F442584

General Info

Members Datasets Scaffolds Average Seq Length
432 289 431 173

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10556638|Ga0114129_105566382
Length 192
Sequence VVLPAPRICSTRIPENLMTRFLFAAAALAAFVWPANAHVTLETQEAKVGASYKAVLRVPHGCEGTATMAIRVKIPDGVIGVKPMPKPGWTLATTTGKYPKAYNLFHREVTEGVTEIAWSGGKLPDAWYDEFVFQGFLAGDLDAGKPLYFPVVQECEKGVHRWIEIPAAGKSASDYPEPAPALRLLPAGAPRH

Samples

Sample ID Description Type Environment
1 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
158 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
159 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
165 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
177 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
178 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
179 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
191 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
192 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
193 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
194 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
197 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
201 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
202 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
206 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
207 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
208 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
213 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
214 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
218 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
219 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
220 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
221 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
222 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
259 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
260 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
261 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
262 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
263 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
275 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
277 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
278 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
279 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
280 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
281 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
282 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
283 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
284 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
285 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
286 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.23
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.95
Nodule 0.23
Rhizoplane 13.43
Rhizosphere 75.69
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1012284 3300002070 Bacteria 1134
2 JGI24745J21846_1020087 3300002073 Bacteria 782
3 JGI24742J22300_10008057 3300002244 Bacteria 1739
4 Ga0065704_10544133 3300005289 Bacteria 638
5 Ga0070658_10644225 3300005327 Bacteria 919
6 Ga0070690_100078154 3300005330 Bacteria 2161
7 Ga0070670_100034946 3300005331 Bacteria 4326
8 Ga0068869_100100839 3300005334 Bacteria 2183
9 Ga0070666_10175890 3300005335 Bacteria 1500
10 Ga0068868_100049178 3300005338 Bacteria 3309
11 Ga0070689_100023424 3300005340 Bacteria 4622
12 Ga0070689_100836996 3300005340 Bacteria 811
13 Ga0070687_100024924 3300005343 Bacteria 2864
14 Ga0070661_100179346 3300005344 Bacteria 1611
15 Ga0070668_100238859 3300005347 Bacteria 1504
16 Ga0070669_100196638 3300005353 Bacteria 1585
17 Ga0070669_101227987 3300005353 Bacteria 648
18 Ga0070675_100152304 3300005354 Bacteria 1983
19 Ga0070671_100209620 3300005355 Bacteria 1653
20 Ga0070671_101401599 3300005355 Bacteria 617
21 Ga0070673_100024794 3300005364 Bacteria 4403
22 Ga0070688_100011866 3300005365 Bacteria 4861
23 Ga0070688_100182188 3300005365 Bacteria 1458
24 Ga0070659_100121905 3300005366 Bacteria 2113
25 Ga0070667_100672811 3300005367 Bacteria 956
26 Ga0070714_100410446 3300005435 Bacteria 1282
27 Ga0070713_100083820 3300005436 Bacteria 2726
28 Ga0070710_10064230 3300005437 Bacteria 2099
29 Ga0070710_10738369 3300005437 Bacteria 698
30 Ga0070701_10005467 3300005438 Bacteria 5254
31 Ga0070711_100140184 3300005439 Bacteria 1812
32 Ga0070711_100538694 3300005439 Bacteria 967
33 Ga0070705_100372178 3300005440 Bacteria 1049
34 Ga0070700_100178061 3300005441 Bacteria 1477
35 Ga0070694_100098761 3300005444 Bacteria 2062
36 Ga0070708_101191730 3300005445 Bacteria 712
37 Ga0070663_100056034 3300005455 Bacteria 2823
38 Ga0070662_101218854 3300005457 Bacteria 647
39 Ga0070681_10219532 3300005458 Bacteria 1816
40 Ga0070681_11369220 3300005458 Bacteria 631
41 Ga0068867_100030311 3300005459 Bacteria 3902
42 Ga0070685_10027324 3300005466 Bacteria 3152
43 Ga0070707_100176669 3300005468 Bacteria 2081
44 Ga0070698_100434679 3300005471 Bacteria 1247
45 Ga0070699_100391680 3300005518 Bacteria 1255
46 Ga0070679_100443137 3300005530 Bacteria 1243
47 Ga0070684_100082396 3300005535 Bacteria 2848
48 Ga0070697_100230922 3300005536 Bacteria 1578
49 Ga0068853_100166237 3300005539 Bacteria 1993
50 Ga0070672_100003902 3300005543 Bacteria 9713
51 Ga0070686_100004484 3300005544 Bacteria 7703
52 Ga0070695_100249167 3300005545 Bacteria 1292
53 Ga0070665_100189043 3300005548 Bacteria 2060
54 Ga0070665_100220502 3300005548 Bacteria 1897
55 Ga0070665_100702465 3300005548 Bacteria 1024
56 Ga0070665_100843182 3300005548 Bacteria 930
57 Ga0070664_100061557 3300005564 Bacteria 3199
58 Ga0068854_100063153 3300005578 Bacteria 2688
59 Ga0068854_100085390 3300005578 Bacteria 2337
60 Ga0068856_100710164 3300005614 Bacteria 1026
61 Ga0070702_100018109 3300005615 Bacteria 3647
62 Ga0068859_100083545 3300005617 Bacteria 3237
63 Ga0068859_100833025 3300005617 Bacteria 1009
64 Ga0068864_100004158 3300005618 Bacteria 11885
65 Ga0068864_100123022 3300005618 Bacteria 2322
66 Ga0068864_100826260 3300005618 Bacteria 912
67 Ga0068866_10067516 3300005718 Bacteria 1877
68 Ga0068866_10258284 3300005718 Bacteria 1069
69 Ga0068861_100089936 3300005719 Bacteria 2420
70 Ga0068870_10227236 3300005840 Bacteria 1145
71 Ga0068858_100471917 3300005842 Bacteria 1210
72 Ga0068860_100036934 3300005843 Bacteria 4677
73 Ga0068862_100026700 3300005844 Bacteria 4855
74 Ga0081455_10025579 3300005937 Bacteria 5445
75 Ga0081455_10029277 3300005937 Bacteria 5021
76 Ga0081538_10054835 3300005981 Bacteria 2352
