F442588

General Info

Members Datasets Scaffolds Average Seq Length
432 252 431 150

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10875888|Ga0105248_108758882
Length 165
Sequence MRREFRRPNAMREIEMAVMRDRPYPQFNFLVDLGTGSTDGPQAGFQEVSAISTEVTVVEYRNGNSKENGPIKITGLNKASDVTMKRGVIGALDLYSWLNDIRNGNQNALRTVTIQLQNEDHSQVVQTWKLLRARIVKHTSGPLNARGSDVAIEEMVLAYERLELE

Samples

Sample ID Description Type Environment
1 2643221593 Lysobacter sp. Root690 Isolate Unclassified
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
167 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
168 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
179 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
180 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
191 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
196 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
197 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
198 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
211 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
214 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
219 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
220 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
221 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
224 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
249 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0.69
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.62
Nodule 0
Rhizoplane 3.24
Rhizosphere 93.98
Stem 0
Stem Tuber 0
Unclassified 1.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000283 3300003187 Bacteria 57989
2 rootH1_10003087 3300003316 Bacteria 52943
3 rootL2_10006881 3300003322 Bacteria 64959
4 Ga0058862_11809141 3300004803 Bacteria 984
5 Ga0058862_12768848 3300004803 Bacteria 716
6 Ga0065715_10543378 3300005293 Bacteria 746
7 Ga0065707_10407728 3300005295 Bacteria 845
8 Ga0070658_10086437 3300005327 Bacteria 2580
9 Ga0070658_10180575 3300005327 Bacteria 1776
10 Ga0070658_10568366 3300005327 Bacteria 982
11 Ga0070676_10248161 3300005328 Bacteria 1187
12 Ga0070683_100016080 3300005329 Bacteria 6585
13 Ga0070683_100050873 3300005329 Bacteria 3837
14 Ga0070690_100010989 3300005330 Bacteria 5286
15 Ga0070670_100001604 3300005331 Bacteria 18269
16 Ga0070670_100065752 3300005331 Bacteria 3111
17 Ga0070670_100362000 3300005331 Bacteria 1276
18 Ga0070677_10022435 3300005333 Bacteria 2325
19 Ga0070677_10085888 3300005333 Bacteria 1358
20 Ga0070677_10108940 3300005333 Bacteria 1233
21 Ga0068869_100008429 3300005334 Bacteria 6646
22 Ga0068869_100525565 3300005334 Bacteria 991
23 Ga0070666_10014337 3300005335 Bacteria 5046
24 Ga0070682_100336064 3300005337 Bacteria 1121
25 Ga0070682_100852599 3300005337 Bacteria 745
26 Ga0068868_100031078 3300005338 Bacteria 4098
27 Ga0068868_101736066 3300005338 Unclassified 589
28 Ga0070660_100027971 3300005339 Bacteria 4214
29 Ga0070660_100264577 3300005339 Bacteria 1405
30 Ga0070687_100019887 3300005343 Bacteria 3131
31 Ga0070687_100130126 3300005343 Bacteria 1452
32 Ga0070661_100010873 3300005344 Bacteria 6339
33 Ga0070661_100058505 3300005344 Bacteria 2825
34 Ga0070661_100312617 3300005344 Bacteria 1225
35 Ga0070668_100026477 3300005347 Bacteria 4401
36 Ga0070669_100007169 3300005353 Bacteria 8010
37 Ga0070669_100345945 3300005353 Bacteria 1206
38 Ga0070675_100007056 3300005354 Bacteria 8642
39 Ga0070675_100160886 3300005354 Bacteria 1931
40 Ga0070675_100171072 3300005354 Bacteria 1873
41 Ga0070675_100668740 3300005354 Bacteria 944
42 Ga0070671_100000303 3300005355 Bacteria 33412
43 Ga0070671_100109068 3300005355 Bacteria 2324
44 Ga0070674_100269738 3300005356 Bacteria 1344
45 Ga0070674_100315977 3300005356 Bacteria 1250
46 Ga0070673_100016440 3300005364 Bacteria 5232
47 Ga0070673_100161392 3300005364 Bacteria 1906
48 Ga0070673_100570380 3300005364 Bacteria 1030
49 Ga0070659_100016323 3300005366 Bacteria 5573
50 Ga0070659_100199767 3300005366 Bacteria 1645
51 Ga0070659_100894767 3300005366 Bacteria 776
52 Ga0070667_100013229 3300005367 Bacteria 6818
53 Ga0070667_100273917 3300005367 Bacteria 1514
54 Ga0070714_100866774 3300005435 Unclassified 876
55 Ga0070701_10089038 3300005438 Bacteria 1687
56 Ga0070708_100538917 3300005445 Unclassified 1101
57 Ga0070708_101774040 3300005445 Unclassified 573
58 Ga0070663_100029223 3300005455 Bacteria 3763
59 Ga0070678_100024572 3300005456 Bacteria 4037
60 Ga0070678_100032738 3300005456 Bacteria 3601
61 Ga0070678_100032979 3300005456 Bacteria 3590
62 Ga0070678_100134829 3300005456 Bacteria 1968
63 Ga0070678_100877952 3300005456 Bacteria 819
64 Ga0070662_100033838 3300005457 Bacteria 3601
65 Ga0070662_100184775 3300005457 Bacteria 1645
66 Ga0070681_10255363 3300005458 Bacteria 1665
67 Ga0070681_10301919 3300005458 Bacteria 1511
68 Ga0068867_100006850 3300005459 Bacteria 8058
69 Ga0068867_100239911 3300005459 Bacteria 1469
70 Ga0068867_100913290 3300005459 Bacteria 791
71 Ga0070685_10714675 3300005466 Bacteria 732
72 Ga0070706_100003005 3300005467 Bacteria 16716
73 Ga0070707_100031551 3300005468 Bacteria 5048
74 Ga0070707_100597252 3300005468 Bacteria 1066
75 Ga0070698_100097951 3300005471 Bacteria 2908
76 Ga0070698_100907021 3300005471 Unclassified 827
77 Ga0070679_100461207 3300005530 Unclassified 1215
78 Ga0070679_101014411 3300005530 Bacteria 774
79 Ga0070684_100009386 3300005535 Bacteria 7703
80 Ga0070684_100229587 3300005535 Bacteria 1694
81 Ga0070697_100800013 3300005536 Bacteria 834
82 Ga0068853_100250513 3300005539 Bacteria 1625
83 Ga0068853_100795209 3300005539 Bacteria 906
84 Ga0070672_100029456 3300005543 Bacteria 4117
85 Ga0070672_100029588 3300005543 Bacteria 4109
86 Ga0070672_100031101 3300005543 Bacteria 4015
87 Ga0070672_100119338 3300005543 Bacteria 2157
88 Ga0070672_100480758 3300005543 Bacteria 1072
89 Ga0070672_100867008 3300005543 Bacteria 796
90 Ga0070693_100101092 3300005547 Bacteria 1756
91 Ga0068855_100121114 3300005563 Bacteria 2994
92 Ga0070664_100043299 3300005564 Bacteria 3798
93 Ga0070664_100045988 3300005564 Bacteria 3686
94 Ga0070664_100074919 3300005564 Bacteria 2905
95 Ga0070664_100357046 3300005564 Bacteria 1330
96 Ga0070664_100887716 3300005564 Bacteria 836
97 Ga0070664_101149786 3300005564 Bacteria 732
98 Ga0068854_100008463 3300005578 Bacteria 6615
