 | Ga0307406_100197444 | 148 |
| 30 | 3300031903 | Ga0307407_10613608 | Ga0307407_106136082 | 148 |
| 31 | 3300031911 | Ga0307412_10018714 | Ga0307412_100187144 | 148 |
| 32 | 3300031995 | Ga0307409_100000931 | Ga0307409_10000093113 | 148 |
| 33 | 3300032002 | Ga0307416_100002618 | Ga0307416_1000026189 | 148 |
| 34 | 3300032126 | Ga0307415_100881450 | Ga0307415_1008814502 | 148 |
| 35 | 3300044694 | Ga0466963_0155916 | Ga0466963_0155916_202_660 | 148 |
| 36 | 3300053146 | Ga0500588_0216690 | Ga0500588_0216690_92_541 | 148 |
| 37 | 3300026116 | Ga0207674_10015468 | Ga0207674_100154682 | 149 |
| 38 | 3300028794 | Ga0307515_10000178 | Ga0307515_1000017846 | 149 |
| 39 | 3300038726 | Ga0400490_44662 | Ga0400490_44662_8599_9048 | 149 |
| 40 | 3300046472 | Ga0495580_0316581 | Ga0495580_0316581_297_746 | 149 |
| 41 | 3300046499 | Ga0495594_0377614 | Ga0495594_0377614_316_765 | 149 |
| 42 | 3300003187 | JGI25151J46595_10000283 | JGI25151J46595_1000028319 | 150 |
| 43 | 3300003316 | rootH1_10003087 | rootH1_100030872 | 150 |
| 44 | 3300003322 | rootL2_10006881 | rootL2_1000688169 | 150 |
| 45 | 3300004803 | Ga0058862_12768848 | Ga0058862_127688482 | 150 |
| 46 | 3300005293 | Ga0065715_10543378 | Ga0065715_105433781 | 150 |
| 47 | 3300005295 | Ga0065707_10407728 | Ga0065707_104077281 | 150 |
| 48 | 3300005327 | Ga0070658_10086437 | Ga0070658_100864372 | 150 |
| 49 | 3300005327 | Ga0070658_10568366 | Ga0070658_105683662 | 150 |
| 50 | 3300005328 | Ga0070676_10248161 | Ga0070676_102481611 | 150 |
| 51 | 3300005329 | Ga0070683_100016080 | Ga0070683_1000160806 | 150 |
| 52 | 3300005329 | Ga0070683_100050873 | Ga0070683_1000508731 | 150 |
| 53 | 3300005330 | Ga0070690_100010989 | Ga0070690_1000109895 | 150 |
| 54 | 3300005331 | Ga0070670_100001604 | Ga0070670_10000160410 | 150 |
| 55 | 3300005331 | Ga0070670_100065752 | Ga0070670_1000657523 | 150 |
| 56 | 3300005331 | Ga0070670_100362000 | Ga0070670_1003620003 | 150 |
| 57 | 3300005333 | Ga0070677_10022435 | Ga0070677_100224353 | 150 |
| 58 | 3300005333 | Ga0070677_10085888 | Ga0070677_100858881 | 150 |
| 59 | 3300005333 | Ga0070677_10108940 | Ga0070677_101089402 | 150 |
| 60 | 3300005334 | Ga0068869_100008429 | Ga0068869_1000084294 | 150 |
| 61 | 3300005334 | Ga0068869_100525565 | Ga0068869_1005255652 | 150 |
| 62 | 3300005335 | Ga0070666_10014337 | Ga0070666_100143372 | 150 |
| 63 | 3300005337 | Ga0070682_100336064 | Ga0070682_1003360642 | 150 |
| 64 | 3300005337 | Ga0070682_100852599 | Ga0070682_1008525991 | 150 |
| 65 | 3300005338 | Ga0068868_100031078 | Ga0068868_1000310785 | 150 |
| 66 | 3300005338 | Ga0068868_101736066 | Ga0068868_1017360661 | 150 |
| 67 | 3300005339 | Ga0070660_100027971 | Ga0070660_1000279712 | 150 |
| 68 | 3300005339 | Ga0070660_100264577 | Ga0070660_1002645772 | 150 |
| 69 | 3300005343 | Ga0070687_100019887 | Ga0070687_1000198874 | 150 |
| 70 | 3300005343 | Ga0070687_100130126 | Ga0070687_1001301262 | 150 |
| 71 | 3300005344 | Ga0070661_100010873 | Ga0070661_1000108736 | 150 |
| 72 | 3300005344 | Ga0070661_100058505 | Ga0070661_1000585052 | 150 |
| 73 | 3300005344 | Ga0070661_100312617 | Ga0070661_1003126171 | 150 |
| 74 | 3300005347 | Ga0070668_100026477 | Ga0070668_1000264772 | 150 |
| 75 | 3300005353 | Ga0070669_100007169 | Ga0070669_1000071695 | 150 |
| 76 | 3300005353 | Ga0070669_100345945 | Ga0070669_1003459452 | 150 |
| 77 | 3300005354 | Ga0070675_100007056 | Ga0070675_10000705612 | 150 |
| 78 | 3300005354 | Ga0070675_100160886 | Ga0070675_1001608862 | 150 |
| 79 | 3300005354 | Ga0070675_100171072 | Ga0070675_1001710723 | 150 |
| 80 | 3300005354 | Ga0070675_100668740 | Ga0070675_1006687401 | 150 |
| 81 | 3300005355 | Ga0070671_100000303 | Ga0070671_10000030321 | 150 |
| 82 | 3300005355 | Ga0070671_100109068 | Ga0070671_1001090683 | 150 |
| 83 | 3300005356 | Ga0070674_100269738 | Ga0070674_1002697381 | 150 |