77 Ga0081540_1027052 3300005983 Bacteria 3258
78 Ga0070717_10260114 3300006028 Bacteria 1535
79 Ga0075365_10007832 3300006038 Bacteria 6018
80 Ga0075365_10205423 3300006038 Bacteria 1380
81 Ga0075365_10698792 3300006038 Bacteria 716
82 Ga0075368_10087276 3300006042 Bacteria 1274
83 Ga0075368_10258810 3300006042 Bacteria 745
84 Ga0075363_100292741 3300006048 Bacteria 944
85 Ga0075364_10223462 3300006051 Bacteria 1278
86 Ga0070715_10170778 3300006163 Bacteria 1083
87 Ga0070716_100654624 3300006173 Bacteria 797
88 Ga0070712_100003370 3300006175 Bacteria 9825
89 Ga0070712_100293866 3300006175 Bacteria 1313
90 Ga0075362_10139963 3300006177 Bacteria 1156
91 Ga0075367_10125600 3300006178 Bacteria 1583
92 Ga0075367_10187182 3300006178 Bacteria 1291
93 Ga0075367_10346415 3300006178 Unclassified 937
94 Ga0075367_10658529 3300006178 Bacteria 666
95 Ga0075369_10018992 3300006186 Bacteria 2803
96 Ga0075369_10180424 3300006186 Bacteria 971
97 Ga0075366_10143448 3300006195 Bacteria 1444
98 Ga0075366_10152562 3300006195 Unclassified 1399
99 Ga0097621_100603771 3300006237 Bacteria 1003
100 Ga0097621_100612469 3300006237 Bacteria 996
101 Ga0075370_10447927 3300006353 Bacteria 777
102 Ga0068871_100547136 3300006358 Bacteria 1048
103 Ga0075428_100059203 3300006844 Bacteria 4194
104 Ga0075428_100061452 3300006844 Bacteria 4114
105 Ga0075428_100082983 3300006844 Bacteria 3497
106 Ga0075428_100321732 3300006844 Bacteria 1662
107 Ga0075431_100068069 3300006847 Bacteria 3675
108 Ga0075431_100273912 3300006847 Bacteria 1710
109 Ga0075434_100037075 3300006871 Bacteria 4826
110 Ga0075429_100129252 3300006880 Bacteria 2209
111 Ga0097620_100083543 3300006931 Bacteria 3237
112 Ga0097620_100833182 3300006931 Bacteria 1009
113 Ga0099794_10197372 3300007265 Bacteria 1030
114 Ga0105250_10292972 3300009092 Bacteria 702
115 Ga0105240_11335912 3300009093 Unclassified 755
116 Ga0105247_10158913 3300009101 Bacteria 1495
117 Ga0105247_10635545 3300009101 Bacteria 796
118 Ga0114129_10006439 3300009147 Bacteria 16649
119 Ga0114129_10040080 3300009147 Bacteria 6604
120 Ga0114129_10284183 3300009147 Bacteria 2210
121 Ga0114129_10556638 3300009147 Bacteria 1491
122 Ga0114129_11324373 3300009147 Bacteria 892
123 Ga0114129_12031131 3300009147 Bacteria 695
124 Ga0105243_10036285 3300009148 Bacteria 3826
125 Ga0105242_10121031 3300009176 Bacteria 2246
126 Ga0105248_10112271 3300009177 Bacteria 3074
127 Ga0105237_10125330 3300009545 Bacteria 2563
128 Ga0105238_11430308 3300009551 Unclassified 719
129 Ga0105249_11042110 3300009553 Bacteria 887
130 Ga0105239_10611220 3300010375 Bacteria 1244
131 Ga0105246_10036315 3300011119 Bacteria 3300
132 Ga0105246_10358799 3300011119 Bacteria 1197
133 Ga0105246_10597182 3300011119 Bacteria 953
134 Ga0157369_10221019 3300013105 Bacteria 1983
135 Ga0157374_10033678 3300013296 Bacteria 4676
136 Ga0157378_10245619 3300013297 Bacteria 1712
137 Ga0163162_11379162 3300013306 Bacteria 802
138 Ga0163162_12065482 3300013306 Bacteria 653
139 Ga0157375_10534407 3300013308 Bacteria 1335
140 Ga0157375_10802629 3300013308 Bacteria 1090
141 Ga0163163_10020293 3300014325 Bacteria 6255
142 Ga0163163_11165971 3300014325 Bacteria 833
143 Ga0157380_10791202 3300014326 Unclassified 964
144 Ga0157377_10008495 3300014745 Bacteria 5011
145 Ga0157379_10180479 3300014968 Bacteria 1907
146 Ga0163161_10063701 3300017792 Bacteria 2688
147 Ga0163161_10365160 3300017792 Bacteria 1151
148 Ga0206354_10676461 3300020081 Bacteria 1970
149 Ga0207426_1094157 3300025302 Bacteria 786
150 Ga0207653_10061507 3300025885 Bacteria 1267
151 Ga0207682_10322092 3300025893 Bacteria 726
152 Ga0207692_10158670 3300025898 Bacteria 1302
153 Ga0207642_10004713 3300025899 Bacteria 4406
154 Ga0207710_10114543 3300025900 Bacteria 1283
155 Ga0207688_10006024 3300025901 Bacteria 6597
156 Ga0207680_10439726 3300025903 Bacteria 925
157 Ga0207685_10047072 3300025905 Bacteria 1644
158 Ga0207685_10222525 3300025905 Bacteria 898
159 Ga0207645_10022887 3300025907 Bacteria 4061
160 Ga0207643_10001376 3300025908 Bacteria 14012
161 Ga0207705_10573329 3300025909 Bacteria 877
162 Ga0207684_10188981 3300025910 Bacteria 1776
163 Ga0207707_11007557 3300025912 Bacteria 683
164 Ga0207695_10483857 3300025913 Bacteria 1120
165 Ga0207671_10034432 3300025914 Bacteria 3762
166 Ga0207693_10020866 3300025915 Bacteria 5208
167 Ga0207663_10474799 3300025916 Bacteria 968
168 Ga0207662_10001115 3300025918 Bacteria 12619
169 Ga0207657_10100189 3300025919 Bacteria 2405
170 Ga0207646_10082986 3300025922 Bacteria 2866
171 Ga0207650_10023922 3300025925 Bacteria 4337
172 Ga0207687_10173736 3300025927 Bacteria 1664
173 Ga0207700_10122759 3300025928 Bacteria 2108
174 Ga0207700_10124134 3300025928 Bacteria 2097
175 Ga0207664_10294323 3300025929 Bacteria 1427
176 Ga0207706_10007664 3300025933 Bacteria 9974
177 Ga0207686_10007563 3300025934 Bacteria 5851
178 Ga0207669_10056403 3300025937 Bacteria 2385
179 Ga0207704_10013767 3300025938 Bacteria 4062
180 Ga0207665_10348827 3300025939 Bacteria 1117
181 Ga0207691_10000891 3300025940 Bacteria 29595
182 Ga0207711_10062736 3300025941 Bacteria 3206
183 Ga0207689_10005518 3300025942 Bacteria 11304
184 Ga0207667_10231007 3300025949 Bacteria 1894
185 Ga0207651_10193480 3300025960 Bacteria 1624
186 Ga0207640_10150841 3300025981 Bacteria 1707
187 Ga0207639_10597609 3300026041 Bacteria 1017
188 Ga0207678_10007226 3300026067 Bacteria 9845
189 Ga0207708_10004654 3300026075 Bacteria 10098
190 Ga0207702_10313399 3300026078 Bacteria 1492
191 Ga0207702_11098829 3300026078 Bacteria 789
192 Ga0207648_10010288 3300026089 Bacteria 8882
193 Ga0207676_10005651 3300026095 Bacteria 8853
194 Ga0207675_100008886 3300026118 Bacteria 9426
195 Ga0207683_10003367 3300026121 Bacteria 13935
196 Ga0207683_11415613 3300026121 Bacteria 643
197 Ga0207698_10010837 3300026142 Bacteria 5883
198 Ga0268266_10824272 3300028379 Bacteria 896
199 Ga0268265_11522885 3300028380 Bacteria 673
200 Ga0268264_10064281 3300028381 Bacteria 3087
201 Ga0265325_10001027 3300031241 Bacteria 20100
202 Ga0265325_10320453 3300031241 Unclassified 689
203 Ga0307513_10084381 3300031456 Bacteria 3263
204 Ga0373944_0005166 3300035089 Bacteria 3431
205 Ga0373944_0062190 3300035089 Bacteria 1200
206 Ga0373949_0100083 3300035090 Bacteria 793
207 Ga0373952_0085240 3300035092 Bacteria 813
208 Ga0373936_0134579 3300035113 Bacteria 1064
209 Ga0373945_0033624 3300035116 Bacteria 1823
210 Ga0373943_0025020 3300035170 Bacteria 2787
211 Ga0373943_0059549 3300035170 Bacteria 1904
212 Ga0373946_0104896 3300035171 Bacteria 1272