99 Ga0068854_100125241 3300005578 Bacteria 1956
100 Ga0068854_101137350 3300005578 Unclassified 697
101 Ga0068856_100099193 3300005614 Bacteria 2903
102 Ga0070702_100195418 3300005615 Bacteria 1335
103 Ga0068852_100001595 3300005616 Bacteria 15432
104 Ga0068852_100002061 3300005616 Bacteria 13712
105 Ga0068859_100066917 3300005617 Bacteria 3628
106 Ga0068864_100003573 3300005618 Bacteria 12853
107 Ga0068864_100481166 3300005618 Bacteria 1192
108 Ga0068864_100566659 3300005618 Bacteria 1099
109 Ga0068864_100686250 3300005618 Bacteria 999
110 Ga0068864_102266214 3300005618 Bacteria 550
111 Ga0068866_10004983 3300005718 Bacteria 5466
112 Ga0068861_100005957 3300005719 Bacteria 8281
113 Ga0068851_10241428 3300005834 Bacteria 1022
114 Ga0068870_10443074 3300005840 Bacteria 855
115 Ga0068863_100045605 3300005841 Bacteria 4160
116 Ga0068863_100065796 3300005841 Bacteria 3430
117 Ga0068863_100226129 3300005841 Bacteria 1804
118 Ga0068863_100258391 3300005841 Bacteria 1683
119 Ga0068858_100003921 3300005842 Bacteria 14698
120 Ga0068858_100007342 3300005842 Bacteria 10666
121 Ga0068858_100365358 3300005842 Bacteria 1383
122 Ga0068860_100022335 3300005843 Bacteria 6121
123 Ga0068860_100199310 3300005843 Bacteria 1939
124 Ga0070717_10002211 3300006028 Bacteria 13677
125 Ga0070717_10157018 3300006028 Bacteria 1971
126 Ga0070717_11014055 3300006028 Unclassified 756
127 Ga0070715_10150521 3300006163 Bacteria 1140
128 Ga0070716_100574399 3300006173 Unclassified 844
129 Ga0075366_10337421 3300006195 Bacteria 924
130 Ga0097621_100169063 3300006237 Bacteria 1883
131 Ga0097621_100367554 3300006237 Bacteria 1283
132 Ga0097621_100736842 3300006237 Bacteria 909
133 Ga0068871_100124707 3300006358 Bacteria 2178
134 Ga0068871_100138066 3300006358 Bacteria 2071
135 Ga0075428_100099763 3300006844 Bacteria 3166
136 Ga0075434_100436664 3300006871 Unclassified 1330
137 Ga0068865_100001266 3300006881 Bacteria 14725
138 Ga0075436_100003792 3300006914 Bacteria 10366
139 Ga0097620_100066920 3300006931 Bacteria 3628
140 Ga0099794_10073234 3300007265 Unclassified 1681
141 Ga0105240_10211117 3300009093 Bacteria 2269
142 Ga0111539_10197671 3300009094 Unclassified 2345
143 Ga0111539_12327172 3300009094 Bacteria 622
144 Ga0105245_10096821 3300009098 Bacteria 2724
145 Ga0105245_10838295 3300009098 Bacteria 959
146 Ga0105245_12392356 3300009098 Bacteria 582
147 Ga0105247_10728450 3300009101 Bacteria 749
148 Ga0114129_10096069 3300009147 Bacteria 4103
149 Ga0105243_10128680 3300009148 Bacteria 2145
150 Ga0105241_10505874 3300009174 Bacteria 1078
151 Ga0105241_11518489 3300009174 Bacteria 645
152 Ga0105242_10039374 3300009176 Bacteria 3804
153 Ga0105242_10127443 3300009176 Bacteria 2193
154 Ga0105248_10017145 3300009177 Bacteria 7979
155 Ga0105248_10825000 3300009177 Bacteria 1047
156 Ga0105248_10875888 3300009177 Bacteria 1014
157 Ga0105248_10891398 3300009177 Bacteria 1004
158 Ga0105237_10237887 3300009545 Bacteria 1822
159 Ga0105238_10007534 3300009551 Bacteria 10902
160 Ga0105238_10210176 3300009551 Bacteria 1922
161 Ga0105238_10631796 3300009551 Bacteria 1080
162 Ga0105249_10008679 3300009553 Bacteria 8855
163 Ga0105239_10454890 3300010375 Bacteria 1453
164 Ga0105246_10475771 3300011119 Bacteria 1055
165 Ga0157324_1003865 3300012506 Bacteria 1006
166 Ga0157373_10091052 3300013100 Bacteria 2148
167 Ga0157369_10011093 3300013105 Bacteria 10252
168 Ga0157374_10045628 3300013296 Bacteria 4056
169 Ga0157374_10069437 3300013296 Bacteria 3317
170 Ga0157374_10284897 3300013296 Bacteria 1632
171 Ga0157374_11270463 3300013296 Bacteria 758
172 Ga0157378_10168418 3300013297 Bacteria 2053
173 Ga0157378_11181476 3300013297 Bacteria 804
174 Ga0163162_10012386 3300013306 Bacteria 8328
175 Ga0163162_10160033 3300013306 Bacteria 2373
176 Ga0157372_10023908 3300013307 Bacteria 6630
177 Ga0157372_10294656 3300013307 Bacteria 1887
178 Ga0157372_11201027 3300013307 Bacteria 876
179 Ga0157372_11361537 3300013307 Bacteria 818
180 Ga0157372_11601261 3300013307 Bacteria 750
181 Ga0157375_10008819 3300013308 Bacteria 8831
182 Ga0157375_10026773 3300013308 Bacteria 5380
183 Ga0157375_10033677 3300013308 Bacteria 4872
184 Ga0157375_10391278 3300013308 Bacteria 1557
185 Ga0157375_10544884 3300013308 Bacteria 1322
186 Ga0157375_10553388 3300013308 Bacteria 1312
187 Ga0157375_11832882 3300013308 Bacteria 719
188 Ga0163163_10131339 3300014325 Bacteria 2545
189 Ga0163163_11220187 3300014325 Bacteria 815
190 Ga0157380_10089533 3300014326 Bacteria 2535
191 Ga0157380_10095688 3300014326 Bacteria 2461
192 Ga0157380_11476105 3300014326 Bacteria 732
193 Ga0182008_10158909 3300014497 Bacteria 1136
194 Ga0182008_10412183 3300014497 Bacteria 728
195 Ga0157377_10509001 3300014745 Bacteria 843
196 Ga0157379_10055705 3300014968 Bacteria 3533
197 Ga0157379_10057874 3300014968 Bacteria 3464
198 Ga0157379_10093887 3300014968 Bacteria 2692
199 Ga0157379_12150681 3300014968 Bacteria 554
200 Ga0157376_10053876 3300014969 Bacteria 3352
201 Ga0157376_10119850 3300014969 Bacteria 2330
202 Ga0182007_10024492 3300015262 Bacteria 2111
203 Ga0163161_10016938 3300017792 Bacteria 5095
204 Ga0163161_10489699 3300017792 Unclassified 1000
205 Ga0207425_1001940 3300025245 Bacteria 7785
206 Ga0209025_1000005 3300025294 Bacteria 1272149
207 Ga0209758_1011515 3300025297 Bacteria 5108
208 Ga0207697_10042308 3300025315 Bacteria 1872
209 Ga0207656_10030875 3300025321 Bacteria 2216
210 Ga0207656_10113334 3300025321 Bacteria 1255
211 Ga0207682_10026443 3300025893 Bacteria 2307
212 Ga0207642_10012121 3300025899 Bacteria 3101
213 Ga0207642_10014314 3300025899 Bacteria 2924
214 Ga0207688_10576759 3300025901 Bacteria 708
215 Ga0207680_10048068 3300025903 Bacteria 2532
216 Ga0207680_10473062 3300025903 Bacteria 891
217 Ga0207645_10022814 3300025907 Bacteria 4069
218 Ga0207643_10100473 3300025908 Bacteria 1696
219 Ga0207705_10018341 3300025909 Bacteria 5004
220 Ga0207705_10251704 3300025909 Bacteria 1347
221 Ga0207684_10008096 3300025910 Bacteria 9371
222 Ga0207654_10308537 3300025911 Bacteria 1078
223 Ga0207707_10216456 3300025912 Bacteria 1668
224 Ga0207707_10284780 3300025912 Bacteria 1431
225 Ga0207695_10289337 3300025913 Bacteria 1531
226 Ga0207662_10021819 3300025918 Bacteria 3664