| 84 | 3300005356 | Ga0070674_100315977 | Ga0070674_1003159772 | 150 |
| 85 | 3300005364 | Ga0070673_100016440 | Ga0070673_1000164403 | 150 |
| 86 | 3300005364 | Ga0070673_100161392 | Ga0070673_1001613922 | 150 |
| 87 | 3300005364 | Ga0070673_100570380 | Ga0070673_1005703801 | 150 |
| 88 | 3300005366 | Ga0070659_100016323 | Ga0070659_1000163232 | 150 |
| 89 | 3300005366 | Ga0070659_100199767 | Ga0070659_1001997673 | 150 |
| 90 | 3300005366 | Ga0070659_100894767 | Ga0070659_1008947672 | 150 |
| 91 | 3300005367 | Ga0070667_100013229 | Ga0070667_1000132293 | 150 |
| 92 | 3300005435 | Ga0070714_100866774 | Ga0070714_1008667742 | 150 |
| 93 | 3300005438 | Ga0070701_10089038 | Ga0070701_100890383 | 150 |
| 94 | 3300005445 | Ga0070708_100538917 | Ga0070708_1005389172 | 150 |
| 95 | 3300005445 | Ga0070708_101774040 | Ga0070708_1017740401 | 150 |
| 96 | 3300005455 | Ga0070663_100029223 | Ga0070663_1000292234 | 150 |
| 97 | 3300005456 | Ga0070678_100024572 | Ga0070678_1000245726 | 150 |
| 98 | 3300005456 | Ga0070678_100032738 | Ga0070678_1000327384 | 150 |
| 99 | 3300005456 | Ga0070678_100032979 | Ga0070678_1000329795 | 150 |
| 100 | 3300005456 | Ga0070678_100134829 | Ga0070678_1001348292 | 150 |
| 101 | 3300005456 | Ga0070678_100877952 | Ga0070678_1008779522 | 150 |
| 102 | 3300005457 | Ga0070662_100033838 | Ga0070662_1000338384 | 150 |
| 103 | 3300005457 | Ga0070662_100184775 | Ga0070662_1001847752 | 150 |
| 104 | 3300005458 | Ga0070681_10255363 | Ga0070681_102553633 | 150 |
| 105 | 3300005459 | Ga0068867_100006850 | Ga0068867_1000068506 | 150 |
| 106 | 3300005459 | Ga0068867_100239911 | Ga0068867_1002399112 | 150 |
| 107 | 3300005459 | Ga0068867_100913290 | Ga0068867_1009132901 | 150 |
| 108 | 3300005466 | Ga0070685_10714675 | Ga0070685_107146751 | 150 |
| 109 | 3300005467 | Ga0070706_100003005 | Ga0070706_10000300512 | 150 |
| 110 | 3300005468 | Ga0070707_100031551 | Ga0070707_1000315512 | 150 |
| 111 | 3300005468 | Ga0070707_100597252 | Ga0070707_1005972522 | 150 |
| 112 | 3300005471 | Ga0070698_100097951 | Ga0070698_1000979512 | 150 |
| 113 | 3300005530 | Ga0070679_100461207 | Ga0070679_1004612073 | 150 |
| 114 | 3300005535 | Ga0070684_100009386 | Ga0070684_1000093866 | 150 |
| 115 | 3300005535 | Ga0070684_100229587 | Ga0070684_1002295873 | 150 |
| 116 | 3300005536 | Ga0070697_100800013 | Ga0070697_1008000131 | 150 |
| 117 | 3300005539 | Ga0068853_100250513 | Ga0068853_1002505132 | 150 |
| 118 | 3300005539 | Ga0068853_100795209 | Ga0068853_1007952091 | 150 |
| 119 | 3300005543 | Ga0070672_100029456 | Ga0070672_1000294562 | 150 |
| 120 | 3300005543 | Ga0070672_100029588 | Ga0070672_1000295883 | 150 |
| 121 | 3300005543 | Ga0070672_100031101 | Ga0070672_1000311012 | 150 |
| 122 | 3300005543 | Ga0070672_100119338 | Ga0070672_1001193383 | 150 |
| 123 | 3300005543 | Ga0070672_100480758 | Ga0070672_1004807582 | 150 |
| 124 | 3300005543 | Ga0070672_100867008 | Ga0070672_1008670082 | 150 |
| 125 | 3300005547 | Ga0070693_100101092 | Ga0070693_1001010923 | 150 |
| 126 | 3300005563 | Ga0068855_100121114 | Ga0068855_1001211143 | 150 |
| 127 | 3300005564 | Ga0070664_100043299 | Ga0070664_1000432992 | 150 |
| 128 | 3300005564 | Ga0070664_100045988 | Ga0070664_1000459884 | 150 |
| 129 | 3300005564 | Ga0070664_100074919 | Ga0070664_1000749191 | 150 |
| 130 | 3300005564 | Ga0070664_100357046 | Ga0070664_1003570462 | 150 |
| 131 | 3300005564 | Ga0070664_100887716 | Ga0070664_1008877162 | 150 |
| 132 | 3300005564 | Ga0070664_101149786 | Ga0070664_1011497862 | 150 |
| 133 | 3300005578 | Ga0068854_100008463 | Ga0068854_1000084634 | 150 |
| 134 | 3300005578 | Ga0068854_100125241 | Ga0068854_1001252412 | 150 |
| 135 | 3300005578 | Ga0068854_101137350 | Ga0068854_1011373502 | 150 |
| 136 | 3300005614 | Ga0068856_100099193 | Ga0068856_1000991933 | 150 |
| 137 | 3300005615 | Ga0070702_100195418 | Ga0070702_1001954183 | 150 |