213 Ga0373961_0066854 3300035241 Bacteria 1104
214 Ga0373962_0050300 3300035242 Bacteria 1200
215 Ga0373931_0009523 3300035691 Bacteria 4644
216 Ga0373927_0018356 3300035695 Bacteria 4597
217 Ga0373927_0139248 3300035695 Bacteria 1587
218 Ga0373927_0176893 3300035695 Bacteria 1399
219 Ga0373947_0006627 3300035725 Bacteria 6723
220 Ga0373937_0607640 3300036401 Bacteria 1038
221 Ga0373925_0017506 3300037068 Bacteria 5195
222 Ga0373925_0040249 3300037068 Bacteria 3460
223 Ga0395899_0008886 3300037312 Bacteria 7735
224 Ga0395900_0004593 3300037418 Bacteria 14573
225 Ga0395898_0021427 3300037466 Bacteria 6554
226 Ga0395901_0022525 3300038443 Bacteria 6457
227 Ga0436365_0966920 3300039437 Bacteria 1571
228 Ga0436361_0963296 3300039447 Bacteria 24549
229 Ga0436363_0824081 3300039450 Unclassified 938
230 Ga0451800_1563797 3300041459 Bacteria 610
231 Ga0495627_069338 3300046453 Bacteria 1032
232 Ga0495603_0150816 3300046455 Bacteria 1350
233 Ga0495603_0319581 3300046455 Bacteria 891
234 Ga0495590_0162696 3300046457 Bacteria 812
235 Ga0495629_0349235 3300046459 Bacteria 1009
236 Ga0495638_0039219 3300046460 Bacteria 3007
237 Ga0495638_0264086 3300046460 Bacteria 943
238 Ga0495641_0029562 3300046461 Bacteria 2639
239 Ga0495653_0358806 3300046463 Bacteria 936
240 Ga0495582_0059055 3300046473 Bacteria 2116
241 Ga0495605_0155196 3300046474 Bacteria 1019
242 Ga0495639_0059616 3300046475 Bacteria 1747
243 Ga0495662_0025689 3300046476 Bacteria 2844
244 Ga0495584_0039647 3300046491 Bacteria 2380
245 Ga0495584_0049573 3300046491 Bacteria 2116
246 Ga0495584_0281125 3300046491 Bacteria 846
247 Ga0495584_0395129 3300046491 Bacteria 703
248 Ga0495585_0122512 3300046492 Bacteria 1375
249 Ga0495585_0137746 3300046492 Bacteria 1280
250 Ga0495594_0169458 3300046499 Bacteria 1242
251 Ga0495594_0222523 3300046499 Bacteria 1076
252 Ga0495596_0114505 3300046500 Bacteria 1047
253 Ga0495607_0099483 3300046501 Bacteria 1560
254 Ga0495607_0156477 3300046501 Bacteria 1162
255 Ga0495608_0332568 3300046511 Bacteria 937
256 Ga0495618_0077819 3300046514 Bacteria 2114
257 Ga0495620_0362581 3300046515 Bacteria 549
258 Ga0495628_0255262 3300046516 Bacteria 1308
259 Ga0495630_0257105 3300046517 Bacteria 1334
260 Ga0495632_0199691 3300046519 Bacteria 911
261 Ga0495644_0007070 3300046523 Bacteria 4341
262 Ga0495644_0056647 3300046523 Bacteria 1473
263 Ga0495642_0066437 3300046528 Bacteria 1503
264 Ga0495642_0229662 3300046528 Bacteria 811
265 Ga0495652_0432072 3300046529 Bacteria 926
266 Ga0495621_0024219 3300046539 Bacteria 2026
267 Ga0495633_0031452 3300046558 Bacteria 2572
268 Ga0495611_0214903 3300046648 Bacteria 895
269 Ga0495659_0061694 3300046664 Bacteria 1386
270 Ga0495659_0141264 3300046664 Bacteria 961
271 Ga0495588_0112385 3300046674 Bacteria 1435
272 Ga0495658_0021757 3300046683 Bacteria 3384
273 Ga0495669_0150882 3300046684 Bacteria 1100
274 Ga0495670_0282706 3300046691 Bacteria 887
275 Ga0495671_0116072 3300046692 Bacteria 1307
276 Ga0495649_0078015 3300046694 Bacteria 1773
277 Ga0495589_0190245 3300046794 Bacteria 971
278 Ga0495581_0336699 3300047315 Bacteria 881
279 Ga0495674_0336791 3300047319 Bacteria 1227
280 Ga0495672_0051811 3300047320 Bacteria 2415
281 Ga0495672_0192134 3300047320 Bacteria 1026
282 Ga0495676_0061913 3300047321 Bacteria 2924
283 Ga0495676_0302386 3300047321 Bacteria 1078
284 Ga0495677_0109436 3300047445 Bacteria 1050
285 Ga0495679_040377 3300047446 Bacteria 1451
286 Ga0495593_0060431 3300047673 Bacteria 1984
287 Ga0495614_0096241 3300048089 Bacteria 1291
288 Ga0496100_0017691 3300048903 Bacteria 4213
289 Ga0496100_0040106 3300048903 Bacteria 2977
290 Ga0496100_0267800 3300048903 Bacteria 1269
291 Ga0496101_0040705 3300048904 Bacteria 3310
292 Ga0496101_0398771 3300048904 Bacteria 1083
293 Ga0496101_0598658 3300048904 Bacteria 871
294 Ga0496102_0104394 3300048905 Bacteria 2636
295 Ga0496102_0372945 3300048905 Bacteria 1343
296 Ga0496102_0441243 3300048905 Bacteria 1221
297 Ga0496103_0004987 3300048906 Bacteria 8006
298 Ga0496103_0035715 3300048906 Bacteria 3043
299 Ga0496104_0000922 3300048907 Bacteria 25212
300 Ga0496104_0002867 3300048907 Bacteria 14866
301 Ga0496104_0015357 3300048907 Bacteria 6934
302 Ga0496104_0017234 3300048907 Bacteria 6573
303 Ga0496104_0220424 3300048907 Bacteria 1809
304 Ga0496105_0006102 3300048908 Bacteria 9223
305 Ga0496105_0010204 3300048908 Bacteria 7382
306 Ga0496105_0038034 3300048908 Bacteria 3964
307 Ga0496105_0278760 3300048908 Bacteria 1348
308 Ga0496106_0171741 3300048909 Bacteria 1718
309 Ga0496106_0203937 3300048909 Bacteria 1574
310 Ga0496106_0232354 3300048909 Bacteria 1472
311 Ga0496107_0003916 3300048910 Bacteria 10008
312 Ga0496107_0108491 3300048910 Bacteria 2039
313 Ga0496108_0008321 3300048911 Bacteria 8411
314 Ga0496108_0058899 3300048911 Bacteria 3230
315 Ga0496108_0193256 3300048911 Bacteria 1764
316 Ga0496108_0204386 3300048911 Bacteria 1714
317 Ga0496108_1300295 3300048911 Bacteria 612
318 Ga0496109_0001368 3300048912 Bacteria 20218
319 Ga0496109_0244492 3300048912 Bacteria 1689
320 Ga0496109_0364885 3300048912 Bacteria 1364
321 Ga0496109_0513449 3300048912 Bacteria 1131
322 Ga0496110_0018815 3300048913 Bacteria 5800
323 Ga0496110_0069885 3300048913 Bacteria 3110
324 Ga0496110_0084474 3300048913 Bacteria 2833
325 Ga0496110_0105380 3300048913 Bacteria 2530
326 Ga0496110_0217716 3300048913 Bacteria 1736
327 Ga0496111_0005758 3300048914 Bacteria 7998
328 Ga0496111_0089244 3300048914 Bacteria 2258
329 Ga0496111_0453609 3300048914 Bacteria 946
330 Ga0496112_0004407 3300048915 Bacteria 11912
331 Ga0496112_0148470 3300048915 Bacteria 2312
332 Ga0496112_0897719 3300048915 Bacteria 808
333 Ga0496112_1194890 3300048915 Bacteria 677
334 Ga0496113_0009550 3300048916 Bacteria 6362
335 Ga0496113_0150144 3300048916 Bacteria 1838
336 Ga0496114_0008417 3300048917 Bacteria 8169
337 Ga0496114_0017557 3300048917 Bacteria 5778
338 Ga0496114_0143294 3300048917 Bacteria 2070
339 Ga0496114_0200846 3300048917 Bacteria 1746
340 Ga0496115_0010688 3300048918 Bacteria 6865
341 Ga0496115_0138614 3300048918 Bacteria 2006
342 Ga0496115_0180341 3300048918 Bacteria 1746
343 Ga0496115_0183990 3300048918 Bacteria 1726
344 Ga0496115_0207514 3300048918 Bacteria 1618
345 Ga0501031_0398057 3300049568 Bacteria 891
346 Ga0501036_1134635 3300049572 Unclassified 638
347 Ga0501038_0589336 3300049574 Bacteria 842
348 Ga0501040_0062176 3300049576 Bacteria 2569
349 Ga0501042_0055864 3300049578 Bacteria 2818
350 Ga0501042_0364522 3300049578 Bacteria 1046