227 Ga0207662_10093750 3300025918 Bacteria 1850
228 Ga0207657_10026399 3300025919 Bacteria 5339
229 Ga0207657_10301007 3300025919 Bacteria 1270
230 Ga0207649_10021107 3300025920 Bacteria 3743
231 Ga0207649_10177605 3300025920 Bacteria 1488
232 Ga0207652_10238255 3300025921 Bacteria 1640
233 Ga0207681_10003606 3300025923 Bacteria 9635
234 Ga0207650_10004217 3300025925 Bacteria 9818
235 Ga0207650_10104552 3300025925 Bacteria 2185
236 Ga0207650_10217943 3300025925 Bacteria 1535
237 Ga0207650_10924390 3300025925 Bacteria 741
238 Ga0207650_11178209 3300025925 Bacteria 652
239 Ga0207659_10053270 3300025926 Bacteria 2885
240 Ga0207659_10202111 3300025926 Bacteria 1588
241 Ga0207659_10269012 3300025926 Bacteria 1389
242 Ga0207659_10950147 3300025926 Bacteria 739
243 Ga0207687_10321354 3300025927 Bacteria 1253
244 Ga0207700_10171241 3300025928 Unclassified 1812
245 Ga0207644_10000068 3300025931 Bacteria 76090
246 Ga0207644_10054726 3300025931 Bacteria 2875
247 Ga0207690_10052875 3300025932 Bacteria 2722
248 Ga0207690_10165843 3300025932 Bacteria 1651
249 Ga0207690_10387673 3300025932 Bacteria 1112
250 Ga0207706_10007964 3300025933 Bacteria 9783
251 Ga0207706_10016165 3300025933 Bacteria 6741
252 Ga0207686_10053035 3300025934 Bacteria 2534
253 Ga0207686_10505763 3300025934 Bacteria 938
254 Ga0207686_10556552 3300025934 Bacteria 897
255 Ga0207709_10318535 3300025935 Bacteria 1163
256 Ga0207709_10400998 3300025935 Bacteria 1049
257 Ga0207669_10019603 3300025937 Bacteria 3526
258 Ga0207704_10043559 3300025938 Bacteria 2652
259 Ga0207665_10533299 3300025939 Bacteria 910
260 Ga0207691_10002959 3300025940 Bacteria 16591
261 Ga0207691_10027638 3300025940 Bacteria 5318
262 Ga0207691_10032454 3300025940 Bacteria 4867
263 Ga0207691_10042492 3300025940 Bacteria 4190
264 Ga0207691_10045783 3300025940 Bacteria 4021
265 Ga0207691_10134897 3300025940 Bacteria 2178
266 Ga0207711_10007769 3300025941 Bacteria 8961
267 Ga0207711_10058055 3300025941 Bacteria 3328
268 Ga0207711_11103642 3300025941 Bacteria 734
269 Ga0207689_10008531 3300025942 Bacteria 8933
270 Ga0207661_10316560 3300025944 Bacteria 1402
271 Ga0207661_10667602 3300025944 Bacteria 955
272 Ga0207679_10041448 3300025945 Bacteria 3301
273 Ga0207679_10145016 3300025945 Bacteria 1924
274 Ga0207679_10504530 3300025945 Bacteria 1080
275 Ga0207679_11093591 3300025945 Bacteria 731
276 Ga0207651_10011189 3300025960 Bacteria 5010
277 Ga0207651_10053036 3300025960 Bacteria 2769
278 Ga0207651_10759512 3300025960 Bacteria 857
279 Ga0207712_10008238 3300025961 Bacteria 6587
280 Ga0207668_10066118 3300025972 Bacteria 2561
281 Ga0207640_10021427 3300025981 Bacteria 3851
282 Ga0207640_10122033 3300025981 Bacteria 1869
283 Ga0207640_10636007 3300025981 Bacteria 907
284 Ga0207658_10030079 3300025986 Bacteria 3841
285 Ga0207658_10073696 3300025986 Bacteria 2592
286 Ga0207677_10008027 3300026023 Bacteria 5875
287 Ga0207677_10023524 3300026023 Bacteria 3809
288 Ga0207677_10237757 3300026023 Bacteria 1471
289 Ga0207677_11239385 3300026023 Bacteria 684
290 Ga0207703_10044598 3300026035 Bacteria 3565
291 Ga0207703_10260863 3300026035 Bacteria 1566
292 Ga0207703_10654563 3300026035 Bacteria 997
293 Ga0207639_10030361 3300026041 Bacteria 3963
294 Ga0207639_10216292 3300026041 Bacteria 1652
295 Ga0207639_11470044 3300026041 Bacteria 640
296 Ga0207678_10091779 3300026067 Bacteria 2596
297 Ga0207678_10832454 3300026067 Bacteria 815
298 Ga0207708_10086908 3300026075 Bacteria 2407
299 Ga0207702_10060306 3300026078 Bacteria 3234
300 Ga0207641_10019792 3300026088 Bacteria 5525
301 Ga0207641_10235276 3300026088 Bacteria 1704
302 Ga0207648_10050360 3300026089 Bacteria 3642
303 Ga0207648_10533340 3300026089 Bacteria 1076
304 Ga0207648_10917210 3300026089 Unclassified 819
305 Ga0207648_11349767 3300026089 Bacteria 670
306 Ga0207676_10009361 3300026095 Bacteria 6972
307 Ga0207676_10148260 3300026095 Bacteria 2017
308 Ga0207676_10228284 3300026095 Bacteria 1662
309 Ga0207676_10749518 3300026095 Bacteria 949
310 Ga0207674_10015468 3300026116 Bacteria 8381
311 Ga0207674_10025298 3300026116 Bacteria 6334
312 Ga0207675_100217928 3300026118 Bacteria 1838
313 Ga0207675_100269669 3300026118 Bacteria 1651
314 Ga0207683_10018583 3300026121 Bacteria 5932
315 Ga0207683_10103801 3300026121 Bacteria 2540
316 Ga0207683_10148015 3300026121 Bacteria 2119
317 Ga0207683_10298148 3300026121 Bacteria 1475
318 Ga0207683_10365742 3300026121 Bacteria 1325
319 Ga0207698_10079361 3300026142 Bacteria 2640
320 Ga0207698_10097318 3300026142 Bacteria 2428
321 Ga0207698_10126076 3300026142 Bacteria 2178
322 Ga0207698_10423514 3300026142 Bacteria 1278
323 Ga0207698_11162798 3300026142 Bacteria 785
324 Ga0209588_1039741 3300027671 Unclassified 1517
325 Ga0268265_10019957 3300028380 Bacteria 4669
326 Ga0268264_10012058 3300028381 Bacteria 7116
327 Ga0307515_10000178 3300028794 Bacteria 157107
328 Ga0265327_10007663 3300031251 Bacteria 8268
329 Ga0307408_100000010 3300031548 Bacteria 420048
330 Ga0307408_100308649 3300031548 Bacteria 1328
331 Ga0316579_10146649 3300031691 Bacteria 1138
332 Ga0316579_10359411 3300031691 Bacteria 704
333 Ga0316576_10511106 3300031727 Bacteria 883
334 Ga0316578_10091000 3300031728 Bacteria 1822
335 Ga0307405_10171238 3300031731 Bacteria 1549
336 Ga0316577_10005803 3300031733 Bacteria 6495
337 Ga0307406_10019744 3300031901 Bacteria 3959
338 Ga0307406_10038198 3300031901 Bacteria 2970
339 Ga0307407_10613608 3300031903 Bacteria 811
340 Ga0307412_10018714 3300031911 Bacteria 4176
341 Ga0307409_100000931 3300031995 Bacteria 13613
342 Ga0307416_100002618 3300032002 Bacteria 10401
343 Ga0307415_100881450 3300032126 Bacteria 823
344 Ga0316593_10005845 3300032168 Bacteria 3281
345 Ga0373928_0094962 3300035084 Bacteria 770
346 Ga0373945_0044854 3300035116 Bacteria 1609
347 Ga0373945_0088479 3300035116 Bacteria 1196
348 Ga0373953_0267782 3300035117 Bacteria 744
349 Ga0373954_0361430 3300035118 Bacteria 717
350 Ga0373943_0110249 3300035170 Bacteria 1451
351 Ga0373946_0117217 3300035171 Bacteria 1212
352 Ga0373924_0022601 3300035410 Bacteria 2459
353 Ga0373931_0061205 3300035691 Bacteria 2029
354 Ga0373927_0323425 3300035695 Bacteria 1016
355 Ga0373933_0298389 3300035724 Bacteria 1043
356 Ga0373947_0357676 3300035725 Bacteria 980