| 138 | 3300005616 | Ga0068852_100001595 | Ga0068852_1000015952 | 150 |
| 139 | 3300005616 | Ga0068852_100002061 | Ga0068852_1000020616 | 150 |
| 140 | 3300005617 | Ga0068859_100066917 | Ga0068859_1000669172 | 150 |
| 141 | 3300005618 | Ga0068864_100003573 | Ga0068864_10000357313 | 150 |
| 142 | 3300005618 | Ga0068864_100481166 | Ga0068864_1004811662 | 150 |
| 143 | 3300005618 | Ga0068864_100566659 | Ga0068864_1005666592 | 150 |
| 144 | 3300005618 | Ga0068864_100686250 | Ga0068864_1006862502 | 150 |
| 145 | 3300005618 | Ga0068864_102266214 | Ga0068864_1022662141 | 150 |
| 146 | 3300005718 | Ga0068866_10004983 | Ga0068866_100049834 | 150 |
| 147 | 3300005719 | Ga0068861_100005957 | Ga0068861_1000059572 | 150 |
| 148 | 3300005834 | Ga0068851_10241428 | Ga0068851_102414282 | 150 |
| 149 | 3300005840 | Ga0068870_10443074 | Ga0068870_104430742 | 150 |
| 150 | 3300005841 | Ga0068863_100045605 | Ga0068863_1000456055 | 150 |
| 151 | 3300005841 | Ga0068863_100226129 | Ga0068863_1002261293 | 150 |
| 152 | 3300005841 | Ga0068863_100258391 | Ga0068863_1002583912 | 150 |
| 153 | 3300005842 | Ga0068858_100003921 | Ga0068858_10000392115 | 150 |
| 154 | 3300005842 | Ga0068858_100007342 | Ga0068858_1000073426 | 150 |
| 155 | 3300005842 | Ga0068858_100365358 | Ga0068858_1003653582 | 150 |
| 156 | 3300005843 | Ga0068860_100022335 | Ga0068860_1000223356 | 150 |
| 157 | 3300005843 | Ga0068860_100199310 | Ga0068860_1001993101 | 150 |
| 158 | 3300006028 | Ga0070717_10002211 | Ga0070717_100022112 | 150 |
| 159 | 3300006028 | Ga0070717_10157018 | Ga0070717_101570181 | 150 |
| 160 | 3300006028 | Ga0070717_11014055 | Ga0070717_110140551 | 150 |
| 161 | 3300006163 | Ga0070715_10150521 | Ga0070715_101505212 | 150 |
| 162 | 3300006173 | Ga0070716_100574399 | Ga0070716_1005743991 | 150 |
| 163 | 3300006195 | Ga0075366_10337421 | Ga0075366_103374212 | 150 |
| 164 | 3300006237 | Ga0097621_100169063 | Ga0097621_1001690631 | 150 |
| 165 | 3300006237 | Ga0097621_100367554 | Ga0097621_1003675542 | 150 |
| 166 | 3300006237 | Ga0097621_100736842 | Ga0097621_1007368422 | 150 |
| 167 | 3300006358 | Ga0068871_100124707 | Ga0068871_1001247073 | 150 |
| 168 | 3300006358 | Ga0068871_100138066 | Ga0068871_1001380662 | 150 |
| 169 | 3300006844 | Ga0075428_100099763 | Ga0075428_1000997633 | 150 |
| 170 | 3300006871 | Ga0075434_100436664 | Ga0075434_1004366641 | 150 |
| 171 | 3300006881 | Ga0068865_100001266 | Ga0068865_10000126611 | 150 |
| 172 | 3300006914 | Ga0075436_100003792 | Ga0075436_1000037926 | 150 |
| 173 | 3300006931 | Ga0097620_100066920 | Ga0097620_1000669202 | 150 |
| 174 | 3300007265 | Ga0099794_10073234 | Ga0099794_100732342 | 150 |
| 175 | 3300009093 | Ga0105240_10211117 | Ga0105240_102111172 | 150 |
| 176 | 3300009098 | Ga0105245_10096821 | Ga0105245_100968213 | 150 |
| 177 | 3300009098 | Ga0105245_10838295 | Ga0105245_108382952 | 150 |
| 178 | 3300009098 | Ga0105245_12392356 | Ga0105245_123923561 | 150 |
| 179 | 3300009101 | Ga0105247_10728450 | Ga0105247_107284502 | 150 |
| 180 | 3300009147 | Ga0114129_10096069 | Ga0114129_100960692 | 150 |
| 181 | 3300009148 | Ga0105243_10128680 | Ga0105243_101286802 | 150 |
| 182 | 3300009174 | Ga0105241_10505874 | Ga0105241_105058742 | 150 |
| 183 | 3300009174 | Ga0105241_11518489 | Ga0105241_115184891 | 150 |
| 184 | 3300009176 | Ga0105242_10039374 | Ga0105242_100393744 | 150 |
| 185 | 3300009176 | Ga0105242_10127443 | Ga0105242_101274433 | 150 |
| 186 | 3300009177 | Ga0105248_10017145 | Ga0105248_100171457 | 150 |
| 187 | 3300009177 | Ga0105248_10825000 | Ga0105248_108250002 | 150 |
| 188 | 3300009177 | Ga0105248_10875888 | Ga0105248_108758882 | 150 |
| 189 | 3300009177 | Ga0105248_10891398 | Ga0105248_108913982 | 150 |
| 190 | 3300009545 | Ga0105237_10237887 | Ga0105237_102378872 | 150 |