351 Ga0501046_0292631 3300049580 Bacteria 1191
352 Ga0501048_0859274 3300049582 Bacteria 652
353 Ga0501068_0236530 3300049584 Bacteria 1162
354 Ga0501068_0297032 3300049584 Bacteria 1034
355 Ga0501071_0764917 3300049587 Bacteria 744
356 Ga0501071_0811599 3300049587 Unclassified 721
357 Ga0501072_0008662 3300049588 Bacteria 7721
358 Ga0501072_0093918 3300049588 Bacteria 2383
359 Ga0501072_0102350 3300049588 Bacteria 2277
360 Ga0501073_0236267 3300049589 Bacteria 1262
361 Ga0501075_0771501 3300049591 Bacteria 732
362 Ga0501076_0095979 3300049592 Bacteria 2388
363 Ga0501076_0241546 3300049592 Bacteria 1478
364 Ga0501076_0610926 3300049592 Unclassified 900
365 Ga0501077_0049966 3300049593 Bacteria 2658
366 Ga0501077_0163445 3300049593 Bacteria 1414
367 Ga0501077_0381155 3300049593 Bacteria 901
368 Ga0501079_0444437 3300049741 Bacteria 1018
369 Ga0501079_0576555 3300049741 Bacteria 885
370 Ga0501080_1274661 3300049742 Bacteria 630
371 Ga0501081_0154563 3300049743 Bacteria 1650
372 Ga0501081_0256146 3300049743 Bacteria 1278
373 Ga0501081_0778704 3300049743 Bacteria 719
374 Ga0501083_0293035 3300049744 Bacteria 1058
375 Ga0501045_0269007 3300049824 Bacteria 1269
376 Ga0501045_0329593 3300049824 Bacteria 1136
377 nmdc:mga03n38_232014_c1 3300050490 Bacteria 968
378 nmdc:mga00v17_29178_c1 3300050491 Bacteria 3236
379 nmdc:mga00v17_776493_c1 3300050491 Bacteria 611
380 nmdc:mga0yw44_105440_c1 3300050492 Bacteria 1801
381 nmdc:mga0yw44_112825_c1 3300050492 Bacteria 1744
382 nmdc:mga0yw44_16094_c1 3300050492 Bacteria 4031
383 nmdc:mga0yw44_173975_c2 3300050492 Bacteria 1024
384 nmdc:mga0yw44_634003_c1 3300050492 Bacteria 726
385 nmdc:mga0k408_127664_c1 3300050493 Bacteria 1509
386 nmdc:mga04h51_281674_c1 3300050495 Bacteria 673
387 nmdc:mga07m45_305784_c1 3300050496 Bacteria 925
388 nmdc:mga07m45_445778_c1 3300050496 Bacteria 751
389 nmdc:mga07m45_59617_c1 3300050496 Bacteria 2159
390 nmdc:mga05p37_111585_c1 3300050507 Bacteria 3363
391 nmdc:mga05p37_8353_c1 3300050507 Bacteria 12241
392 nmdc:mga09592_189545_c1 3300050508 Bacteria 1780
393 nmdc:mga0qj67_343752_c1 3300050509 Bacteria 1207
394 nmdc:mga06r32_207457_c1 3300050510 Bacteria 1947
395 nmdc:mga06r32_58439_c1 3300050510 Bacteria 3706
396 nmdc:mga06r32_66769_c1 3300050510 Bacteria 3471
397 nmdc:mga08y16_340295_c1 3300050511 Bacteria 1542
398 nmdc:mga08y16_521526_c1 3300050511 Bacteria 1205
399 nmdc:mga0n895_23105_c1 3300050512 Bacteria 5840
400 nmdc:mga0n895_312309_c1 3300050512 Bacteria 1593
401 nmdc:mga0rr50_204597_c1 3300050513 Bacteria 1624
402 nmdc:mga0a205_33635_c1 3300050515 Bacteria 4027
403 nmdc:mga0a205_494579_c1 3300050515 Bacteria 1080
404 nmdc:mga0a205_582011_c1 3300050515 Bacteria 973
405 nmdc:mga0sz30_110323_c1 3300050516 Bacteria 1206
406 nmdc:mga0sz30_43248_c1 3300050516 Bacteria 1896
407 Ga0495601_0114648 3300053077 Bacteria 1747
408 Ga0495612_0104129 3300053078 Bacteria 1210
409 Ga0495655_0014988 3300053083 Bacteria 1638
410 Ga0495619_0040342 3300053085 Bacteria 3052
411 Ga0495619_0088662 3300053085 Bacteria 2092
412 Ga0495619_0172401 3300053085 Bacteria 1496
413 Ga0500643_078534 3300053087 Bacteria 909
414 Ga0500641_0044009 3300053096 Bacteria 1814
415 Ga0500654_137730 3300053099 Bacteria 901
416 Ga0500562_210737 3300053108 Bacteria 526
417 Ga0500642_0069105 3300053130 Bacteria 1604
418 Ga0500652_334458 3300053131 Bacteria 577
419 Ga0500577_0129657 3300053142 Bacteria 1056
420 Ga0500588_0060307 3300053146 Bacteria 1214
421 Ga0500616_0033711 3300053153 Bacteria 2793
422 Ga0500622_0261354 3300053156 Bacteria 755
423 Ga0501084_0038911 3300054114 Bacteria 3977
424 Ga0501084_0196763 3300054114 Bacteria 1701
425 Ga0501084_0685176 3300054114 Bacteria 865
426 Ga0501082_0136789 3300060353 Bacteria 2126
427 Ga0501082_0298412 3300060353 Bacteria 1403
428 Ga0501082_0758640 3300060353 Bacteria 849
429 Ga0501082_0778413 3300060353 Bacteria 837
430 Ga0530510_0099895 3300061734 Bacteria 2122
431 Ga0530510_0127610 3300061734 Bacteria 1870

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041459 Ga0451800_1563797 Ga0451800_1563797_72_512 146
2 3300053099 Ga0500654_137730 Ga0500654_137730_440_886 148
3 3300005937 Ga0081455_10029277 Ga0081455_100292773 149
4 3300009093 Ga0105240_11335912 Ga0105240_113359121 149
5 3300009551 Ga0105238_11430308 Ga0105238_114303082 149
6 3300050513 nmdc:mga0rr50_204597_c1 nmdc:mga0rr50_204597_c1_20_469 149
7 3300053131 Ga0500652_334458 Ga0500652_334458_116_565 149
8 3300006195 Ga0075366_10152562 Ga0075366_101525622 155
9 3300050493 nmdc:mga0k408_127664_c1 nmdc:mga0k408_127664_c1_908_1471 155
10 3300053108 Ga0500562_210737 Ga0500562_210737_21_506 159
11 3300037312 Ga0395899_0008886 Ga0395899_0008886_4941_5450 163
12 3300037418 Ga0395900_0004593 Ga0395900_0004593_10433_10942 163
13 3300037466 Ga0395898_0021427 Ga0395898_0021427_2414_2923 163
14 3300038443 Ga0395901_0022525 Ga0395901_0022525_5577_6086 163
15 3300014326 Ga0157380_10791202 Ga0157380_107912021 166
16 3300050496 nmdc:mga07m45_59617_c1 nmdc:mga07m45_59617_c1_68_586 166
17 3300005340 Ga0070689_100836996 Ga0070689_1008369962 167
18 3300006186 Ga0075369_10018992 Ga0075369_100189922 167
19 3300048905 Ga0496102_0372945 Ga0496102_0372945_752_1255 167
20 3300050516 nmdc:mga0sz30_43248_c1 nmdc:mga0sz30_43248_c1_1170_1679 167
21 3300053087 Ga0500643_078534 Ga0500643_078534_23_553 167
22 3300053153 Ga0500616_0033711 Ga0500616_0033711_2052_2582 167
23 3300005617 Ga0068859_100833025 Ga0068859_1008330252 168
24 3300006042 Ga0075368_10087276 Ga0075368_100872762 168
25 3300006178 Ga0075367_10658529 Ga0075367_106585291 168
26 3300006931 Ga0097620_100833182 Ga0097620_1008331822 168
27 3300025302 Ga0207426_1094157 Ga0207426_10941572 168
28 3300031456 Ga0307513_10084381 Ga0307513_100843814 168
29 3300046460 Ga0495638_0039219 Ga0495638_0039219_1619_2131 168
30 3300047320 Ga0495672_0192134 Ga0495672_0192134_202_714 168
31 3300049587 Ga0501071_0811599 Ga0501071_0811599_10_522 168
32 3300050495 nmdc:mga04h51_281674_c1 nmdc:mga04h51_281674_c1_143_655 168
33 3300053096 Ga0500641_0044009 Ga0500641_0044009_883_1395 168
34 3300053130 Ga0500642_0069105 Ga0500642_0069105_449_961 168
35 3300053142 Ga0500577_0129657 Ga0500577_0129657_453_965 168
36 3300053146 Ga0500588_0060307 Ga0500588_0060307_253_768 168
37 3300053156 Ga0500622_0261354 Ga0500622_0261354_72_584 168
38 3300005457 Ga0070662_101218854 Ga0070662_1012188541 169
39 3300005548 Ga0070665_100220502 Ga0070665_1002205022 169
40 3300005548 Ga0070665_100702465 Ga0070665_1007024652 169
41 3300026095 Ga0207676_10005651 Ga0207676_100056519 169