357 Ga0373937_0040920 3300036401 Bacteria 4226
358 Ga0373937_0235793 3300036401 Bacteria 1723
359 Ga0316582_0038962 3300036647 Bacteria 2957
360 Ga0316584_0091722 3300036712 Bacteria 2274
361 Ga0373925_0083408 3300037068 Bacteria 2434
362 Ga0373925_0537334 3300037068 Bacteria 961
363 Ga0395900_0289222 3300037418 Bacteria 1628
364 Ga0395898_0770477 3300037466 Bacteria 903
365 Ga0316581_0154004 3300037588 Unclassified 708
366 Ga0400490_44662 3300038726 Bacteria 23632
367 Ga0439436_0013864 3300041404 Bacteria 2436
368 Ga0439455_0075449 3300042012 Bacteria 911
369 Ga0466963_0155916 3300044694 Bacteria 1587
370 Ga0453684_0091441 3300044712 Bacteria 3756
371 Ga0453684_0704745 3300044712 Bacteria 1097
372 Ga0466957_0208784 3300044842 Unclassified 1285
373 Ga0451576_0207179 3300045051 Bacteria 2047
374 Ga0451576_0340483 3300045051 Unclassified 1570
375 Ga0495592_0157403 3300046454 Bacteria 1566
376 Ga0495592_0598494 3300046454 Bacteria 673
377 Ga0495591_136298 3300046458 Bacteria 594
378 Ga0495580_0316581 3300046472 Bacteria 1061
379 Ga0495580_0584450 3300046472 Unclassified 739
380 Ga0495582_0217120 3300046473 Bacteria 1094
381 Ga0495594_0377614 3300046499 Bacteria 807
382 Ga0495596_0020954 3300046500 Bacteria 2672
383 Ga0495606_0019524 3300046507 Bacteria 5037
384 Ga0495663_0102643 3300046525 Bacteria 943
385 Ga0495642_0153962 3300046528 Bacteria 995
386 Ga0495586_0166740 3300046535 Bacteria 1244
387 Ga0495621_0069998 3300046539 Bacteria 1291
388 Ga0495621_0124371 3300046539 Bacteria 999
389 Ga0495597_0110476 3300046542 Bacteria 1153
390 Ga0495645_0112835 3300046543 Bacteria 1922
391 Ga0495645_0230398 3300046543 Bacteria 1241
392 Ga0495667_0353487 3300046559 Bacteria 928
393 Ga0495668_0000022 3300046616 Bacteria 363999
394 Ga0495658_0203578 3300046683 Bacteria 1234
395 Ga0495670_0260973 3300046691 Bacteria 925
396 Ga0495649_0322881 3300046694 Bacteria 783
397 Ga0495636_0001837 3300047318 Bacteria 8118
398 Ga0495680_0156248 3300047322 Bacteria 1659
399 Ga0495683_0009835 3300047323 Bacteria 5083
400 Ga0495685_020797 3300047447 Bacteria 2256
401 Ga0496101_0509356 3300048904 Bacteria 951
402 Ga0496104_0141413 3300048907 Bacteria 2312
403 Ga0496104_0478638 3300048907 Bacteria 1156
404 Ga0496106_0004171 3300048909 Bacteria 10771
405 Ga0496107_1233534 3300048910 Bacteria 537
406 Ga0496108_0205009 3300048911 Bacteria 1711
407 Ga0496108_1077216 3300048911 Bacteria 684
408 Ga0496109_0558379 3300048912 Bacteria 1080
409 Ga0496110_0179768 3300048913 Bacteria 1921
410 Ga0496110_0554823 3300048913 Bacteria 1044
411 Ga0496112_0089634 3300048915 Bacteria 3044
412 Ga0496113_0160729 3300048916 Bacteria 1776
413 Ga0496114_0241221 3300048917 Bacteria 1589
414 Ga0496115_0034359 3300048918 Bacteria 4007
415 Ga0501036_1200806 3300049572 Bacteria 618
416 Ga0501068_0373467 3300049584 Bacteria 918
417 Ga0501076_0294906 3300049592 Bacteria 1329
418 Ga0501081_0346848 3300049743 Bacteria 1094
419 nmdc:mga0k408_542266_c1 3300050493 Bacteria 688
420 nmdc:mga09592_874812_c1 3300050508 Bacteria 756
421 nmdc:mga06r32_154893_c1 3300050510 Bacteria 2272
422 nmdc:mga08y16_1628091_c1 3300050511 Unclassified 603
423 nmdc:mga0n895_558887_c1 3300050512 Unclassified 1150
424 nmdc:mga0rr50_212124_c1 3300050513 Bacteria 1596
425 nmdc:mga0a205_356496_c1 3300050515 Unclassified 1330
426 Ga0495601_0121624 3300053077 Bacteria 1695
427 Ga0495655_0252971 3300053083 Bacteria 593
428 Ga0495595_0117305 3300053084 Bacteria 1295
429 Ga0495619_0417923 3300053085 Bacteria 925
430 Ga0500588_0216690 3300053146 Bacteria 713
431 Ga0501082_0750136 3300060353 Bacteria 854

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049584 Ga0501068_0373467 Ga0501068_0373467_529_903 115
2 3300009094 Ga0111539_10197671 Ga0111539_101976712 128
3 3300009094 Ga0111539_12327172 Ga0111539_123271721 128
4 3300050511 nmdc:mga08y16_1628091_c1 nmdc:mga08y16_1628091_c1_114_500 128
5 3300047322 Ga0495680_0156248 Ga0495680_0156248_452_856 134
6 3300049572 Ga0501036_1200806 Ga0501036_1200806_77_517 134
7 3300004803 Ga0058862_11809141 Ga0058862_118091412 135
8 3300005458 Ga0070681_10301919 Ga0070681_103019192 135
9 3300005530 Ga0070679_101014411 Ga0070679_1010144112 135
10 3300025912 Ga0207707_10284780 Ga0207707_102847802 135
11 3300025921 Ga0207652_10238255 Ga0207652_102382552 135
12 3300042012 Ga0439455_0075449 Ga0439455_0075449_287_739 135
13 3300049592 Ga0501076_0294906 Ga0501076_0294906_298_747 137
14 3300049743 Ga0501081_0346848 Ga0501081_0346848_512_961 137
15 3300060353 Ga0501082_0750136 Ga0501082_0750136_272_721 137
16 iso_pu_bacteria 2643221593 2643976897 146
17 3300005327 Ga0070658_10180575 Ga0070658_101805752 147
18 3300005367 Ga0070667_100273917 Ga0070667_1002739173 147
19 3300005471 Ga0070698_100907021 Ga0070698_1009070212 147
20 3300005841 Ga0068863_100065796 Ga0068863_1000657964 147
21 3300013296 Ga0157374_10069437 Ga0157374_100694372 147
22 3300013308 Ga0157375_10033677 Ga0157375_100336775 147
23 3300013308 Ga0157375_11832882 Ga0157375_118328821 147
24 3300014969 Ga0157376_10053876 Ga0157376_100538762 147
25 3300026089 Ga0207648_11349767 Ga0207648_113497672 147
26 3300026142 Ga0207698_10423514 Ga0207698_104235143 147
27 3300031548 Ga0307408_100308649 Ga0307408_1003086492 148
28 3300031731 Ga0307405_10171238 Ga0307405_101712382 148
29 3300031901 Ga0307406_10019744 Ga0307406_100197444 148
30 3300031903 Ga0307407_10613608 Ga0307407_106136082 148
31 3300031911 Ga0307412_10018714 Ga0307412_100187144 148
32 3300031995 Ga0307409_100000931 Ga0307409_10000093113 148
33 3300032002 Ga0307416_100002618 Ga0307416_1000026189 148
34 3300032126 Ga0307415_100881450 Ga0307415_1008814502 148
35 3300044694 Ga0466963_0155916 Ga0466963_0155916_202_660 148
36 3300053146 Ga0500588_0216690 Ga0500588_0216690_92_541 148
37 3300026116 Ga0207674_10015468 Ga0207674_100154682 149
38 3300028794 Ga0307515_10000178 Ga0307515_1000017846 149
39 3300038726 Ga0400490_44662 Ga0400490_44662_8599_9048 149
40 3300046472 Ga0495580_0316581 Ga0495580_0316581_297_746 149
41 3300046499 Ga0495594_0377614 Ga0495594_0377614_316_765 149
42 3300003187 JGI25151J46595_10000283 JGI25151J46595_1000028319 150
43 3300003316 rootH1_10003087 rootH1_100030872 150
44 3300003322 rootL2_10006881 rootL2_1000688169 150
45 3300004803 Ga0058862_12768848 Ga0058862_127688482 150