| 191 | 3300009551 | Ga0105238_10007534 | Ga0105238_100075347 | 150 |
| 192 | 3300009551 | Ga0105238_10210176 | Ga0105238_102101762 | 150 |
| 193 | 3300009551 | Ga0105238_10631796 | Ga0105238_106317962 | 150 |
| 194 | 3300009553 | Ga0105249_10008679 | Ga0105249_100086794 | 150 |
| 195 | 3300010375 | Ga0105239_10454890 | Ga0105239_104548902 | 150 |
| 196 | 3300011119 | Ga0105246_10475771 | Ga0105246_104757712 | 150 |
| 197 | 3300012506 | Ga0157324_1003865 | Ga0157324_10038652 | 150 |
| 198 | 3300013100 | Ga0157373_10091052 | Ga0157373_100910523 | 150 |
| 199 | 3300013105 | Ga0157369_10011093 | Ga0157369_100110933 | 150 |
| 200 | 3300013296 | Ga0157374_10045628 | Ga0157374_100456282 | 150 |
| 201 | 3300013296 | Ga0157374_10284897 | Ga0157374_102848972 | 150 |
| 202 | 3300013296 | Ga0157374_11270463 | Ga0157374_112704632 | 150 |
| 203 | 3300013297 | Ga0157378_10168418 | Ga0157378_101684183 | 150 |
| 204 | 3300013297 | Ga0157378_11181476 | Ga0157378_111814762 | 150 |
| 205 | 3300013306 | Ga0163162_10012386 | Ga0163162_100123866 | 150 |
| 206 | 3300013306 | Ga0163162_10160033 | Ga0163162_101600332 | 150 |
| 207 | 3300013307 | Ga0157372_10023908 | Ga0157372_100239082 | 150 |
| 208 | 3300013307 | Ga0157372_10294656 | Ga0157372_102946563 | 150 |
| 209 | 3300013307 | Ga0157372_11201027 | Ga0157372_112010271 | 150 |
| 210 | 3300013307 | Ga0157372_11361537 | Ga0157372_113615372 | 150 |
| 211 | 3300013307 | Ga0157372_11601261 | Ga0157372_116012612 | 150 |
| 212 | 3300013308 | Ga0157375_10008819 | Ga0157375_100088197 | 150 |
| 213 | 3300013308 | Ga0157375_10026773 | Ga0157375_100267735 | 150 |
| 214 | 3300013308 | Ga0157375_10391278 | Ga0157375_103912782 | 150 |
| 215 | 3300013308 | Ga0157375_10544884 | Ga0157375_105448842 | 150 |
| 216 | 3300013308 | Ga0157375_10553388 | Ga0157375_105533882 | 150 |
| 217 | 3300014325 | Ga0163163_10131339 | Ga0163163_101313392 | 150 |
| 218 | 3300014325 | Ga0163163_11220187 | Ga0163163_112201871 | 150 |
| 219 | 3300014326 | Ga0157380_10089533 | Ga0157380_100895333 | 150 |
| 220 | 3300014326 | Ga0157380_10095688 | Ga0157380_100956883 | 150 |
| 221 | 3300014326 | Ga0157380_11476105 | Ga0157380_114761052 | 150 |
| 222 | 3300014497 | Ga0182008_10158909 | Ga0182008_101589092 | 150 |
| 223 | 3300014497 | Ga0182008_10412183 | Ga0182008_104121832 | 150 |
| 224 | 3300014745 | Ga0157377_10509001 | Ga0157377_105090012 | 150 |
| 225 | 3300014968 | Ga0157379_10055705 | Ga0157379_100557052 | 150 |
| 226 | 3300014968 | Ga0157379_10057874 | Ga0157379_100578744 | 150 |
| 227 | 3300014968 | Ga0157379_10093887 | Ga0157379_100938873 | 150 |
| 228 | 3300014968 | Ga0157379_12150681 | Ga0157379_121506811 | 150 |
| 229 | 3300014969 | Ga0157376_10119850 | Ga0157376_101198504 | 150 |
| 230 | 3300015262 | Ga0182007_10024492 | Ga0182007_100244923 | 150 |
| 231 | 3300017792 | Ga0163161_10016938 | Ga0163161_100169383 | 150 |
| 232 | 3300017792 | Ga0163161_10489699 | Ga0163161_104896991 | 150 |
| 233 | 3300025245 | Ga0207425_1001940 | Ga0207425_10019402 | 150 |
| 234 | 3300025294 | Ga0209025_1000005 | Ga0209025_1000005840 | 150 |
| 235 | 3300025297 | Ga0209758_1011515 | Ga0209758_10115153 | 150 |
| 236 | 3300025315 | Ga0207697_10042308 | Ga0207697_100423083 | 150 |
| 237 | 3300025321 | Ga0207656_10030875 | Ga0207656_100308752 | 150 |
| 238 | 3300025321 | Ga0207656_10113334 | Ga0207656_101133342 | 150 |
| 239 | 3300025893 | Ga0207682_10026443 | Ga0207682_100264431 | 150 |
| 240 | 3300025899 | Ga0207642_10012121 | Ga0207642_100121214 | 150 |
| 241 | 3300025899 | Ga0207642_10014314 | Ga0207642_100143142 | 150 |
| 242 | 3300025901 | Ga0207688_10576759 | Ga0207688_105767592 | 150 |
| 243 | 3300025903 | Ga0207680_10048068 | Ga0207680_100480683 | 150 |
| 244 | 3300025903 | Ga0207680_10473062 | Ga0207680_104730621 | 150 |
| 245 | 3300025907 | Ga0207645_10022814 | Ga0207645_100228142 | 150 |