42 3300028379 Ga0268266_10824272 Ga0268266_108242722 169
43 3300039450 Ga0436363_0824081 Ga0436363_0824081_249_785 169
44 3300046460 Ga0495638_0264086 Ga0495638_0264086_186_698 169
45 3300046499 Ga0495594_0169458 Ga0495594_0169458_478_993 169
46 3300049572 Ga0501036_1134635 Ga0501036_1134635_34_579 169
47 3300049592 Ga0501076_0610926 Ga0501076_0610926_109_654 169
48 3300006844 Ga0075428_100082983 Ga0075428_1000829833 170
49 3300006847 Ga0075431_100068069 Ga0075431_1000680691 170
50 3300009147 Ga0114129_10040080 Ga0114129_100400803 170
51 3300028380 Ga0268265_11522885 Ga0268265_115228852 170
52 3300031241 Ga0265325_10320453 Ga0265325_103204531 170
53 3300048912 Ga0496109_0364885 Ga0496109_0364885_490_1005 170
54 3300049588 Ga0501072_0008662 Ga0501072_0008662_3809_4327 170
55 3300049593 Ga0501077_0049966 Ga0501077_0049966_183_698 170
56 3300049744 Ga0501083_0293035 Ga0501083_0293035_27_545 170
57 3300050507 nmdc:mga05p37_111585_c1 nmdc:mga05p37_111585_c1_2386_2949 170
58 3300050510 nmdc:mga06r32_58439_c1 nmdc:mga06r32_58439_c1_3115_3678 170
59 3300054114 Ga0501084_0038911 Ga0501084_0038911_1177_1695 170
60 3300060353 Ga0501082_0758640 Ga0501082_0758640_228_767 170
61 3300060353 Ga0501082_0778413 Ga0501082_0778413_100_618 170
62 3300061734 Ga0530510_0099895 Ga0530510_0099895_656_1195 170
63 iso_pu_bacteria 3005594810 3005598198 170
64 3300005355 Ga0070671_101401599 Ga0070671_1014015991 171
65 3300005458 Ga0070681_10219532 Ga0070681_102195322 171
66 3300005530 Ga0070679_100443137 Ga0070679_1004431371 171
67 3300005578 Ga0068854_100063153 Ga0068854_1000631534 171
68 3300005614 Ga0068856_100710164 Ga0068856_1007101642 171
69 3300005618 Ga0068864_100123022 Ga0068864_1001230223 171
70 3300005718 Ga0068866_10258284 Ga0068866_102582842 171
71 3300005983 Ga0081540_1027052 Ga0081540_10270522 171
72 3300006163 Ga0070715_10170778 Ga0070715_101707781 171
73 3300006173 Ga0070716_100654624 Ga0070716_1006546242 171
74 3300006237 Ga0097621_100603771 Ga0097621_1006037711 171
75 3300006237 Ga0097621_100612469 Ga0097621_1006124692 171
76 3300006358 Ga0068871_100547136 Ga0068871_1005471361 171
77 3300009101 Ga0105247_10635545 Ga0105247_106355451 171
78 3300009147 Ga0114129_10556638 Ga0114129_105566382 171
79 3300013105 Ga0157369_10221019 Ga0157369_102210193 171
80 3300014968 Ga0157379_10180479 Ga0157379_101804792 171
81 3300017792 Ga0163161_10365160 Ga0163161_103651602 171
82 3300020081 Ga0206354_10676461 Ga0206354_106764613 171
83 3300025905 Ga0207685_10222525 Ga0207685_102225252 171
84 3300025909 Ga0207705_10573329 Ga0207705_105733292 171
85 3300025912 Ga0207707_11007557 Ga0207707_110075571 171
86 3300025913 Ga0207695_10483857 Ga0207695_104838572 171
87 3300025939 Ga0207665_10348827 Ga0207665_103488272 171
88 3300025941 Ga0207711_10062736 Ga0207711_100627363 171
89 3300025949 Ga0207667_10231007 Ga0207667_102310071 171
90 3300025981 Ga0207640_10150841 Ga0207640_101508412 171
91 3300026078 Ga0207702_11098829 Ga0207702_110988292 171
92 3300031241 Ga0265325_10001027 Ga0265325_100010275 171
93 3300035090 Ga0373949_0100083 Ga0373949_0100083_141_668 171
94 3300035171 Ga0373946_0104896 Ga0373946_0104896_530_1057 171
95 3300035241 Ga0373961_0066854 Ga0373961_0066854_122_643 171
96 3300035242 Ga0373962_0050300 Ga0373962_0050300_351_872 171
97 3300035691 Ga0373931_0009523 Ga0373931_0009523_4032_4559 171
98 3300035695 Ga0373927_0176893 Ga0373927_0176893_398_925 171
99 3300036401 Ga0373937_0607640 Ga0373937_0607640_443_961 171
100 3300037068 Ga0373925_0040249 Ga0373925_0040249_2916_3443 171
101 3300046455 Ga0495603_0319581 Ga0495603_0319581_232_759 171
102 3300046491 Ga0495584_0395129 Ga0495584_0395129_16_543 171
103 3300046664 Ga0495659_0061694 Ga0495659_0061694_817_1344 171
104 3300046683 Ga0495658_0021757 Ga0495658_0021757_2753_3280 171
105 3300048904 Ga0496101_0398771 Ga0496101_0398771_85_606 171
106 3300048905 Ga0496102_0104394 Ga0496102_0104394_359_880 171
107 3300048907 Ga0496104_0015357 Ga0496104_0015357_5283_5810 171
108 3300048908 Ga0496105_0038034 Ga0496105_0038034_1966_2493 171
109 3300048909 Ga0496106_0203937 Ga0496106_0203937_328_849 171
110 3300048910 Ga0496107_0108491 Ga0496107_0108491_128_649 171
111 3300048911 Ga0496108_0204386 Ga0496108_0204386_807_1328 171
112 3300048912 Ga0496109_0244492 Ga0496109_0244492_196_717 171
113 3300048913 Ga0496110_0069885 Ga0496110_0069885_491_1012 171
114 3300048914 Ga0496111_0089244 Ga0496111_0089244_919_1440 171
115 3300048915 Ga0496112_0148470 Ga0496112_0148470_897_1418 171
116 3300048916 Ga0496113_0150144 Ga0496113_0150144_606_1127 171
117 3300048917 Ga0496114_0017557 Ga0496114_0017557_4278_4799 171
118 3300048918 Ga0496115_0183990 Ga0496115_0183990_383_904 171
119 3300049574 Ga0501038_0589336 Ga0501038_0589336_11_526 171
120 3300049578 Ga0501042_0055864 Ga0501042_0055864_479_994 171
121 3300049584 Ga0501068_0236530 Ga0501068_0236530_526_1041 171
122 3300049589 Ga0501073_0236267 Ga0501073_0236267_144_659 171
123 3300049591 Ga0501075_0771501 Ga0501075_0771501_160_687 171
124 3300049743 Ga0501081_0154563 Ga0501081_0154563_295_810 171
125 3300060353 Ga0501082_0136789 Ga0501082_0136789_270_785 171
126 3300005343 Ga0070687_100024924 Ga0070687_1000249242 172
127 3300006038 Ga0075365_10698792 Ga0075365_106987921 172
128 3300006042 Ga0075368_10258810 Ga0075368_102588101 172
129 3300006051 Ga0075364_10223462 Ga0075364_102234622 172
130 3300006178 Ga0075367_10125600 Ga0075367_101256002 172
131 3300006178 Ga0075367_10187182 Ga0075367_101871821 172
132 3300006178 Ga0075367_10346415 Ga0075367_103464152 172
133 3300006186 Ga0075369_10180424 Ga0075369_101804241 172
134 3300006195 Ga0075366_10143448 Ga0075366_101434483 172
135 3300006871 Ga0075434_100037075 Ga0075434_1000370753 172
136 3300009147 Ga0114129_12031131 Ga0114129_120311311 172
137 3300050490 nmdc:mga03n38_232014_c1 nmdc:mga03n38_232014_c1_113_646 172
138 3300050492 nmdc:mga0yw44_112825_c1 nmdc:mga0yw44_112825_c1_1144_1677 172
139 3300050496 nmdc:mga07m45_305784_c1 nmdc:mga07m45_305784_c1_224_757 172
140 3300050510 nmdc:mga06r32_207457_c1 nmdc:mga06r32_207457_c1_961_1503 172
141 3300050512 nmdc:mga0n895_23105_c1 nmdc:mga0n895_23105_c1_1098_1640 172
142 3300050515 nmdc:mga0a205_33635_c1 nmdc:mga0a205_33635_c1_2092_2634 172
143 3300050516 nmdc:mga0sz30_110323_c1 nmdc:mga0sz30_110323_c1_591_1124 172
144 3300002070 JGI24750J21931_1012284 JGI24750J21931_10122842 173
145 3300002073 JGI24745J21846_1020087 JGI24745J21846_10200871 173
146 3300002244 JGI24742J22300_10008057 JGI24742J22300_100080572 173
147 3300005289 Ga0065704_10544133 Ga0065704_105441331 173