46 3300005293 Ga0065715_10543378 Ga0065715_105433781 150
47 3300005295 Ga0065707_10407728 Ga0065707_104077281 150
48 3300005327 Ga0070658_10086437 Ga0070658_100864372 150
49 3300005327 Ga0070658_10568366 Ga0070658_105683662 150
50 3300005328 Ga0070676_10248161 Ga0070676_102481611 150
51 3300005329 Ga0070683_100016080 Ga0070683_1000160806 150
52 3300005329 Ga0070683_100050873 Ga0070683_1000508731 150
53 3300005330 Ga0070690_100010989 Ga0070690_1000109895 150
54 3300005331 Ga0070670_100001604 Ga0070670_10000160410 150
55 3300005331 Ga0070670_100065752 Ga0070670_1000657523 150
56 3300005331 Ga0070670_100362000 Ga0070670_1003620003 150
57 3300005333 Ga0070677_10022435 Ga0070677_100224353 150
58 3300005333 Ga0070677_10085888 Ga0070677_100858881 150
59 3300005333 Ga0070677_10108940 Ga0070677_101089402 150
60 3300005334 Ga0068869_100008429 Ga0068869_1000084294 150
61 3300005334 Ga0068869_100525565 Ga0068869_1005255652 150
62 3300005335 Ga0070666_10014337 Ga0070666_100143372 150
63 3300005337 Ga0070682_100336064 Ga0070682_1003360642 150
64 3300005337 Ga0070682_100852599 Ga0070682_1008525991 150
65 3300005338 Ga0068868_100031078 Ga0068868_1000310785 150
66 3300005338 Ga0068868_101736066 Ga0068868_1017360661 150
67 3300005339 Ga0070660_100027971 Ga0070660_1000279712 150
68 3300005339 Ga0070660_100264577 Ga0070660_1002645772 150
69 3300005343 Ga0070687_100019887 Ga0070687_1000198874 150
70 3300005343 Ga0070687_100130126 Ga0070687_1001301262 150
71 3300005344 Ga0070661_100010873 Ga0070661_1000108736 150
72 3300005344 Ga0070661_100058505 Ga0070661_1000585052 150
73 3300005344 Ga0070661_100312617 Ga0070661_1003126171 150
74 3300005347 Ga0070668_100026477 Ga0070668_1000264772 150
75 3300005353 Ga0070669_100007169 Ga0070669_1000071695 150
76 3300005353 Ga0070669_100345945 Ga0070669_1003459452 150
77 3300005354 Ga0070675_100007056 Ga0070675_10000705612 150
78 3300005354 Ga0070675_100160886 Ga0070675_1001608862 150
79 3300005354 Ga0070675_100171072 Ga0070675_1001710723 150
80 3300005354 Ga0070675_100668740 Ga0070675_1006687401 150
81 3300005355 Ga0070671_100000303 Ga0070671_10000030321 150
82 3300005355 Ga0070671_100109068 Ga0070671_1001090683 150
83 3300005356 Ga0070674_100269738 Ga0070674_1002697381 150
84 3300005356 Ga0070674_100315977 Ga0070674_1003159772 150
85 3300005364 Ga0070673_100016440 Ga0070673_1000164403 150
86 3300005364 Ga0070673_100161392 Ga0070673_1001613922 150
87 3300005364 Ga0070673_100570380 Ga0070673_1005703801 150
88 3300005366 Ga0070659_100016323 Ga0070659_1000163232 150
89 3300005366 Ga0070659_100199767 Ga0070659_1001997673 150
90 3300005366 Ga0070659_100894767 Ga0070659_1008947672 150
91 3300005367 Ga0070667_100013229 Ga0070667_1000132293 150
92 3300005435 Ga0070714_100866774 Ga0070714_1008667742 150
93 3300005438 Ga0070701_10089038 Ga0070701_100890383 150
94 3300005445 Ga0070708_100538917 Ga0070708_1005389172 150
95 3300005445 Ga0070708_101774040 Ga0070708_1017740401 150
96 3300005455 Ga0070663_100029223 Ga0070663_1000292234 150
97 3300005456 Ga0070678_100024572 Ga0070678_1000245726 150
98 3300005456 Ga0070678_100032738 Ga0070678_1000327384 150
99 3300005456 Ga0070678_100032979 Ga0070678_1000329795 150
100 3300005456 Ga0070678_100134829 Ga0070678_1001348292 150
101 3300005456 Ga0070678_100877952 Ga0070678_1008779522 150
102 3300005457 Ga0070662_100033838 Ga0070662_1000338384 150
103 3300005457 Ga0070662_100184775 Ga0070662_1001847752 150
104 3300005458 Ga0070681_10255363 Ga0070681_102553633 150
105 3300005459 Ga0068867_100006850 Ga0068867_1000068506 150
106 3300005459 Ga0068867_100239911 Ga0068867_1002399112 150
107 3300005459 Ga0068867_100913290 Ga0068867_1009132901 150
108 3300005466 Ga0070685_10714675 Ga0070685_107146751 150
109 3300005467 Ga0070706_100003005 Ga0070706_10000300512 150
110 3300005468 Ga0070707_100031551 Ga0070707_1000315512 150
111 3300005468 Ga0070707_100597252 Ga0070707_1005972522 150
112 3300005471 Ga0070698_100097951 Ga0070698_1000979512 150
113 3300005530 Ga0070679_100461207 Ga0070679_1004612073 150
114 3300005535 Ga0070684_100009386 Ga0070684_1000093866 150
115 3300005535 Ga0070684_100229587 Ga0070684_1002295873 150
116 3300005536 Ga0070697_100800013 Ga0070697_1008000131 150
117 3300005539 Ga0068853_100250513 Ga0068853_1002505132 150
118 3300005539 Ga0068853_100795209 Ga0068853_1007952091 150
119 3300005543 Ga0070672_100029456 Ga0070672_1000294562 150
120 3300005543 Ga0070672_100029588 Ga0070672_1000295883 150
121 3300005543 Ga0070672_100031101 Ga0070672_1000311012 150
122 3300005543 Ga0070672_100119338 Ga0070672_1001193383 150
123 3300005543 Ga0070672_100480758 Ga0070672_1004807582 150
124 3300005543 Ga0070672_100867008 Ga0070672_1008670082 150
125 3300005547 Ga0070693_100101092 Ga0070693_1001010923 150
126 3300005563 Ga0068855_100121114 Ga0068855_1001211143 150
127 3300005564 Ga0070664_100043299 Ga0070664_1000432992 150
128 3300005564 Ga0070664_100045988 Ga0070664_1000459884 150
129 3300005564 Ga0070664_100074919 Ga0070664_1000749191 150
130 3300005564 Ga0070664_100357046 Ga0070664_1003570462 150
131 3300005564 Ga0070664_100887716 Ga0070664_1008877162 150
132 3300005564 Ga0070664_101149786 Ga0070664_1011497862 150
133 3300005578 Ga0068854_100008463 Ga0068854_1000084634 150
134 3300005578 Ga0068854_100125241 Ga0068854_1001252412 150
135 3300005578 Ga0068854_101137350 Ga0068854_1011373502 150
136 3300005614 Ga0068856_100099193 Ga0068856_1000991933 150
137 3300005615 Ga0070702_100195418 Ga0070702_1001954183 150
138 3300005616 Ga0068852_100001595 Ga0068852_1000015952 150
139 3300005616 Ga0068852_100002061 Ga0068852_1000020616 150
140 3300005617 Ga0068859_100066917 Ga0068859_1000669172 150
141 3300005618 Ga0068864_100003573 Ga0068864_10000357313 150
142 3300005618 Ga0068864_100481166 Ga0068864_1004811662 150
143 3300005618 Ga0068864_100566659 Ga0068864_1005666592 150
144 3300005618 Ga0068864_100686250 Ga0068864_1006862502 150
145 3300005618 Ga0068864_102266214 Ga0068864_1022662141 150
146 3300005718 Ga0068866_10004983 Ga0068866_100049834 150
147 3300005719 Ga0068861_100005957 Ga0068861_1000059572 150
148 3300005834 Ga0068851_10241428 Ga0068851_102414282 150
149 3300005840 Ga0068870_10443074 Ga0068870_104430742 150
150 3300005841 Ga0068863_100045605 Ga0068863_1000456055 150