| 246 | 3300025908 | Ga0207643_10100473 | Ga0207643_101004733 | 150 |
| 247 | 3300025909 | Ga0207705_10018341 | Ga0207705_100183416 | 150 |
| 248 | 3300025909 | Ga0207705_10251704 | Ga0207705_102517042 | 150 |
| 249 | 3300025910 | Ga0207684_10008096 | Ga0207684_100080968 | 150 |
| 250 | 3300025911 | Ga0207654_10308537 | Ga0207654_103085372 | 150 |
| 251 | 3300025912 | Ga0207707_10216456 | Ga0207707_102164563 | 150 |
| 252 | 3300025913 | Ga0207695_10289337 | Ga0207695_102893372 | 150 |
| 253 | 3300025918 | Ga0207662_10021819 | Ga0207662_100218195 | 150 |
| 254 | 3300025918 | Ga0207662_10093750 | Ga0207662_100937502 | 150 |
| 255 | 3300025919 | Ga0207657_10026399 | Ga0207657_100263995 | 150 |
| 256 | 3300025919 | Ga0207657_10301007 | Ga0207657_103010072 | 150 |
| 257 | 3300025920 | Ga0207649_10021107 | Ga0207649_100211072 | 150 |
| 258 | 3300025920 | Ga0207649_10177605 | Ga0207649_101776053 | 150 |
| 259 | 3300025923 | Ga0207681_10003606 | Ga0207681_100036067 | 150 |
| 260 | 3300025925 | Ga0207650_10004217 | Ga0207650_100042175 | 150 |
| 261 | 3300025925 | Ga0207650_10104552 | Ga0207650_101045523 | 150 |
| 262 | 3300025925 | Ga0207650_10217943 | Ga0207650_102179433 | 150 |
| 263 | 3300025925 | Ga0207650_10924390 | Ga0207650_109243902 | 150 |
| 264 | 3300025925 | Ga0207650_11178209 | Ga0207650_111782092 | 150 |
| 265 | 3300025926 | Ga0207659_10053270 | Ga0207659_100532702 | 150 |
| 266 | 3300025926 | Ga0207659_10202111 | Ga0207659_102021112 | 150 |
| 267 | 3300025926 | Ga0207659_10269012 | Ga0207659_102690122 | 150 |
| 268 | 3300025926 | Ga0207659_10950147 | Ga0207659_109501472 | 150 |
| 269 | 3300025927 | Ga0207687_10321354 | Ga0207687_103213542 | 150 |
| 270 | 3300025928 | Ga0207700_10171241 | Ga0207700_101712412 | 150 |
| 271 | 3300025931 | Ga0207644_10000068 | Ga0207644_1000006838 | 150 |
| 272 | 3300025931 | Ga0207644_10054726 | Ga0207644_100547264 | 150 |
| 273 | 3300025932 | Ga0207690_10052875 | Ga0207690_100528752 | 150 |
| 274 | 3300025932 | Ga0207690_10165843 | Ga0207690_101658433 | 150 |
| 275 | 3300025932 | Ga0207690_10387673 | Ga0207690_103876732 | 150 |
| 276 | 3300025933 | Ga0207706_10007964 | Ga0207706_1000796412 | 150 |
| 277 | 3300025933 | Ga0207706_10016165 | Ga0207706_100161652 | 150 |
| 278 | 3300025934 | Ga0207686_10053035 | Ga0207686_100530353 | 150 |
| 279 | 3300025934 | Ga0207686_10505763 | Ga0207686_105057632 | 150 |
| 280 | 3300025934 | Ga0207686_10556552 | Ga0207686_105565522 | 150 |
| 281 | 3300025935 | Ga0207709_10318535 | Ga0207709_103185352 | 150 |
| 282 | 3300025935 | Ga0207709_10400998 | Ga0207709_104009982 | 150 |
| 283 | 3300025937 | Ga0207669_10019603 | Ga0207669_100196033 | 150 |
| 284 | 3300025938 | Ga0207704_10043559 | Ga0207704_100435594 | 150 |
| 285 | 3300025939 | Ga0207665_10533299 | Ga0207665_105332992 | 150 |
| 286 | 3300025940 | Ga0207691_10002959 | Ga0207691_100029595 | 150 |
| 287 | 3300025940 | Ga0207691_10027638 | Ga0207691_100276385 | 150 |
| 288 | 3300025940 | Ga0207691_10032454 | Ga0207691_100324545 | 150 |
| 289 | 3300025940 | Ga0207691_10042492 | Ga0207691_100424922 | 150 |
| 290 | 3300025940 | Ga0207691_10045783 | Ga0207691_100457834 | 150 |
| 291 | 3300025940 | Ga0207691_10134897 | Ga0207691_101348971 | 150 |
| 292 | 3300025941 | Ga0207711_10007769 | Ga0207711_100077694 | 150 |
| 293 | 3300025941 | Ga0207711_10058055 | Ga0207711_100580553 | 150 |
| 294 | 3300025941 | Ga0207711_11103642 | Ga0207711_111036421 | 150 |
| 295 | 3300025942 | Ga0207689_10008531 | Ga0207689_100085316 | 150 |
| 296 | 3300025944 | Ga0207661_10316560 | Ga0207661_103165602 | 150 |
| 297 | 3300025944 | Ga0207661_10667602 | Ga0207661_106676022 | 150 |
| 298 | 3300025945 | Ga0207679_10041448 | Ga0207679_100414481 | 150 |
| 299 | 3300025945 | Ga0207679_10145016 | Ga0207679_101450162 | 150 |
| 300 | 3300025945 | Ga0207679_10504530 | Ga0207679_105045302 | 150 |