148 3300005327 Ga0070658_10644225 Ga0070658_106442251 173
149 3300005330 Ga0070690_100078154 Ga0070690_1000781542 173
150 3300005331 Ga0070670_100034946 Ga0070670_1000349462 173
151 3300005334 Ga0068869_100100839 Ga0068869_1001008392 173
152 3300005335 Ga0070666_10175890 Ga0070666_101758902 173
153 3300005338 Ga0068868_100049178 Ga0068868_1000491782 173
154 3300005340 Ga0070689_100023424 Ga0070689_1000234244 173
155 3300005344 Ga0070661_100179346 Ga0070661_1001793462 173
156 3300005347 Ga0070668_100238859 Ga0070668_1002388592 173
157 3300005353 Ga0070669_100196638 Ga0070669_1001966382 173
158 3300005353 Ga0070669_101227987 Ga0070669_1012279871 173
159 3300005354 Ga0070675_100152304 Ga0070675_1001523042 173
160 3300005355 Ga0070671_100209620 Ga0070671_1002096202 173
161 3300005364 Ga0070673_100024794 Ga0070673_1000247944 173
162 3300005365 Ga0070688_100011866 Ga0070688_1000118662 173
163 3300005365 Ga0070688_100182188 Ga0070688_1001821882 173
164 3300005366 Ga0070659_100121905 Ga0070659_1001219052 173
165 3300005367 Ga0070667_100672811 Ga0070667_1006728112 173
166 3300005435 Ga0070714_100410446 Ga0070714_1004104462 173
167 3300005436 Ga0070713_100083820 Ga0070713_1000838202 173
168 3300005437 Ga0070710_10064230 Ga0070710_100642301 173
169 3300005437 Ga0070710_10738369 Ga0070710_107383692 173
170 3300005438 Ga0070701_10005467 Ga0070701_100054671 173
171 3300005439 Ga0070711_100140184 Ga0070711_1001401843 173
172 3300005439 Ga0070711_100538694 Ga0070711_1005386941 173
173 3300005440 Ga0070705_100372178 Ga0070705_1003721782 173
174 3300005441 Ga0070700_100178061 Ga0070700_1001780612 173
175 3300005444 Ga0070694_100098761 Ga0070694_1000987613 173
176 3300005445 Ga0070708_101191730 Ga0070708_1011917301 173
177 3300005455 Ga0070663_100056034 Ga0070663_1000560343 173
178 3300005458 Ga0070681_11369220 Ga0070681_113692201 173
179 3300005459 Ga0068867_100030311 Ga0068867_1000303113 173
180 3300005466 Ga0070685_10027324 Ga0070685_100273243 173
181 3300005468 Ga0070707_100176669 Ga0070707_1001766695 173
182 3300005471 Ga0070698_100434679 Ga0070698_1004346792 173
183 3300005518 Ga0070699_100391680 Ga0070699_1003916803 173
184 3300005535 Ga0070684_100082396 Ga0070684_1000823962 173
185 3300005536 Ga0070697_100230922 Ga0070697_1002309222 173
186 3300005539 Ga0068853_100166237 Ga0068853_1001662372 173
187 3300005543 Ga0070672_100003902 Ga0070672_1000039028 173
188 3300005544 Ga0070686_100004484 Ga0070686_1000044844 173
189 3300005545 Ga0070695_100249167 Ga0070695_1002491671 173
190 3300005548 Ga0070665_100189043 Ga0070665_1001890433 173
191 3300005548 Ga0070665_100843182 Ga0070665_1008431822 173
192 3300005564 Ga0070664_100061557 Ga0070664_1000615575 173
193 3300005578 Ga0068854_100085390 Ga0068854_1000853904 173
194 3300005615 Ga0070702_100018109 Ga0070702_1000181093 173
195 3300005617 Ga0068859_100083545 Ga0068859_1000835454 173
196 3300005618 Ga0068864_100004158 Ga0068864_1000041585 173
197 3300005618 Ga0068864_100826260 Ga0068864_1008262602 173
198 3300005718 Ga0068866_10067516 Ga0068866_100675163 173
199 3300005719 Ga0068861_100089936 Ga0068861_1000899362 173
200 3300005840 Ga0068870_10227236 Ga0068870_102272361 173
201 3300005842 Ga0068858_100471917 Ga0068858_1004719172 173
202 3300005843 Ga0068860_100036934 Ga0068860_1000369345 173
203 3300005844 Ga0068862_100026700 Ga0068862_1000267005 173
204 3300005937 Ga0081455_10025579 Ga0081455_100255795 173
205 3300005981 Ga0081538_10054835 Ga0081538_100548351 173
206 3300006028 Ga0070717_10260114 Ga0070717_102601143 173
207 3300006038 Ga0075365_10007832 Ga0075365_100078323 173
208 3300006038 Ga0075365_10205423 Ga0075365_102054232 173
209 3300006048 Ga0075363_100292741 Ga0075363_1002927412 173
210 3300006175 Ga0070712_100003370 Ga0070712_1000033705 173
211 3300006175 Ga0070712_100293866 Ga0070712_1002938662 173
212 3300006177 Ga0075362_10139963 Ga0075362_101399632 173
213 3300006353 Ga0075370_10447927 Ga0075370_104479271 173
214 3300006844 Ga0075428_100059203 Ga0075428_1000592033 173
215 3300006844 Ga0075428_100061452 Ga0075428_1000614522 173
216 3300006844 Ga0075428_100321732 Ga0075428_1003217323 173
217 3300006847 Ga0075431_100273912 Ga0075431_1002739122 173
218 3300006880 Ga0075429_100129252 Ga0075429_1001292522 173
219 3300006931 Ga0097620_100083543 Ga0097620_1000835432 173
220 3300007265 Ga0099794_10197372 Ga0099794_101973722 173
221 3300009092 Ga0105250_10292972 Ga0105250_102929721 173
222 3300009101 Ga0105247_10158913 Ga0105247_101589133 173
223 3300009147 Ga0114129_10006439 Ga0114129_100064395 173
224 3300009147 Ga0114129_10284183 Ga0114129_102841834 173
225 3300009147 Ga0114129_11324373 Ga0114129_113243732 173
226 3300009148 Ga0105243_10036285 Ga0105243_100362852 173
227 3300009176 Ga0105242_10121031 Ga0105242_101210312 173
228 3300009177 Ga0105248_10112271 Ga0105248_101122714 173
229 3300009545 Ga0105237_10125330 Ga0105237_101253302 173
230 3300009553 Ga0105249_11042110 Ga0105249_110421102 173
231 3300010375 Ga0105239_10611220 Ga0105239_106112202 173
232 3300011119 Ga0105246_10036315 Ga0105246_100363152 173
233 3300011119 Ga0105246_10358799 Ga0105246_103587992 173
234 3300011119 Ga0105246_10597182 Ga0105246_105971822 173
235 3300013296 Ga0157374_10033678 Ga0157374_100336784 173
236 3300013297 Ga0157378_10245619 Ga0157378_102456192 173
237 3300013306 Ga0163162_11379162 Ga0163162_113791622 173
238 3300013306 Ga0163162_12065482 Ga0163162_120654821 173
239 3300013308 Ga0157375_10534407 Ga0157375_105344072 173
240 3300013308 Ga0157375_10802629 Ga0157375_108026292 173
241 3300014325 Ga0163163_10020293 Ga0163163_100202932 173
242 3300014325 Ga0163163_11165971 Ga0163163_111659712 173
243 3300014745 Ga0157377_10008495 Ga0157377_100084955 173
244 3300017792 Ga0163161_10063701 Ga0163161_100637012 173
245 3300025885 Ga0207653_10061507 Ga0207653_100615072 173
246 3300025893 Ga0207682_10322092 Ga0207682_103220921 173
247 3300025898 Ga0207692_10158670 Ga0207692_101586702 173
248 3300025899 Ga0207642_10004713 Ga0207642_100047133 173
249 3300025900 Ga0207710_10114543 Ga0207710_101145431 173
250 3300025901 Ga0207688_10006024 Ga0207688_100060248 173
251 3300025903 Ga0207680_10439726 Ga0207680_104397262 173
252 3300025905 Ga0207685_10047072 Ga0207685_100470722 173
253 3300025907 Ga0207645_10022887 Ga0207645_100228874 173
254 3300025908 Ga0207643_10001376 Ga0207643_100013764 173
255 3300025910 Ga0207684_10188981 Ga0207684_101889812 173
256 3300025914 Ga0207671_10034432 Ga0207671_100344324 173
257 3300025915 Ga0207693_10020866 Ga0207693_100208664 173