151 3300005841 Ga0068863_100226129 Ga0068863_1002261293 150
152 3300005841 Ga0068863_100258391 Ga0068863_1002583912 150
153 3300005842 Ga0068858_100003921 Ga0068858_10000392115 150
154 3300005842 Ga0068858_100007342 Ga0068858_1000073426 150
155 3300005842 Ga0068858_100365358 Ga0068858_1003653582 150
156 3300005843 Ga0068860_100022335 Ga0068860_1000223356 150
157 3300005843 Ga0068860_100199310 Ga0068860_1001993101 150
158 3300006028 Ga0070717_10002211 Ga0070717_100022112 150
159 3300006028 Ga0070717_10157018 Ga0070717_101570181 150
160 3300006028 Ga0070717_11014055 Ga0070717_110140551 150
161 3300006163 Ga0070715_10150521 Ga0070715_101505212 150
162 3300006173 Ga0070716_100574399 Ga0070716_1005743991 150
163 3300006195 Ga0075366_10337421 Ga0075366_103374212 150
164 3300006237 Ga0097621_100169063 Ga0097621_1001690631 150
165 3300006237 Ga0097621_100367554 Ga0097621_1003675542 150
166 3300006237 Ga0097621_100736842 Ga0097621_1007368422 150
167 3300006358 Ga0068871_100124707 Ga0068871_1001247073 150
168 3300006358 Ga0068871_100138066 Ga0068871_1001380662 150
169 3300006844 Ga0075428_100099763 Ga0075428_1000997633 150
170 3300006871 Ga0075434_100436664 Ga0075434_1004366641 150
171 3300006881 Ga0068865_100001266 Ga0068865_10000126611 150
172 3300006914 Ga0075436_100003792 Ga0075436_1000037926 150
173 3300006931 Ga0097620_100066920 Ga0097620_1000669202 150
174 3300007265 Ga0099794_10073234 Ga0099794_100732342 150
175 3300009093 Ga0105240_10211117 Ga0105240_102111172 150
176 3300009098 Ga0105245_10096821 Ga0105245_100968213 150
177 3300009098 Ga0105245_10838295 Ga0105245_108382952 150
178 3300009098 Ga0105245_12392356 Ga0105245_123923561 150
179 3300009101 Ga0105247_10728450 Ga0105247_107284502 150
180 3300009147 Ga0114129_10096069 Ga0114129_100960692 150
181 3300009148 Ga0105243_10128680 Ga0105243_101286802 150
182 3300009174 Ga0105241_10505874 Ga0105241_105058742 150
183 3300009174 Ga0105241_11518489 Ga0105241_115184891 150
184 3300009176 Ga0105242_10039374 Ga0105242_100393744 150
185 3300009176 Ga0105242_10127443 Ga0105242_101274433 150
186 3300009177 Ga0105248_10017145 Ga0105248_100171457 150
187 3300009177 Ga0105248_10825000 Ga0105248_108250002 150
188 3300009177 Ga0105248_10875888 Ga0105248_108758882 150
189 3300009177 Ga0105248_10891398 Ga0105248_108913982 150
190 3300009545 Ga0105237_10237887 Ga0105237_102378872 150
191 3300009551 Ga0105238_10007534 Ga0105238_100075347 150
192 3300009551 Ga0105238_10210176 Ga0105238_102101762 150
193 3300009551 Ga0105238_10631796 Ga0105238_106317962 150
194 3300009553 Ga0105249_10008679 Ga0105249_100086794 150
195 3300010375 Ga0105239_10454890 Ga0105239_104548902 150
196 3300011119 Ga0105246_10475771 Ga0105246_104757712 150
197 3300012506 Ga0157324_1003865 Ga0157324_10038652 150
198 3300013100 Ga0157373_10091052 Ga0157373_100910523 150
199 3300013105 Ga0157369_10011093 Ga0157369_100110933 150
200 3300013296 Ga0157374_10045628 Ga0157374_100456282 150
201 3300013296 Ga0157374_10284897 Ga0157374_102848972 150
202 3300013296 Ga0157374_11270463 Ga0157374_112704632 150
203 3300013297 Ga0157378_10168418 Ga0157378_101684183 150
204 3300013297 Ga0157378_11181476 Ga0157378_111814762 150
205 3300013306 Ga0163162_10012386 Ga0163162_100123866 150
206 3300013306 Ga0163162_10160033 Ga0163162_101600332 150
207 3300013307 Ga0157372_10023908 Ga0157372_100239082 150
208 3300013307 Ga0157372_10294656 Ga0157372_102946563 150
209 3300013307 Ga0157372_11201027 Ga0157372_112010271 150
210 3300013307 Ga0157372_11361537 Ga0157372_113615372 150
211 3300013307 Ga0157372_11601261 Ga0157372_116012612 150
212 3300013308 Ga0157375_10008819 Ga0157375_100088197 150
213 3300013308 Ga0157375_10026773 Ga0157375_100267735 150
214 3300013308 Ga0157375_10391278 Ga0157375_103912782 150
215 3300013308 Ga0157375_10544884 Ga0157375_105448842 150
216 3300013308 Ga0157375_10553388 Ga0157375_105533882 150
217 3300014325 Ga0163163_10131339 Ga0163163_101313392 150
218 3300014325 Ga0163163_11220187 Ga0163163_112201871 150
219 3300014326 Ga0157380_10089533 Ga0157380_100895333 150
220 3300014326 Ga0157380_10095688 Ga0157380_100956883 150
221 3300014326 Ga0157380_11476105 Ga0157380_114761052 150
222 3300014497 Ga0182008_10158909 Ga0182008_101589092 150
223 3300014497 Ga0182008_10412183 Ga0182008_104121832 150
224 3300014745 Ga0157377_10509001 Ga0157377_105090012 150
225 3300014968 Ga0157379_10055705 Ga0157379_100557052 150
226 3300014968 Ga0157379_10057874 Ga0157379_100578744 150
227 3300014968 Ga0157379_10093887 Ga0157379_100938873 150
228 3300014968 Ga0157379_12150681 Ga0157379_121506811 150
229 3300014969 Ga0157376_10119850 Ga0157376_101198504 150
230 3300015262 Ga0182007_10024492 Ga0182007_100244923 150
231 3300017792 Ga0163161_10016938 Ga0163161_100169383 150
232 3300017792 Ga0163161_10489699 Ga0163161_104896991 150
233 3300025245 Ga0207425_1001940 Ga0207425_10019402 150
234 3300025294 Ga0209025_1000005 Ga0209025_1000005840 150
235 3300025297 Ga0209758_1011515 Ga0209758_10115153 150
236 3300025315 Ga0207697_10042308 Ga0207697_100423083 150
237 3300025321 Ga0207656_10030875 Ga0207656_100308752 150
238 3300025321 Ga0207656_10113334 Ga0207656_101133342 150
239 3300025893 Ga0207682_10026443 Ga0207682_100264431 150
240 3300025899 Ga0207642_10012121 Ga0207642_100121214 150
241 3300025899 Ga0207642_10014314 Ga0207642_100143142 150
242 3300025901 Ga0207688_10576759 Ga0207688_105767592 150
243 3300025903 Ga0207680_10048068 Ga0207680_100480683 150
244 3300025903 Ga0207680_10473062 Ga0207680_104730621 150
245 3300025907 Ga0207645_10022814 Ga0207645_100228142 150
246 3300025908 Ga0207643_10100473 Ga0207643_101004733 150
247 3300025909 Ga0207705_10018341 Ga0207705_100183416 150
248 3300025909 Ga0207705_10251704 Ga0207705_102517042 150
249 3300025910 Ga0207684_10008096 Ga0207684_100080968 150
250 3300025911 Ga0207654_10308537 Ga0207654_103085372 150
251 3300025912 Ga0207707_10216456 Ga0207707_102164563 150
252 3300025913 Ga0207695_10289337 Ga0207695_102893372 150
253 3300025918 Ga0207662_10021819 Ga0207662_100218195 150
254 3300025918 Ga0207662_10093750 Ga0207662_100937502 150
255 3300025919 Ga0207657_10026399 Ga0207657_100263995 150
256 3300025919 Ga0207657_10301007 Ga0207657_103010072 150