| 301 | 3300025945 | Ga0207679_11093591 | Ga0207679_110935911 | 150 |
| 302 | 3300025960 | Ga0207651_10011189 | Ga0207651_100111895 | 150 |
| 303 | 3300025960 | Ga0207651_10053036 | Ga0207651_100530363 | 150 |
| 304 | 3300025960 | Ga0207651_10759512 | Ga0207651_107595121 | 150 |
| 305 | 3300025961 | Ga0207712_10008238 | Ga0207712_100082384 | 150 |
| 306 | 3300025972 | Ga0207668_10066118 | Ga0207668_100661183 | 150 |
| 307 | 3300025981 | Ga0207640_10021427 | Ga0207640_100214272 | 150 |
| 308 | 3300025981 | Ga0207640_10122033 | Ga0207640_101220333 | 150 |
| 309 | 3300025981 | Ga0207640_10636007 | Ga0207640_106360072 | 150 |
| 310 | 3300025986 | Ga0207658_10030079 | Ga0207658_100300792 | 150 |
| 311 | 3300025986 | Ga0207658_10073696 | Ga0207658_100736962 | 150 |
| 312 | 3300026023 | Ga0207677_10008027 | Ga0207677_100080272 | 150 |
| 313 | 3300026023 | Ga0207677_10023524 | Ga0207677_100235243 | 150 |
| 314 | 3300026023 | Ga0207677_10237757 | Ga0207677_102377573 | 150 |
| 315 | 3300026023 | Ga0207677_11239385 | Ga0207677_112393852 | 150 |
| 316 | 3300026035 | Ga0207703_10044598 | Ga0207703_100445983 | 150 |
| 317 | 3300026035 | Ga0207703_10260863 | Ga0207703_102608632 | 150 |
| 318 | 3300026035 | Ga0207703_10654563 | Ga0207703_106545632 | 150 |
| 319 | 3300026041 | Ga0207639_10030361 | Ga0207639_100303614 | 150 |
| 320 | 3300026041 | Ga0207639_10216292 | Ga0207639_102162923 | 150 |
| 321 | 3300026041 | Ga0207639_11470044 | Ga0207639_114700442 | 150 |
| 322 | 3300026067 | Ga0207678_10091779 | Ga0207678_100917793 | 150 |
| 323 | 3300026067 | Ga0207678_10832454 | Ga0207678_108324542 | 150 |
| 324 | 3300026075 | Ga0207708_10086908 | Ga0207708_100869081 | 150 |
| 325 | 3300026078 | Ga0207702_10060306 | Ga0207702_100603064 | 150 |
| 326 | 3300026088 | Ga0207641_10019792 | Ga0207641_100197925 | 150 |
| 327 | 3300026088 | Ga0207641_10235276 | Ga0207641_102352762 | 150 |
| 328 | 3300026089 | Ga0207648_10050360 | Ga0207648_100503605 | 150 |
| 329 | 3300026089 | Ga0207648_10533340 | Ga0207648_105333402 | 150 |
| 330 | 3300026089 | Ga0207648_10917210 | Ga0207648_109172102 | 150 |
| 331 | 3300026095 | Ga0207676_10009361 | Ga0207676_100093615 | 150 |
| 332 | 3300026095 | Ga0207676_10148260 | Ga0207676_101482602 | 150 |
| 333 | 3300026095 | Ga0207676_10228284 | Ga0207676_102282842 | 150 |
| 334 | 3300026095 | Ga0207676_10749518 | Ga0207676_107495181 | 150 |
| 335 | 3300026116 | Ga0207674_10025298 | Ga0207674_100252984 | 150 |
| 336 | 3300026118 | Ga0207675_100217928 | Ga0207675_1002179282 | 150 |
| 337 | 3300026118 | Ga0207675_100269669 | Ga0207675_1002696693 | 150 |
| 338 | 3300026121 | Ga0207683_10018583 | Ga0207683_100185836 | 150 |
| 339 | 3300026121 | Ga0207683_10103801 | Ga0207683_101038014 | 150 |
| 340 | 3300026121 | Ga0207683_10148015 | Ga0207683_101480151 | 150 |
| 341 | 3300026121 | Ga0207683_10298148 | Ga0207683_102981482 | 150 |
| 342 | 3300026121 | Ga0207683_10365742 | Ga0207683_103657422 | 150 |
| 343 | 3300026142 | Ga0207698_10079361 | Ga0207698_100793614 | 150 |
| 344 | 3300026142 | Ga0207698_10097318 | Ga0207698_100973183 | 150 |
| 345 | 3300026142 | Ga0207698_10126076 | Ga0207698_101260762 | 150 |
| 346 | 3300026142 | Ga0207698_11162798 | Ga0207698_111627982 | 150 |
| 347 | 3300027671 | Ga0209588_1039741 | Ga0209588_10397411 | 150 |
| 348 | 3300028380 | Ga0268265_10019957 | Ga0268265_100199575 | 150 |
| 349 | 3300028381 | Ga0268264_10012058 | Ga0268264_100120584 | 150 |
| 350 | 3300031251 | Ga0265327_10007663 | Ga0265327_100076635 | 150 |
| 351 | 3300031548 | Ga0307408_100000010 | Ga0307408_10000001077 | 150 |
| 352 | 3300031691 | Ga0316579_10146649 | Ga0316579_101466492 | 150 |
| 353 | 3300031691 | Ga0316579_10359411 | Ga0316579_103594112 | 150 |
| 354 | 3300031727 | Ga0316576_10511106 | Ga0316576_105111062 | 150 |
| 355 | 3300031728 | Ga0316578_10091000 | Ga0316578_100910002 | 150 |