258 3300025916 Ga0207663_10474799 Ga0207663_104747992 173
259 3300025918 Ga0207662_10001115 Ga0207662_100011155 173
260 3300025919 Ga0207657_10100189 Ga0207657_101001892 173
261 3300025922 Ga0207646_10082986 Ga0207646_100829862 173
262 3300025925 Ga0207650_10023922 Ga0207650_100239226 173
263 3300025927 Ga0207687_10173736 Ga0207687_101737362 173
264 3300025928 Ga0207700_10122759 Ga0207700_101227593 173
265 3300025928 Ga0207700_10124134 Ga0207700_101241342 173
266 3300025929 Ga0207664_10294323 Ga0207664_102943232 173
267 3300025933 Ga0207706_10007664 Ga0207706_100076642 173
268 3300025934 Ga0207686_10007563 Ga0207686_100075634 173
269 3300025937 Ga0207669_10056403 Ga0207669_100564034 173
270 3300025938 Ga0207704_10013767 Ga0207704_100137672 173
271 3300025940 Ga0207691_10000891 Ga0207691_1000089110 173
272 3300025942 Ga0207689_10005518 Ga0207689_100055184 173
273 3300025960 Ga0207651_10193480 Ga0207651_101934801 173
274 3300026041 Ga0207639_10597609 Ga0207639_105976092 173
275 3300026067 Ga0207678_10007226 Ga0207678_100072268 173
276 3300026075 Ga0207708_10004654 Ga0207708_1000465410 173
277 3300026078 Ga0207702_10313399 Ga0207702_103133991 173
278 3300026089 Ga0207648_10010288 Ga0207648_100102886 173
279 3300026118 Ga0207675_100008886 Ga0207675_1000088866 173
280 3300026121 Ga0207683_10003367 Ga0207683_1000336710 173
281 3300026121 Ga0207683_11415613 Ga0207683_114156131 173
282 3300026142 Ga0207698_10010837 Ga0207698_100108376 173
283 3300028381 Ga0268264_10064281 Ga0268264_100642812 173
284 3300035089 Ga0373944_0005166 Ga0373944_0005166_1898_2419 173
285 3300035089 Ga0373944_0062190 Ga0373944_0062190_67_588 173
286 3300035092 Ga0373952_0085240 Ga0373952_0085240_231_752 173
287 3300035113 Ga0373936_0134579 Ga0373936_0134579_223_744 173
288 3300035116 Ga0373945_0033624 Ga0373945_0033624_1069_1590 173
289 3300035170 Ga0373943_0025020 Ga0373943_0025020_1832_2353 173
290 3300035170 Ga0373943_0059549 Ga0373943_0059549_676_1197 173
291 3300035695 Ga0373927_0018356 Ga0373927_0018356_2360_2881 173
292 3300035695 Ga0373927_0139248 Ga0373927_0139248_296_817 173
293 3300035725 Ga0373947_0006627 Ga0373947_0006627_2489_3010 173
294 3300037068 Ga0373925_0017506 Ga0373925_0017506_509_1030 173
295 3300039437 Ga0436365_0966920 Ga0436365_0966920_569_1090 173
296 3300039447 Ga0436361_0963296 Ga0436361_0963296_11804_12325 173
297 3300046453 Ga0495627_069338 Ga0495627_069338_463_984 173
298 3300046455 Ga0495603_0150816 Ga0495603_0150816_398_919 173
299 3300046457 Ga0495590_0162696 Ga0495590_0162696_276_797 173
300 3300046459 Ga0495629_0349235 Ga0495629_0349235_189_710 173
301 3300046461 Ga0495641_0029562 Ga0495641_0029562_2101_2622 173
302 3300046463 Ga0495653_0358806 Ga0495653_0358806_221_742 173
303 3300046473 Ga0495582_0059055 Ga0495582_0059055_426_947 173
304 3300046474 Ga0495605_0155196 Ga0495605_0155196_366_887 173
305 3300046475 Ga0495639_0059616 Ga0495639_0059616_59_580 173
306 3300046476 Ga0495662_0025689 Ga0495662_0025689_1138_1659 173
307 3300046491 Ga0495584_0039647 Ga0495584_0039647_1612_2133 173
308 3300046491 Ga0495584_0049573 Ga0495584_0049573_1268_1789 173
309 3300046491 Ga0495584_0281125 Ga0495584_0281125_58_582 173
310 3300046492 Ga0495585_0122512 Ga0495585_0122512_235_756 173
311 3300046492 Ga0495585_0137746 Ga0495585_0137746_436_957 173
312 3300046499 Ga0495594_0222523 Ga0495594_0222523_275_796 173
313 3300046500 Ga0495596_0114505 Ga0495596_0114505_130_651 173
314 3300046501 Ga0495607_0099483 Ga0495607_0099483_975_1496 173
315 3300046501 Ga0495607_0156477 Ga0495607_0156477_52_573 173
316 3300046511 Ga0495608_0332568 Ga0495608_0332568_180_701 173
317 3300046514 Ga0495618_0077819 Ga0495618_0077819_306_827 173
318 3300046515 Ga0495620_0362581 Ga0495620_0362581_11_532 173
319 3300046516 Ga0495628_0255262 Ga0495628_0255262_295_816 173
320 3300046517 Ga0495630_0257105 Ga0495630_0257105_493_1014 173
321 3300046519 Ga0495632_0199691 Ga0495632_0199691_143_664 173
322 3300046523 Ga0495644_0007070 Ga0495644_0007070_2060_2581 173
323 3300046523 Ga0495644_0056647 Ga0495644_0056647_97_618 173
324 3300046528 Ga0495642_0066437 Ga0495642_0066437_142_663 173
325 3300046528 Ga0495642_0229662 Ga0495642_0229662_193_714 173
326 3300046529 Ga0495652_0432072 Ga0495652_0432072_37_558 173
327 3300046539 Ga0495621_0024219 Ga0495621_0024219_449_970 173
328 3300046558 Ga0495633_0031452 Ga0495633_0031452_1295_1816 173
329 3300046648 Ga0495611_0214903 Ga0495611_0214903_207_728 173
330 3300046664 Ga0495659_0141264 Ga0495659_0141264_418_939 173
331 3300046674 Ga0495588_0112385 Ga0495588_0112385_830_1351 173
332 3300046684 Ga0495669_0150882 Ga0495669_0150882_436_957 173
333 3300046691 Ga0495670_0282706 Ga0495670_0282706_39_560 173
334 3300046692 Ga0495671_0116072 Ga0495671_0116072_213_734 173
335 3300046694 Ga0495649_0078015 Ga0495649_0078015_530_1051 173
336 3300046794 Ga0495589_0190245 Ga0495589_0190245_291_812 173
337 3300047315 Ga0495581_0336699 Ga0495581_0336699_299_820 173
338 3300047319 Ga0495674_0336791 Ga0495674_0336791_489_1010 173
339 3300047320 Ga0495672_0051811 Ga0495672_0051811_1822_2343 173
340 3300047321 Ga0495676_0061913 Ga0495676_0061913_56_577 173
341 3300047321 Ga0495676_0302386 Ga0495676_0302386_534_1055 173
342 3300047445 Ga0495677_0109436 Ga0495677_0109436_512_1033 173
343 3300047446 Ga0495679_040377 Ga0495679_040377_198_719 173
344 3300047673 Ga0495593_0060431 Ga0495593_0060431_1366_1887 173
345 3300048089 Ga0495614_0096241 Ga0495614_0096241_269_790 173
346 3300048903 Ga0496100_0017691 Ga0496100_0017691_112_633 173
347 3300048903 Ga0496100_0040106 Ga0496100_0040106_1671_2192 173
348 3300048903 Ga0496100_0267800 Ga0496100_0267800_128_661 173
349 3300048904 Ga0496101_0040705 Ga0496101_0040705_919_1440 173
350 3300048904 Ga0496101_0598658 Ga0496101_0598658_306_827 173
351 3300048905 Ga0496102_0441243 Ga0496102_0441243_415_936 173
352 3300048906 Ga0496103_0004987 Ga0496103_0004987_5253_5774 173
353 3300048906 Ga0496103_0035715 Ga0496103_0035715_576_1097 173
354 3300048907 Ga0496104_0000922 Ga0496104_0000922_5614_6153 173
355 3300048907 Ga0496104_0002867 Ga0496104_0002867_8764_9285 173
356 3300048907 Ga0496104_0017234 Ga0496104_0017234_5733_6266 173
357 3300048907 Ga0496104_0220424 Ga0496104_0220424_24_545 173
358 3300048908 Ga0496105_0006102 Ga0496105_0006102_5883_6404 173
359 3300048908 Ga0496105_0010204 Ga0496105_0010204_6282_6815 173
360 3300048908 Ga0496105_0278760 Ga0496105_0278760_650_1171 173
361 3300048909 Ga0496106_0171741 Ga0496106_0171741_229_750 173