257 3300025920 Ga0207649_10021107 Ga0207649_100211072 150
258 3300025920 Ga0207649_10177605 Ga0207649_101776053 150
259 3300025923 Ga0207681_10003606 Ga0207681_100036067 150
260 3300025925 Ga0207650_10004217 Ga0207650_100042175 150
261 3300025925 Ga0207650_10104552 Ga0207650_101045523 150
262 3300025925 Ga0207650_10217943 Ga0207650_102179433 150
263 3300025925 Ga0207650_10924390 Ga0207650_109243902 150
264 3300025925 Ga0207650_11178209 Ga0207650_111782092 150
265 3300025926 Ga0207659_10053270 Ga0207659_100532702 150
266 3300025926 Ga0207659_10202111 Ga0207659_102021112 150
267 3300025926 Ga0207659_10269012 Ga0207659_102690122 150
268 3300025926 Ga0207659_10950147 Ga0207659_109501472 150
269 3300025927 Ga0207687_10321354 Ga0207687_103213542 150
270 3300025928 Ga0207700_10171241 Ga0207700_101712412 150
271 3300025931 Ga0207644_10000068 Ga0207644_1000006838 150
272 3300025931 Ga0207644_10054726 Ga0207644_100547264 150
273 3300025932 Ga0207690_10052875 Ga0207690_100528752 150
274 3300025932 Ga0207690_10165843 Ga0207690_101658433 150
275 3300025932 Ga0207690_10387673 Ga0207690_103876732 150
276 3300025933 Ga0207706_10007964 Ga0207706_1000796412 150
277 3300025933 Ga0207706_10016165 Ga0207706_100161652 150
278 3300025934 Ga0207686_10053035 Ga0207686_100530353 150
279 3300025934 Ga0207686_10505763 Ga0207686_105057632 150
280 3300025934 Ga0207686_10556552 Ga0207686_105565522 150
281 3300025935 Ga0207709_10318535 Ga0207709_103185352 150
282 3300025935 Ga0207709_10400998 Ga0207709_104009982 150
283 3300025937 Ga0207669_10019603 Ga0207669_100196033 150
284 3300025938 Ga0207704_10043559 Ga0207704_100435594 150
285 3300025939 Ga0207665_10533299 Ga0207665_105332992 150
286 3300025940 Ga0207691_10002959 Ga0207691_100029595 150
287 3300025940 Ga0207691_10027638 Ga0207691_100276385 150
288 3300025940 Ga0207691_10032454 Ga0207691_100324545 150
289 3300025940 Ga0207691_10042492 Ga0207691_100424922 150
290 3300025940 Ga0207691_10045783 Ga0207691_100457834 150
291 3300025940 Ga0207691_10134897 Ga0207691_101348971 150
292 3300025941 Ga0207711_10007769 Ga0207711_100077694 150
293 3300025941 Ga0207711_10058055 Ga0207711_100580553 150
294 3300025941 Ga0207711_11103642 Ga0207711_111036421 150
295 3300025942 Ga0207689_10008531 Ga0207689_100085316 150
296 3300025944 Ga0207661_10316560 Ga0207661_103165602 150
297 3300025944 Ga0207661_10667602 Ga0207661_106676022 150
298 3300025945 Ga0207679_10041448 Ga0207679_100414481 150
299 3300025945 Ga0207679_10145016 Ga0207679_101450162 150
300 3300025945 Ga0207679_10504530 Ga0207679_105045302 150
301 3300025945 Ga0207679_11093591 Ga0207679_110935911 150
302 3300025960 Ga0207651_10011189 Ga0207651_100111895 150
303 3300025960 Ga0207651_10053036 Ga0207651_100530363 150
304 3300025960 Ga0207651_10759512 Ga0207651_107595121 150
305 3300025961 Ga0207712_10008238 Ga0207712_100082384 150
306 3300025972 Ga0207668_10066118 Ga0207668_100661183 150
307 3300025981 Ga0207640_10021427 Ga0207640_100214272 150
308 3300025981 Ga0207640_10122033 Ga0207640_101220333 150
309 3300025981 Ga0207640_10636007 Ga0207640_106360072 150
310 3300025986 Ga0207658_10030079 Ga0207658_100300792 150
311 3300025986 Ga0207658_10073696 Ga0207658_100736962 150
312 3300026023 Ga0207677_10008027 Ga0207677_100080272 150
313 3300026023 Ga0207677_10023524 Ga0207677_100235243 150
314 3300026023 Ga0207677_10237757 Ga0207677_102377573 150
315 3300026023 Ga0207677_11239385 Ga0207677_112393852 150
316 3300026035 Ga0207703_10044598 Ga0207703_100445983 150
317 3300026035 Ga0207703_10260863 Ga0207703_102608632 150
318 3300026035 Ga0207703_10654563 Ga0207703_106545632 150
319 3300026041 Ga0207639_10030361 Ga0207639_100303614 150
320 3300026041 Ga0207639_10216292 Ga0207639_102162923 150
321 3300026041 Ga0207639_11470044 Ga0207639_114700442 150
322 3300026067 Ga0207678_10091779 Ga0207678_100917793 150
323 3300026067 Ga0207678_10832454 Ga0207678_108324542 150
324 3300026075 Ga0207708_10086908 Ga0207708_100869081 150
325 3300026078 Ga0207702_10060306 Ga0207702_100603064 150
326 3300026088 Ga0207641_10019792 Ga0207641_100197925 150
327 3300026088 Ga0207641_10235276 Ga0207641_102352762 150
328 3300026089 Ga0207648_10050360 Ga0207648_100503605 150
329 3300026089 Ga0207648_10533340 Ga0207648_105333402 150
330 3300026089 Ga0207648_10917210 Ga0207648_109172102 150
331 3300026095 Ga0207676_10009361 Ga0207676_100093615 150
332 3300026095 Ga0207676_10148260 Ga0207676_101482602 150
333 3300026095 Ga0207676_10228284 Ga0207676_102282842 150
334 3300026095 Ga0207676_10749518 Ga0207676_107495181 150
335 3300026116 Ga0207674_10025298 Ga0207674_100252984 150
336 3300026118 Ga0207675_100217928 Ga0207675_1002179282 150
337 3300026118 Ga0207675_100269669 Ga0207675_1002696693 150
338 3300026121 Ga0207683_10018583 Ga0207683_100185836 150
339 3300026121 Ga0207683_10103801 Ga0207683_101038014 150
340 3300026121 Ga0207683_10148015 Ga0207683_101480151 150
341 3300026121 Ga0207683_10298148 Ga0207683_102981482 150
342 3300026121 Ga0207683_10365742 Ga0207683_103657422 150
343 3300026142 Ga0207698_10079361 Ga0207698_100793614 150
344 3300026142 Ga0207698_10097318 Ga0207698_100973183 150
345 3300026142 Ga0207698_10126076 Ga0207698_101260762 150
346 3300026142 Ga0207698_11162798 Ga0207698_111627982 150
347 3300027671 Ga0209588_1039741 Ga0209588_10397411 150
348 3300028380 Ga0268265_10019957 Ga0268265_100199575 150
349 3300028381 Ga0268264_10012058 Ga0268264_100120584 150
350 3300031251 Ga0265327_10007663 Ga0265327_100076635 150
351 3300031548 Ga0307408_100000010 Ga0307408_10000001077 150
352 3300031691 Ga0316579_10146649 Ga0316579_101466492 150
353 3300031691 Ga0316579_10359411 Ga0316579_103594112 150
354 3300031727 Ga0316576_10511106 Ga0316576_105111062 150
355 3300031728 Ga0316578_10091000 Ga0316578_100910002 150
356 3300031733 Ga0316577_10005803 Ga0316577_100058035 150
357 3300031901 Ga0307406_10038198 Ga0307406_100381982 150
358 3300032168 Ga0316593_10005845 Ga0316593_100058452 150
359 3300035084 Ga0373928_0094962 Ga0373928_0094962_194_646 150
360 3300035116 Ga0373945_0044854 Ga0373945_0044854_867_1319 150
361 3300035116 Ga0373945_0088479 Ga0373945_0088479_434_886 150
362 3300035117 Ga0373953_0267782 Ga0373953_0267782_106_558 150
363 3300035118 Ga0373954_0361430 Ga0373954_0361430_193_645 150