| 356 | 3300031733 | Ga0316577_10005803 | Ga0316577_100058035 | 150 |
| 357 | 3300031901 | Ga0307406_10038198 | Ga0307406_100381982 | 150 |
| 358 | 3300032168 | Ga0316593_10005845 | Ga0316593_100058452 | 150 |
| 359 | 3300035084 | Ga0373928_0094962 | Ga0373928_0094962_194_646 | 150 |
| 360 | 3300035116 | Ga0373945_0044854 | Ga0373945_0044854_867_1319 | 150 |
| 361 | 3300035116 | Ga0373945_0088479 | Ga0373945_0088479_434_886 | 150 |
| 362 | 3300035117 | Ga0373953_0267782 | Ga0373953_0267782_106_558 | 150 |
| 363 | 3300035118 | Ga0373954_0361430 | Ga0373954_0361430_193_645 | 150 |
| 364 | 3300035170 | Ga0373943_0110249 | Ga0373943_0110249_596_1048 | 150 |
| 365 | 3300035171 | Ga0373946_0117217 | Ga0373946_0117217_601_1053 | 150 |
| 366 | 3300035410 | Ga0373924_0022601 | Ga0373924_0022601_469_921 | 150 |
| 367 | 3300035691 | Ga0373931_0061205 | Ga0373931_0061205_436_888 | 150 |
| 368 | 3300035695 | Ga0373927_0323425 | Ga0373927_0323425_299_751 | 150 |
| 369 | 3300035724 | Ga0373933_0298389 | Ga0373933_0298389_408_860 | 150 |
| 370 | 3300035725 | Ga0373947_0357676 | Ga0373947_0357676_10_462 | 150 |
| 371 | 3300036401 | Ga0373937_0040920 | Ga0373937_0040920_1084_1536 | 150 |
| 372 | 3300036401 | Ga0373937_0235793 | Ga0373937_0235793_294_746 | 150 |
| 373 | 3300036647 | Ga0316582_0038962 | Ga0316582_0038962_993_1448 | 150 |
| 374 | 3300036712 | Ga0316584_0091722 | Ga0316584_0091722_795_1250 | 150 |
| 375 | 3300037068 | Ga0373925_0083408 | Ga0373925_0083408_312_764 | 150 |
| 376 | 3300037068 | Ga0373925_0537334 | Ga0373925_0537334_19_471 | 150 |
| 377 | 3300037418 | Ga0395900_0289222 | Ga0395900_0289222_766_1230 | 150 |
| 378 | 3300037466 | Ga0395898_0770477 | Ga0395898_0770477_334_798 | 150 |
| 379 | 3300037588 | Ga0316581_0154004 | Ga0316581_0154004_128_583 | 150 |
| 380 | 3300041404 | Ga0439436_0013864 | Ga0439436_0013864_1697_2149 | 150 |
| 381 | 3300044712 | Ga0453684_0091441 | Ga0453684_0091441_2636_3091 | 150 |
| 382 | 3300044712 | Ga0453684_0704745 | Ga0453684_0704745_498_950 | 150 |
| 383 | 3300044842 | Ga0466957_0208784 | Ga0466957_0208784_641_1096 | 150 |
| 384 | 3300045051 | Ga0451576_0207179 | Ga0451576_0207179_1349_1801 | 150 |
| 385 | 3300045051 | Ga0451576_0340483 | Ga0451576_0340483_973_1428 | 150 |
| 386 | 3300046454 | Ga0495592_0157403 | Ga0495592_0157403_906_1358 | 150 |
| 387 | 3300046454 | Ga0495592_0598494 | Ga0495592_0598494_153_605 | 150 |
| 388 | 3300046458 | Ga0495591_136298 | Ga0495591_136298_126_578 | 150 |
| 389 | 3300046472 | Ga0495580_0584450 | Ga0495580_0584450_20_472 | 150 |
| 390 | 3300046473 | Ga0495582_0217120 | Ga0495582_0217120_174_626 | 150 |
| 391 | 3300046500 | Ga0495596_0020954 | Ga0495596_0020954_2052_2504 | 150 |
| 392 | 3300046507 | Ga0495606_0019524 | Ga0495606_0019524_3098_3550 | 150 |
| 393 | 3300046525 | Ga0495663_0102643 | Ga0495663_0102643_118_570 | 150 |
| 394 | 3300046528 | Ga0495642_0153962 | Ga0495642_0153962_287_739 | 150 |
| 395 | 3300046535 | Ga0495586_0166740 | Ga0495586_0166740_466_918 | 150 |
| 396 | 3300046539 | Ga0495621_0069998 | Ga0495621_0069998_617_1069 | 150 |
| 397 | 3300046539 | Ga0495621_0124371 | Ga0495621_0124371_185_637 | 150 |
| 398 | 3300046542 | Ga0495597_0110476 | Ga0495597_0110476_623_1075 | 150 |
| 399 | 3300046543 | Ga0495645_0112835 | Ga0495645_0112835_982_1434 | 150 |
| 400 | 3300046543 | Ga0495645_0230398 | Ga0495645_0230398_464_916 | 150 |
| 401 | 3300046559 | Ga0495667_0353487 | Ga0495667_0353487_173_625 | 150 |
| 402 | 3300046616 | Ga0495668_0000022 | Ga0495668_0000022_117565_118017 | 150 |
| 403 | 3300046683 | Ga0495658_0203578 | Ga0495658_0203578_360_812 | 150 |
| 404 | 3300046691 | Ga0495670_0260973 | Ga0495670_0260973_460_912 | 150 |
| 405 | 3300046694 | Ga0495649_0322881 | Ga0495649_0322881_55_507 | 150 |
| 406 | 3300047318 | Ga0495636_0001837 | Ga0495636_0001837_4639_5091 | 150 |