362 3300048909 Ga0496106_0232354 Ga0496106_0232354_41_562 173
363 3300048910 Ga0496107_0003916 Ga0496107_0003916_67_588 173
364 3300048911 Ga0496108_0008321 Ga0496108_0008321_7307_7828 173
365 3300048911 Ga0496108_0058899 Ga0496108_0058899_2150_2683 173
366 3300048911 Ga0496108_0193256 Ga0496108_0193256_1042_1563 173
367 3300048911 Ga0496108_1300295 Ga0496108_1300295_52_573 173
368 3300048912 Ga0496109_0001368 Ga0496109_0001368_4505_5026 173
369 3300048912 Ga0496109_0513449 Ga0496109_0513449_394_927 173
370 3300048913 Ga0496110_0018815 Ga0496110_0018815_4259_4780 173
371 3300048913 Ga0496110_0084474 Ga0496110_0084474_2134_2655 173
372 3300048913 Ga0496110_0105380 Ga0496110_0105380_676_1209 173
373 3300048913 Ga0496110_0217716 Ga0496110_0217716_308_829 173
374 3300048914 Ga0496111_0005758 Ga0496111_0005758_4505_5026 173
375 3300048914 Ga0496111_0453609 Ga0496111_0453609_321_854 173
376 3300048915 Ga0496112_0004407 Ga0496112_0004407_5509_6030 173
377 3300048915 Ga0496112_0897719 Ga0496112_0897719_158_679 173
378 3300048915 Ga0496112_1194890 Ga0496112_1194890_112_645 173
379 3300048916 Ga0496113_0009550 Ga0496113_0009550_1052_1573 173
380 3300048917 Ga0496114_0008417 Ga0496114_0008417_3928_4449 173
381 3300048917 Ga0496114_0143294 Ga0496114_0143294_419_940 173
382 3300048917 Ga0496114_0200846 Ga0496114_0200846_424_963 173
383 3300048918 Ga0496115_0010688 Ga0496115_0010688_3240_3761 173
384 3300048918 Ga0496115_0138614 Ga0496115_0138614_1272_1811 173
385 3300048918 Ga0496115_0180341 Ga0496115_0180341_186_719 173
386 3300048918 Ga0496115_0207514 Ga0496115_0207514_989_1510 173
387 3300049568 Ga0501031_0398057 Ga0501031_0398057_358_879 173
388 3300049576 Ga0501040_0062176 Ga0501040_0062176_1010_1531 173
389 3300049578 Ga0501042_0364522 Ga0501042_0364522_498_1019 173
390 3300049580 Ga0501046_0292631 Ga0501046_0292631_285_806 173
391 3300049582 Ga0501048_0859274 Ga0501048_0859274_91_612 173
392 3300049584 Ga0501068_0297032 Ga0501068_0297032_449_970 173
393 3300049587 Ga0501071_0764917 Ga0501071_0764917_111_632 173
394 3300049588 Ga0501072_0093918 Ga0501072_0093918_870_1391 173
395 3300049588 Ga0501072_0102350 Ga0501072_0102350_552_1073 173
396 3300049592 Ga0501076_0095979 Ga0501076_0095979_863_1384 173
397 3300049592 Ga0501076_0241546 Ga0501076_0241546_444_965 173
398 3300049593 Ga0501077_0163445 Ga0501077_0163445_508_1029 173
399 3300049593 Ga0501077_0381155 Ga0501077_0381155_297_818 173
400 3300049741 Ga0501079_0444437 Ga0501079_0444437_100_621 173
401 3300049741 Ga0501079_0576555 Ga0501079_0576555_305_826 173
402 3300049742 Ga0501080_1274661 Ga0501080_1274661_78_599 173
403 3300049743 Ga0501081_0256146 Ga0501081_0256146_350_871 173
404 3300049743 Ga0501081_0778704 Ga0501081_0778704_157_678 173
405 3300049824 Ga0501045_0269007 Ga0501045_0269007_176_697 173
406 3300049824 Ga0501045_0329593 Ga0501045_0329593_491_1012 173
407 3300050491 nmdc:mga00v17_29178_c1 nmdc:mga00v17_29178_c1_2069_2590 173
408 3300050491 nmdc:mga00v17_776493_c1 nmdc:mga00v17_776493_c1_28_549 173
409 3300050492 nmdc:mga0yw44_105440_c1 nmdc:mga0yw44_105440_c1_685_1206 173
410 3300050492 nmdc:mga0yw44_16094_c1 nmdc:mga0yw44_16094_c1_692_1213 173
411 3300050492 nmdc:mga0yw44_173975_c2 nmdc:mga0yw44_173975_c2_69_590 173
412 3300050492 nmdc:mga0yw44_634003_c1 nmdc:mga0yw44_634003_c1_88_609 173
413 3300050496 nmdc:mga07m45_445778_c1 nmdc:mga07m45_445778_c1_60_581 173
414 3300050507 nmdc:mga05p37_8353_c1 nmdc:mga05p37_8353_c1_2847_3368 173
415 3300050508 nmdc:mga09592_189545_c1 nmdc:mga09592_189545_c1_685_1206 173
416 3300050509 nmdc:mga0qj67_343752_c1 nmdc:mga0qj67_343752_c1_455_976 173
417 3300050510 nmdc:mga06r32_66769_c1 nmdc:mga06r32_66769_c1_628_1149 173
418 3300050511 nmdc:mga08y16_340295_c1 nmdc:mga08y16_340295_c1_112_633 173
419 3300050511 nmdc:mga08y16_521526_c1 nmdc:mga08y16_521526_c1_128_649 173
420 3300050512 nmdc:mga0n895_312309_c1 nmdc:mga0n895_312309_c1_536_1057 173
421 3300050515 nmdc:mga0a205_494579_c1 nmdc:mga0a205_494579_c1_413_934 173
422 3300050515 nmdc:mga0a205_582011_c1 nmdc:mga0a205_582011_c1_145_666 173
423 3300053077 Ga0495601_0114648 Ga0495601_0114648_1038_1559 173
424 3300053078 Ga0495612_0104129 Ga0495612_0104129_215_736 173
425 3300053083 Ga0495655_0014988 Ga0495655_0014988_1000_1521 173
426 3300053085 Ga0495619_0040342 Ga0495619_0040342_1348_1869 173
427 3300053085 Ga0495619_0088662 Ga0495619_0088662_1288_1809 173
428 3300053085 Ga0495619_0172401 Ga0495619_0172401_705_1226 173
429 3300054114 Ga0501084_0196763 Ga0501084_0196763_348_869 173
430 3300054114 Ga0501084_0685176 Ga0501084_0685176_154_675 173
431 3300060353 Ga0501082_0298412 Ga0501082_0298412_291_812 173
432 3300061734 Ga0530510_0127610 Ga0530510_0127610_530_1051 173

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07987

DUF1775

Domain of unkown function (DUF1775)

38

184

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7me6-assembly1.cif.gz_A structure of the apo form of ycni 0.8206 22 169
7me6-assembly1.cif.gz_A structure of the apo form of ycni 0.7971 22 169
3esm-assembly1.cif.gz_A-2 crystal structure of an uncharacterized protein from nocardia farcinica reveals an immunoglobulin-like fold 0.7519 22 170
3esm-assembly1.cif.gz_A-2 crystal structure of an uncharacterized protein from nocardia farcinica reveals an immunoglobulin-like fold 0.7318 22 170
1nug-assembly1.cif.gz_A role of calcium ions in the activation and activity of the transglutaminase 3 enzyme (2 calciums, 1 mg, inactive form) 0.6986 23 170
ID Description Score Start End Superfamily
3esmA00 Mainly Beta;Sandwich;Immunoglobulin-like;Uncharacterised protein YcnI-like PF07987, DUF1775 0.7519 22 170 2.60.40.2230
3esmA00 Mainly Beta;Sandwich;Immunoglobulin-like;Uncharacterised protein YcnI-like PF07987, DUF1775 0.7318 22 170 2.60.40.2230
af_Q08189_594_692_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7005 23 169 2.60.40.10
af_A0A2R8PX12_582_681_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6937 22 170 2.60.40.10
af_A0A2R8PX12_582_681_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6827 22 170 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A436FF66-F1-model_v4 DUF1775 domain-containing protein 0.974 36 173
AF-A0A530GDL3-F1-model_v4 DUF1775 domain-containing protein 0.9701 36 123
AF-A0A7X6IQS5-F1-model_v4 deleted 0.9674 31 158
AF-A0A4R9Q028-F1-model_v4 DUF1775 domain-containing protein 0.9646 57 164
AF-A0A5P9K1Z7-F1-model_v4 DUF1775 domain-containing protein 0.9642 21 171

Feature Viewer

pLDDT pTM Quality
88.2 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map