364 3300035170 Ga0373943_0110249 Ga0373943_0110249_596_1048 150
365 3300035171 Ga0373946_0117217 Ga0373946_0117217_601_1053 150
366 3300035410 Ga0373924_0022601 Ga0373924_0022601_469_921 150
367 3300035691 Ga0373931_0061205 Ga0373931_0061205_436_888 150
368 3300035695 Ga0373927_0323425 Ga0373927_0323425_299_751 150
369 3300035724 Ga0373933_0298389 Ga0373933_0298389_408_860 150
370 3300035725 Ga0373947_0357676 Ga0373947_0357676_10_462 150
371 3300036401 Ga0373937_0040920 Ga0373937_0040920_1084_1536 150
372 3300036401 Ga0373937_0235793 Ga0373937_0235793_294_746 150
373 3300036647 Ga0316582_0038962 Ga0316582_0038962_993_1448 150
374 3300036712 Ga0316584_0091722 Ga0316584_0091722_795_1250 150
375 3300037068 Ga0373925_0083408 Ga0373925_0083408_312_764 150
376 3300037068 Ga0373925_0537334 Ga0373925_0537334_19_471 150
377 3300037418 Ga0395900_0289222 Ga0395900_0289222_766_1230 150
378 3300037466 Ga0395898_0770477 Ga0395898_0770477_334_798 150
379 3300037588 Ga0316581_0154004 Ga0316581_0154004_128_583 150
380 3300041404 Ga0439436_0013864 Ga0439436_0013864_1697_2149 150
381 3300044712 Ga0453684_0091441 Ga0453684_0091441_2636_3091 150
382 3300044712 Ga0453684_0704745 Ga0453684_0704745_498_950 150
383 3300044842 Ga0466957_0208784 Ga0466957_0208784_641_1096 150
384 3300045051 Ga0451576_0207179 Ga0451576_0207179_1349_1801 150
385 3300045051 Ga0451576_0340483 Ga0451576_0340483_973_1428 150
386 3300046454 Ga0495592_0157403 Ga0495592_0157403_906_1358 150
387 3300046454 Ga0495592_0598494 Ga0495592_0598494_153_605 150
388 3300046458 Ga0495591_136298 Ga0495591_136298_126_578 150
389 3300046472 Ga0495580_0584450 Ga0495580_0584450_20_472 150
390 3300046473 Ga0495582_0217120 Ga0495582_0217120_174_626 150
391 3300046500 Ga0495596_0020954 Ga0495596_0020954_2052_2504 150
392 3300046507 Ga0495606_0019524 Ga0495606_0019524_3098_3550 150
393 3300046525 Ga0495663_0102643 Ga0495663_0102643_118_570 150
394 3300046528 Ga0495642_0153962 Ga0495642_0153962_287_739 150
395 3300046535 Ga0495586_0166740 Ga0495586_0166740_466_918 150
396 3300046539 Ga0495621_0069998 Ga0495621_0069998_617_1069 150
397 3300046539 Ga0495621_0124371 Ga0495621_0124371_185_637 150
398 3300046542 Ga0495597_0110476 Ga0495597_0110476_623_1075 150
399 3300046543 Ga0495645_0112835 Ga0495645_0112835_982_1434 150
400 3300046543 Ga0495645_0230398 Ga0495645_0230398_464_916 150
401 3300046559 Ga0495667_0353487 Ga0495667_0353487_173_625 150
402 3300046616 Ga0495668_0000022 Ga0495668_0000022_117565_118017 150
403 3300046683 Ga0495658_0203578 Ga0495658_0203578_360_812 150
404 3300046691 Ga0495670_0260973 Ga0495670_0260973_460_912 150
405 3300046694 Ga0495649_0322881 Ga0495649_0322881_55_507 150
406 3300047318 Ga0495636_0001837 Ga0495636_0001837_4639_5091 150
407 3300047323 Ga0495683_0009835 Ga0495683_0009835_856_1308 150
408 3300047447 Ga0495685_020797 Ga0495685_020797_1037_1489 150
409 3300048904 Ga0496101_0509356 Ga0496101_0509356_373_828 150
410 3300048907 Ga0496104_0141413 Ga0496104_0141413_1420_1872 150
411 3300048907 Ga0496104_0478638 Ga0496104_0478638_226_678 150
412 3300048909 Ga0496106_0004171 Ga0496106_0004171_9906_10358 150
413 3300048910 Ga0496107_1233534 Ga0496107_1233534_17_496 150
414 3300048911 Ga0496108_0205009 Ga0496108_0205009_46_498 150
415 3300048911 Ga0496108_1077216 Ga0496108_1077216_93_548 150
416 3300048912 Ga0496109_0558379 Ga0496109_0558379_190_642 150
417 3300048913 Ga0496110_0179768 Ga0496110_0179768_1437_1889 150
418 3300048913 Ga0496110_0554823 Ga0496110_0554823_420_872 150
419 3300048915 Ga0496112_0089634 Ga0496112_0089634_1073_1528 150
420 3300048916 Ga0496113_0160729 Ga0496113_0160729_289_741 150
421 3300048917 Ga0496114_0241221 Ga0496114_0241221_884_1336 150
422 3300048918 Ga0496115_0034359 Ga0496115_0034359_659_1111 150
423 3300050493 nmdc:mga0k408_542266_c1 nmdc:mga0k408_542266_c1_135_587 150
424 3300050508 nmdc:mga09592_874812_c1 nmdc:mga09592_874812_c1_281_733 150
425 3300050510 nmdc:mga06r32_154893_c1 nmdc:mga06r32_154893_c1_1649_2101 150
426 3300050512 nmdc:mga0n895_558887_c1 nmdc:mga0n895_558887_c1_651_1103 150
427 3300050513 nmdc:mga0rr50_212124_c1 nmdc:mga0rr50_212124_c1_1097_1549 150
428 3300050515 nmdc:mga0a205_356496_c1 nmdc:mga0a205_356496_c1_48_500 150
429 3300053077 Ga0495601_0121624 Ga0495601_0121624_140_592 150
430 3300053083 Ga0495655_0252971 Ga0495655_0252971_38_490 150
431 3300053084 Ga0495595_0117305 Ga0495595_0117305_345_797 150
432 3300053085 Ga0495619_0417923 Ga0495619_0417923_223_675 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06841

Phage_T4_gp19

T4-like virus tail tube protein gp19

25

163

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j0b-assembly1.cif.gz_a cryo-em structure of an extracellular contractile injection system, pvc sheath-tube complex in extended state 0.8063 8 150
7adz-assembly1.cif.gz_1a cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the cap portion in extended state. 0.7786 7 150
6j0f-assembly1.cif.gz_a cryo-em structure of an extracellular contractile injection system, pvc sheath/tube terminator in extended state 0.7619 7 150
7adz-assembly1.cif.gz_1a cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the cap portion in extended state. 0.7591 7 150
7b5h-assembly1.cif.gz_AN cryo-em structure of the contractile injection system base plate from anabaena pcc7120 0.7585 5 150
ID Description Score Start End Superfamily
1y12B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.6699 14 149 2.30.110.20
af_A0A1D6MBR1_179_244_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.666 66 143 3.30.200.20
3eaaB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.6384 11 149 2.30.110.20
4hkhG00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.6374 12 149 2.30.110.20
5xhhA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.6331 14 149 2.30.110.20
ID Description Score Start End GO Terms
AF-A0A3M1E306-F1-model_v4 Phage tail protein 0.8986 68 150 GO:0005198
AF-A0A486XPI5-F1-model_v4 Phage tail protein 0.8931 94 150 GO:0005198
AF-A0A5M3Y8P0-F1-model_v4 deleted 0.8809 65 150
AF-A0A3M1E306-F1-model_v4 Phage tail protein 0.879 68 150 GO:0005198
AF-A0A2W5LGN3-F1-model_v4 deleted 0.8708 12 146

Feature Viewer

pLDDT pTM Quality
81.01 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map