| 407 | 3300047323 | Ga0495683_0009835 | Ga0495683_0009835_856_1308 | 150 |
| 408 | 3300047447 | Ga0495685_020797 | Ga0495685_020797_1037_1489 | 150 |
| 409 | 3300048904 | Ga0496101_0509356 | Ga0496101_0509356_373_828 | 150 |
| 410 | 3300048907 | Ga0496104_0141413 | Ga0496104_0141413_1420_1872 | 150 |
| 411 | 3300048907 | Ga0496104_0478638 | Ga0496104_0478638_226_678 | 150 |
| 412 | 3300048909 | Ga0496106_0004171 | Ga0496106_0004171_9906_10358 | 150 |
| 413 | 3300048910 | Ga0496107_1233534 | Ga0496107_1233534_17_496 | 150 |
| 414 | 3300048911 | Ga0496108_0205009 | Ga0496108_0205009_46_498 | 150 |
| 415 | 3300048911 | Ga0496108_1077216 | Ga0496108_1077216_93_548 | 150 |
| 416 | 3300048912 | Ga0496109_0558379 | Ga0496109_0558379_190_642 | 150 |
| 417 | 3300048913 | Ga0496110_0179768 | Ga0496110_0179768_1437_1889 | 150 |
| 418 | 3300048913 | Ga0496110_0554823 | Ga0496110_0554823_420_872 | 150 |
| 419 | 3300048915 | Ga0496112_0089634 | Ga0496112_0089634_1073_1528 | 150 |
| 420 | 3300048916 | Ga0496113_0160729 | Ga0496113_0160729_289_741 | 150 |
| 421 | 3300048917 | Ga0496114_0241221 | Ga0496114_0241221_884_1336 | 150 |
| 422 | 3300048918 | Ga0496115_0034359 | Ga0496115_0034359_659_1111 | 150 |
| 423 | 3300050493 | nmdc:mga0k408_542266_c1 | nmdc:mga0k408_542266_c1_135_587 | 150 |
| 424 | 3300050508 | nmdc:mga09592_874812_c1 | nmdc:mga09592_874812_c1_281_733 | 150 |
| 425 | 3300050510 | nmdc:mga06r32_154893_c1 | nmdc:mga06r32_154893_c1_1649_2101 | 150 |
| 426 | 3300050512 | nmdc:mga0n895_558887_c1 | nmdc:mga0n895_558887_c1_651_1103 | 150 |
| 427 | 3300050513 | nmdc:mga0rr50_212124_c1 | nmdc:mga0rr50_212124_c1_1097_1549 | 150 |
| 428 | 3300050515 | nmdc:mga0a205_356496_c1 | nmdc:mga0a205_356496_c1_48_500 | 150 |
| 429 | 3300053077 | Ga0495601_0121624 | Ga0495601_0121624_140_592 | 150 |
| 430 | 3300053083 | Ga0495655_0252971 | Ga0495655_0252971_38_490 | 150 |
| 431 | 3300053084 | Ga0495595_0117305 | Ga0495595_0117305_345_797 | 150 |
| 432 | 3300053085 | Ga0495619_0417923 | Ga0495619_0417923_223_675 | 150 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6j0b-assembly1.cif.gz_a | cryo-em structure of an extracellular contractile injection system, pvc sheath-tube complex in extended state | 0.8063 | 8 | 150 |
| 7adz-assembly1.cif.gz_1a | cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the cap portion in extended state. | 0.7786 | 7 | 150 |
| 6j0f-assembly1.cif.gz_a | cryo-em structure of an extracellular contractile injection system, pvc sheath/tube terminator in extended state | 0.7619 | 7 | 150 |
| 7adz-assembly1.cif.gz_1a | cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the cap portion in extended state. | 0.7591 | 7 | 150 |
| 7b5h-assembly1.cif.gz_AN | cryo-em structure of the contractile injection system base plate from anabaena pcc7120 | 0.7585 | 5 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1y12B00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like | 0.6699 | 14 | 149 | 2.30.110.20 |
| af_A0A1D6MBR1_179_244_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.666 | 66 | 143 | 3.30.200.20 |
| 3eaaB00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like | 0.6384 | 11 | 149 | 2.30.110.20 |
| 4hkhG00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like | 0.6374 | 12 | 149 | 2.30.110.20 |
| 5xhhA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like | 0.6331 | 14 | 149 | 2.30.110.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M1E306-F1-model_v4 | Phage tail protein | 0.8986 | 68 | 150 |
GO:0005198
|
| AF-A0A486XPI5-F1-model_v4 | Phage tail protein | 0.8931 | 94 | 150 |
GO:0005198
|
| AF-A0A5M3Y8P0-F1-model_v4 | deleted | 0.8809 | 65 | 150 |
|
| AF-A0A3M1E306-F1-model_v4 | Phage tail protein | 0.879 | 68 | 150 |
GO:0005198
|
| AF-A0A2W5LGN3-F1-model_v4 | deleted | 0.8708 | 12 | 146 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar